GenomeNet

Database: Pfam
Entry: CAF-1_p150
LinkDB: CAF-1_p150
Original site: CAF-1_p150 
#=GF ID   CAF-1_p150
#=GF AC   PF11600.7
#=GF DE   Chromatin assembly factor 1 complex p150 subunit, N-terminal
#=GF AU   Pollington J
#=GF SE   pdb_1s4z
#=GF GA   23.00 23.00;
#=GF TC   23.00 23.00;
#=GF NC   22.90 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   14765118
#=GF RT   Structural basis of HP1/PXVXL motif peptide interactions and HP1
#=GF RT   localisation to heterochromatin. 
#=GF RA   Thiru A, Nietlispach D, Mott HR, Okuwaki M, Lyon D, Nielsen PR,
#=GF RA   Hirshberg M, Verreault A, Murzina NV, Laue ED; 
#=GF RL   EMBO J. 2004;23:489-499.
#=GF RN   [2]
#=GF RM   12697822
#=GF RT   The methyl-CpG binding protein MBD1 interacts with the p150
#=GF RT   subunit of chromatin  assembly factor 1.
#=GF RA   Reese BE, Bachman KE, Baylin SB, Rountree MR;
#=GF RL   Mol Cell Biol. 2003;23:3226-3236.
#=GF CC   CAF-1_p150 is a polypeptide subunit of CAF-1, which functions in
#=GF CC   depositing newly synthesised and acetylated histones H3/H4 into
#=GF CC   chromatin during DNA replication and repair [1]. CAF-1_p150
#=GF CC   includes the HP1 interaction site, the PEST, KER and ED
#=GF CC   interacting sites. CAF-1_p150 interacts directly with newly
#=GF CC   synthesised and acetylated histones through the acidic KER and
#=GF CC   ED domains. The PEST domain is associated with proteins that
#=GF CC   undergo rapid proteolysis [2].
#=GF SQ   130
#=GS I3MNS2_ICTTR/301-455      AC I3MNS2.1
#=GS A0A0Q3TNW1_AMAAE/282-445  AC A0A0Q3TNW1.1
#=GS A7F4P3_SCLS1/785-946      AC A7F4P3.1
#=GS F1S7L7_PIG/321-480        AC F1S7L7.1
#=GS A0A091ICE5_CALAN/287-450  AC A0A091ICE5.1
#=GS A0A0F8AD16_LARCR/255-421  AC A0A0F8AD16.1
#=GS M3XIX8_LATCH/306-469      AC M3XIX8.1
#=GS G3SLF5_LOXAF/345-436      AC G3SLF5.1
#=GS M4ABP2_XIPMA/235-394      AC M4ABP2.1
#=GS C4JLZ9_UNCRE/115-285      AC C4JLZ9.1
#=GS F6VDM1_CALJA/322-420      AC F6VDM1.1
#=GS H2QF16_PANTR/320-479      AC H2QF16.1
#=GS C3YNV2_BRAFL/369-543      AC C3YNV2.1
#=GS F6YQD7_XENTR/348-417      AC F6YQD7.1
#=GS CAF1A_DANRE/242-396       AC A0JMK9.1
#=GS K7FMD9_PELSI/306-469      AC K7FMD9.1
#=GS CAF1A_CHICK/293-456       AC Q5R1T0.1
#=GS M7AWT3_CHEMY/273-433      AC M7AWT3.1
#=GS A0A091R0U0_MERNU/277-440  AC A0A091R0U0.1
#=GS U3IL50_ANAPL/273-437      AC U3IL50.1
#=GS G3PN46_GASAC/1-96         AC G3PN46.1
#=GS E9IDN8_SOLIN/240-437      AC E9IDN8.1
#=GS G1QSB4_NOMLE/320-479      AC G1QSB4.1
#=GS Z4YIN8_DANRE/177-331      AC Z4YIN8.1
#=GS A0A151N058_ALLMI/58-221   AC A0A151N058.1
#=GS A0A091SJS2_9AVES/278-441  AC A0A091SJS2.1
#=GS J5RIC1_SACK1/96-259       AC J5RIC1.1
#=GS F6VDV6_CALJA/367-455      AC F6VDV6.1
