GenomeNet

Database: Pfam
Entry: Baculo_RING
LinkDB: Baculo_RING
Original site: Baculo_RING 
#=GF ID   Baculo_RING
#=GF AC   PF05883.8
#=GF DE   Baculovirus U-box/Ring-like domain
#=GF PI   DUF855; 
#=GF AU   Moxon SJ, Bateman A, Dlakic M
#=GF SE   Pfam-B_9633 (release 8.0)
#=GF GA   23.90 23.90;
#=GF TC   23.90 213.70;
#=GF NC   23.60 23.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR008573;
#=GF CC   This family consists of several Baculovirus proteins of around
#=GF CC   130 residues in length. The function of this family is unknown,
#=GF CC   but it appears to be related to the U-box and ring finger domain
#=GF CC   by profile-profile comparison.
#=GF SQ   2
#=GS Q8B9J7_NPVR1/1-134  AC Q8B9J7.1
#=GS Q91ES1_GVCPM/3-132  AC Q91ES1.1
Q8B9J7_NPVR1/1-134             MFCTFCLKDRNYYMFKLFKDYWPTCATECQICLEKIDD.NGGIVAMPDTGLLNLEKMFHEQCIQRWRREHTRDPFNRVIKYYFNFPPKTLEECNVMLRETKGFI...GDHEIDRVYKRVYQRVTQEDALDIELDFRHF
Q91ES1_GVCPM/3-132             FITTQTE--CKAAAELIIREQFH--TMECAICLNDINDtNRGVVYITCGGAADLERVMCKECDKRF---EKQDPYKRQIEYRFEYPFVNNEHAKVFLERSKTFVlndGDEERIEVFAKTLKSTTSG-YQDVEFPLGLT
#=GC seq_cons                  hhsT.s...pphhh.hlh+-.a...shECtICLpcIsD.NtGlVhhsssGhhsLE+hhpcpC.pRa...cppDPapR.IcYhFpaP.hs.EcspVhLccoKsFl...GDcEh.cVat+shppsTpt.h.DlEhshthh
//
DBGET integrated database retrieval system