GenomeNet

Database: Pfam
Entry: Baculo_E25
LinkDB: Baculo_E25
Original site: Baculo_E25 
#=GF ID   Baculo_E25
#=GF AC   PF05274.8
#=GF DE   Occlusion-derived virus envelope protein E25
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_6633 (release 7.7)
#=GF GA   20.70 20.70;
#=GF TC   325.90 325.70;
#=GF NC   20.30 17.70;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9108103
#=GF RT   N-terminal sequences from Autographa californica nuclear
#=GF RT   polyhedrosis virus envelope proteins ODV-E66 and ODV-E25 are
#=GF RT   sufficient to direct reporter proteins to the nuclear envelope,
#=GF RT   intranuclear microvesicles and the envelope of occlusion derived
#=GF RT   virus. 
#=GF RA   Hong T, Summers MD, Braunagel SC; 
#=GF RL   Proc Natl Acad Sci U S A 1997;94:4050-4055.
#=GF DR   INTERPRO; IPR007938;
#=GF CC   This family consists of several nucleopolyhedrovirus
#=GF CC   occlusion-derived virus envelope E25 proteins.
#=GF SQ   2
#=GS Q91EW4_GVCPM/35-211  AC Q91EW4.1
#=GS Q8B9G4_NPVR1/36-225  AC Q8B9G4.1
Q91EW4_GVCPM/35-211             SSGDSIQFTPDGRANVRFNNARVKNVRISHGDNNFSKVSVTESPVRYEQIIEQG-DRIGANTVFMGVV-DEPLSGVNAAHRASN--------NFVIKKFKNLFIVFKGVEYSEIDSNNLMVRYESNKMVYALIDASNSTLPEL-LRDVSYPICVL--TNNSSAQLVLKEWGYTQINDSATLFVKNEKSFR
Q8B9G4_NPVR1/36-225             QSSDSVELNETKQLNVKLNNGRVANLRIAHGDNKLSQVYIAEKPLSIDDIVKEGSNKVGTNSVFLGTVYDYGIKSPNAASTSSNVTMTRGAANFDIKEFKSMFIVFKGVTPTKTVEDNGMLRFEVDNMIVCLIDPNTAPLSEREVRELRKSNCTLVYTRNAAAQQILLENNFTVINAEQTAYLKNYKSYR
#=GC seq_cons                   pSuDSlphs.stphNV+hNNuRVtNlRIuHGDNphSpV.lsEpPlph-pIlcpG.s+lGsNoVFhGsV.D.slpusNAAppuSN........NFsIKcFKshFIVFKGVp.ochspsNhMlRaEsspMlhsLIDsssusLsEh.lR-lphs.CsL..TpNuuAQ.lLhE.saT.INsptThalKN.KSaR
//
DBGET integrated database retrieval system