#=GS A0A091LB96_9GRUI/273-436  AC A0A091LB96.1
#=GS W4YJY9_STRPU/299-469      AC W4YJY9.1
#=GS H9G514_ANOCA/261-437      AC H9G514.1
#=GS A0A093ZD96_9PEZI/83-238   AC A0A093ZD96.1
#=GS W5LF66_ASTMX/255-415      AC W5LF66.1
#=GS A0A0A0MUP9_PAPAN/320-479  AC A0A0A0MUP9.1
#=GS F6X520_CANLF/323-481      AC F6X520.1
#=GS G1MUV9_MELGA/293-455      AC G1MUV9.2
#=GS A0A094BYL8_9PEZI/83-239   AC A0A094BYL8.1
#=GS A0A091MJN7_CARIC/278-441  AC A0A091MJN7.1
#=GS C1H0H5_PARBA/128-255      AC C1H0H5.1
#=GS A0A0D8XKU5_DICVI/81-218   AC A0A0D8XKU5.1
#=GS G3XLS4_ASPNA/102-247      AC G3XLS4.1
#=GS A0A093FEW7_TAUER/277-440  AC A0A093FEW7.1
#=GS T0NQ02_CAMFR/264-415      AC T0NQ02.1
#=GS H2NX28_PONAB/319-478      AC H2NX28.1
#=GS H0YRC7_TAEGU/282-445      AC H0YRC7.1
#=GS F7F7P0_MONDO/380-539      AC F7F7P0.2
#=GS G1QFV9_MYOLU/312-385      AC G1QFV9.1
#=GS F6VEI3_MACMU/302-461      AC F6VEI3.1
#=GS A0A091NEP6_9PASS/293-456  AC A0A091NEP6.1
#=GS L8Y2Y3_TUPCH/314-473      AC L8Y2Y3.1
#=GS CAF1A_HUMAN/320-479       AC Q13111.2
#=GS R7SRJ7_DICSQ/46-137       AC R7SRJ7.1
#=GS H2VC85_TAKRU/227-396      AC H2VC85.1
#=GS A0A183B4H2_9TREM/14-170   AC A0A183B4H2.1
#=GS U3JEF1_FICAL/280-443      AC U3JEF1.1
#=GS A0A094K2L1_ANTCR/1-164    AC A0A094K2L1.1
#=GS G1MUW3_MELGA/290-451      AC G1MUW3.2
#=GS A0A087RBC0_APTFO/278-441  AC A0A087RBC0.1
#=GS T1ENS0_HELRO/71-218       AC T1ENS0.1
#=GS M3Y0Y1_MUSPF/425-584      AC M3Y0Y1.1
#=GS K7E9K7_ORNAN/11-170       AC K7E9K7.1
#=GS A0A091FRL6_CORBR/291-454  AC A0A091FRL6.1
#=GS H0WK89_OTOGA/314-473      AC H0WK89.1
#=GS W5MI24_LEPOC/244-399      AC W5MI24.1
#=GS G3VAZ2_SARHA/1-150        AC G3VAZ2.1
#=GS G3SLF5_LOXAF/298-355      AC G3SLF5.1
#=GS A0A0P7TXQ7_9TELE/197-362  AC A0A0P7TXQ7.1
#=GS F7C253_HORSE/307-466      AC F7C253.1
#=GS A0A0W7VTB4_9HYPO/101-262  AC A0A0W7VTB4.1
#=GS A0A099YY86_TINGU/287-450  AC A0A099YY86.1
#=GS A0A093JVU3_STRCA/291-454  AC A0A093JVU3.1
#=GS G1L5F6_AILME/308-467      AC G1L5F6.1
#=GS H3D6M0_TETNG/258-388      AC H3D6M0.1
#=GS A0A151WHZ7_9HYME/275-443  AC A0A151WHZ7.1
#=GS I3J2Y4_ORENI/239-403      AC I3J2Y4.1
#=GS M3WK65_FELCA/323-468      AC M3WK65.1
#=GS A0A0C7NCN7_9SACH/62-222   AC A0A0C7NCN7.1
#=GS G3HCF9_CRIGR/291-444      AC G3HCF9.1
#=GS G1PI42_MYOLU/1-141        AC G1PI42.1
#=GS A0A093FL86_GAVST/292-455  AC A0A093FL86.1
#=GS A0A091DEY6_FUKDA/295-447  AC A0A091DEY6.1
#=GS A0A091WPA8_OPIHO/292-455  AC A0A091WPA8.1
#=GS A0A091UHU8_PHALP/278-441  AC A0A091UHU8.1
#=GS V8NFM8_OPHHA/259-422      AC V8NFM8.1
#=GS Q6FN62_CANGA/71-221       AC Q6FN62.1
#=GS H2ZYI8_LATCH/323-486      AC H2ZYI8.1
#=GS U3JEF0_FICAL/283-446      AC U3JEF0.1
#=GS U7PT59_SPOS1/274-383      AC U7PT59.1
#=GS CAF1A_BOVIN/322-481       AC A6QLA6.1
#=GS A0A0L1HPH9_9PLEO/63-201   AC A0A0L1HPH9.1
#=GS G7PYM2_MACFA/284-435      AC G7PYM2.1
#=GS S6ESZ0_ZYGB2/44-203       AC S6ESZ0.1
#=GS K7EPA1_HUMAN/93-245       AC K7EPA1.8
#=GS A0A0V0R3J4_PSEPJ/117-271  AC A0A0V0R3J4.1
#=GS E7FAY6_DANRE/243-328      AC E7FAY6.1
#=GS A0A093PYY2_9PASS/267-430  AC A0A093PYY2.1
#=GS A0A091RDH2_9GRUI/292-455  AC A0A091RDH2.1
#=GS L5L8Q0_PTEAL/391-550      AC L5L8Q0.1
#=GS F6VEG2_MACMU/303-462      AC F6VEG2.1
#=GS A0A093BN37_CHAPE/292-455  AC A0A093BN37.1
#=GS A0A0F8BY49_LARCR/102-230  AC A0A0F8BY49.1
#=GS G5BZA2_HETGA/302-452      AC G5BZA2.1
#=GS CAF1A_MOUSE/299-458       AC Q9QWF0.1
#=GS A0A0F8XGQ6_9EURO/56-194   AC A0A0F8XGQ6.1
#=GS M0R3S3_RAT/301-451        AC M0R3S3.2
#=GS E7FAY6_DANRE/323-371      AC E7FAY6.1
#=GS A0A067R7P4_ZOONE/356-518  AC A0A067R7P4.1
#=GS A0A0L9SZT9_9HYPO/56-209   AC A0A0L9SZT9.1
#=GS L5MGP6_MYODS/304-463      AC L5MGP6.1
#=GS C1GJR6_PARBD/131-255      AC C1GJR6.1
#=GS A0A091VN52_NIPNI/292-455  AC A0A091VN52.1
#=GS A0A0F7ZU94_9HYPO/111-239  AC A0A0F7ZU94.1
#=GS A0A095A0T6_SCHHA/10-151   AC A0A095A0T6.1
#=GS A0A087XMB6_POEFO/256-422  AC A0A087XMB6.2
#=GS F1P5R3_CHICK/293-456      AC F1P5R3.1
#=GS I3J2Y3_ORENI/277-443      AC I3J2Y3.1
#=GS E7QAE9_YEASB/90-265       AC E7QAE9.2
#=GS Q0CE47_ASPTN/117-246      AC Q0CE47.1
#=GS F6VDM1_CALJA/418-462      AC F6VDM1.1
#=GS A0A099ZWH0_CHAVO/290-453  AC A0A099ZWH0.1
#=GS A0A091G5C5_9AVES/292-455  AC A0A091G5C5.1
#=GS F6VDV6_CALJA/322-374      AC F6VDV6.1
#=GS H0VJM6_CAVPO/382-474      AC H0VJM6.1
#=GS A0A091GX49_BUCRH/278-441  AC A0A091GX49.1
#=GS S7NZA1_MYOBR/304-463      AC S7NZA1.1
#=GS A0A091JRE8_9AVES/278-441  AC A0A091JRE8.1
#=GS W5PIZ1_SHEEP/321-480      AC W5PIZ1.1
#=GS A0A0Q3MK46_AMAAE/2-158    AC A0A0Q3MK46.1
#=GS A0A0D9RDU6_CHLSB/302-461  AC A0A0D9RDU6.1
#=GS H2MK30_ORYLA/6-102        AC H2MK30.1
I3MNS2_ICTTR/301-455                 ...................................tpvhri--TKKFVKGSTEKNR.MRPQR....-.--.------........DKEQLREEKEKLKEE...AR-.---.RA.K.EEARRKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KER..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0Q3TNW1_AMAAE/282-445             .........................................KVSQKCHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KXK..AEK.LRAKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A7F4P3_SCLS1/785-946                 ............................lvshyesfrddia-------------ER.RHEEF....D.KR.RRDAEK........ELEKQVAQRRKEFKE...RKI.REK.RE.R.EEQERKL.REE....EE..RAQ....KE..KAE.KDE......REE.KRK..AEF.AQLKAIRE.KE.RQEALE....iAALQERRAEE...AS.K.R.RAEEK............ARGPVR.GA..P.....IERS.-..D.S.T.GE........RR.A.PLAL...A.GASGKI.N----------wrekerlr....................................................
F1S7L7_PIG/321-480                   .........................................RMSNKLLKGSAEKNK.MRLQR....D.KE.RLGKQL........KLRAEKEEKEKLREE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....RE..RRE.KRE......KDE.KEK..AEK.QRRKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A091ICE5_CALAN/287-450             .........................................KVSQKCPRSSAEREK.LRLQR....D.QE.RADKLQ........KMQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PP.A.PKIL...A.SSCGKF.APFEIKENMVL............................................................
A0A0F8AD16_LARCR/255-421             ...............................kiptdqkkikRRSLKSL--------.---QE....Q.EE.RLRLQQ........EKERQKEEAKAAKEK...KKE.EAR.KM.K.EEREKEK.REK....KE..KDE....RE..KRE.KKE......KEE.KEK..AER.LKAKEEQR.KS.KLE---.....AKLEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.A.PKTL...A.AACGKF.APFEIKENVSL............................................................
M3XIX8_LATCH/306-469                 .........................................KGSQNSSKSKGLKEK.RRLEK....E.QE.REEKRK........KLQAEKEEKERLREE...VKA.VKE.RA.K.EEAKKKK.EEE....KE..QKE....KE..RKE.KKE......KEE.KEK..AEK.LRLKEEKR.KE.KQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.L..Q.K.S.KT........PQ.V.PKTL...A.GSCGKF.APFEIKENMVL............................................................
G3SLF5_LOXAF/345-436                 ........................................a---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......---.KEE..A-R.KRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEEkvl.....rakvKRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIREHMVL............................................................
M4ABP2_XIPMA/235-394                 ...............................kipaeekkikRRSLKSLQEQ-----.-----....-.EE.RLRLRQ........EKERQKEEAKAAKEK...KKE.EAR.ML.K.EEKEREK.REK....KE..KEE....RE..KRE.KKE......KEE.KEK..AER.LKAKEELR.KS.KLE---.....AKLEEKRKKE...EE.K.R.MKEEF............QRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.A.PKTL...A.AACGKF.APFEIKGNMSL............................................................
C4JLZ9_UNCRE/115-285                 ..................................egcrplv-----------KKQR.PRKKQ....G.KT.RLANFW.......eEEKQKREEEKKRREE...ERE.AEK.RR.R.EEVRKKK.EEE....KE..EEK....RK..REEeKKK......KDE.EKE..AER.-KKREEKR.KQ.KEDERI.....AREEEKKKKE...RS.Q.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------mrlnafftkpsipnstnkavepkaveesnqasasqspdtkavsdysdefppffvqshvcl
F6VDM1_CALJA/322-420                 .........................................RITKKFVKSPTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....Q---------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------r...........................................................
H2QF16_PANTR/320-479                 .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
C3YNV2_BRAFL/369-543                 ....................................rvktp----KQLAKEAELQR.KREEK....E.KE.KQEKLR........LKEEERAEKERLRSE...ARR.QKE.LE.K.EELRKKK.EEE....KR..QKE....AE..KQK.LKE......AEE.KER..QEK.LRIKEEER.KK.KQEAIE.....AKLEEKKKKE...EE.K.Q.KQEEEkkkv...eeekaRKQQKV.KA..A.....FQSF.F..V.K.P.KF........DP.AePKEE...Q.QPVGAF.MPFEVKKDMKL............................................................
F6YQD7_XENTR/348-417                 .................................seslikts---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......---.---..---.--------.--.------.....-KATTRRHKD...TN.M.N.PSHCK............KRLKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTF...A.RSCGKF.APFEIKKDMAL............................................................
CAF1A_DANRE/242-396                  ....................................ankvkRRSLKSVQEQEEKQR.QRDEK....-.--.------........--ERLKQEAKAAKEK...KKE.EAR.KM.K.EEKEREK.KEK....KE..KDE....KE..RRE.KKE......RDE.KEK..ADK.LKAKEEQR.QM.KIE---.....AKLEEKRKKE...EE.K.R.LKEEK............DRIKAE.KA..E.....ITRF.L..Q.K.P.KT........QL.A.PKTL...A.SACGKF.APFEIKAHMSL............................................................
K7FMD9_PELSI/306-469                 ........................................k-VYQKCLSSSVKKEK.LRLQR....D.QE.RADKLQ........KLQAEKEEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....RE..LKE....KE..RRE.KKE......KDE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.T.PKTL...A.GSCGKF.APFEIKENMVL............................................................
CAF1A_CHICK/293-456                  .........................................KVSQKLHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....RE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
M7AWT3_CHEMY/273-433                 ..........................qnrsdtsplaasipv---------------.---RK....D.QE.RADKLQ........KLQAEKEEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KDE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
A0A091R0U0_MERNU/277-440             .........................................KVSQKLHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRAKEERR.KE.RQEALE.....AKLEEKRKRE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
U3IL50_ANAPL/273-437                 ........................................k-VPQKFPKSSAEKEK.LRLQR....Q.TL.PERVGA........AREVHGHSRERLNLK...EAA.AAR.GA.L.EQAALCE.WAL....QV..LLV....LP..RKL.RCE......INK.KKR..EEV.NAFRESRR.SEaEQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
G3PN46_GASAC/1-96                    .......................................pr---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....-R..RSS.KSE......QEE.KVRlqQEK.ERQKEETK.AA.KMK---.....IKEEARRVAE...IK.V.R.VSNAS............QRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.P.PKTL...A.AACGKF.APFEIKEHMAL............................................................
E9IDN8_SOLIN/240-437                 .etsseldksisnrneevtenkettpatsvtpktdknikri----------KRLTP.KQLEK....R.EE.IARRKE........ERLKLKMEKEKKREE...EKA.NRR.RE.K.EEKQKEK.EEK....-E..KIE....KElkKKE.KELk...elKKQ.MEL..EQK.QKEKEARE.EE.RKKREE.....AKEEEKRKKE...DE.-.R.LEAER............KKQKAV.SN..F.....VSFF.V..P.KkQ.EV........KS.M.EEES...V.VKVKNF.MPFEIKADMR-v...........................................................
G1QSB4_NOMLE/320-479                 .........................................RITKKFVKGPTKKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKRKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
Z4YIN8_DANRE/177-331                 ....................................ankvkRRSLKSVQEQEEKQR.QRDEK....-.--.------........--ERLKQEAKAAKEK...KKE.EAR.KM.K.EEKEREK.KEK....KE..KDE....KE..RRE.KKE......RDE.KEK..ADK.LKAKEEQR.QM.KIE---.....AKLEEKRKKE...EE.K.R.LKEEK............DRIKAE.KA..E.....ITRF.L..Q.K.P.KT........QL.A.PKTL...A.SACGKF.APFEIKAHMSL............................................................
A0A151N058_ALLMI/58-221              .........................................KVSQKCHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMAL............................................................
A0A091SJS2_9AVES/278-441             .........................................KVSQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
J5RIC1_SACK1/96-259                  ...........kesigsdgnadkqrpgealsivsesksksp---------------.-----....-.--.------........SPSSKKEPSTMRKEN...AKM.E--.--.K.ELKRQQR.EEE....KH..RKEllrqAE..RRK.KEL......KTE.EER..HKR.AELKKQKE.EA.RLETKR.....RKEEEKSKKE...QE.I.R.LKEEA............KE--RA.QS..R.....IGNF.F..K.K.V.SD........SN.A.PPVE...K.SDYEKFfLPFYAKD----gvkv........................................................
F6VDV6_CALJA/367-455                 ......................................kra---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......--K.EEA..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A091LB96_9GRUI/273-436             .........................................KVSQKFHKSSAEKEK.LKLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....ARLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
W4YJY9_STRPU/299-469                 .......................................pm--SAKALQRLKEQEE.KKEEK....L.KL.REDKKR........KLEEENEMKKRQKLE...QKQ.AKE.EE.K.EAQRKEK.AEE....KK..KKE....ME..KQL.KKE......KEE.QER..MEK.KKAKEEER.LK.KQEEIE.....AKQEEKKKKQ...EE.R.-.IKQEE............EKKQKE.AA..E.....LSKK.S..K.Q.S.QVfknffsvqAQ.A.PVKK...P.EVKGWF.APFEVKSDQVL............................................................
H9G514_ANOCA/261-437                 .........................................KVSQKTHQSAEEKEK.LKLQKnildN.KE.GLRKSLlniklafaGQDQERAEKGRLKEE...AKA.AKE.RA.R.EEARRKK.EEE....KE..LKE....KE..RKE.KKE......KDE.KEK..AEK.LRVKEEKR.KE.KQEALE.....AKLEEKRKKE...EE.K.R.LKEEE...........kRRIKAE.KA..G.....ITRF.F..Q.K.P.KT........QP.V.PKTL...A.GWCGKF.APFEIKENMVL............................................................
A0A093ZD96_9PEZI/83-238              ...............................smmsgsgqpp------------KKK.PKLTY....A.EQ.EHKKILk......eIRDREKADERARKEA...EKR.DKE.HD.K.ARKDAEI.KAE....KQ..RKE....AE..REE.KRL......MKE.AEK..AEK.DKVKAEKD.KV.K----E.....AKDEEKRKKE...EE.K.Q.RHEEE............KRKKERsQK..K.....LNSF.F..I.S.Q.PA........KK.A.EK--...-.------.-----------dvspepgnaagvald.............................................
W5LF66_ASTMX/255-415                 ...................................prtdae-------QKKAKRRS.LKSAQ....EmEE.KQRQRE........ERERLKEEARAAKEK...KRE.DAR.RL.K.EEKEKEK.KEK....RE..KDE....RE..RRE.KKE......RDD.KEK..AEK.QRAKEEQR.KV.KME---.....AKLEEKRKKE...EE.K.R.LREEK............DQIKAE.KA..A.....ITRF.L..Q.K.S.KT........QL.A.PKTL...A.SVCGKF.APFEIKEHMIL............................................................
A0A0A0MUP9_PAPAN/320-479             .........................................RITKKFVKGSAEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
F6X520_CANLF/323-481                 .........................................RITKKLIKASAEKDK.LRLQR....D.KE.RLGKQL........KLRAEKEEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.-.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
G1MUV9_MELGA/293-455                 .........................................KVSQKLHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AK-.AAK.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A094BYL8_9PEZI/83-239              ...............................smmsgggqpp------------KKK.KKLTY...aE.QE.HN-KILk......eIRDREKADERARKEA...EKR.DKE.HD.K.ARKDAEI.KAE....KQ..RKE....AE..REE.KRL......MKE.AEK..AEK.DKVKAEKD.KV.K----E.....AKDEEKRKKE...EE.K.Q.RQEEE............KRKKERsQK..K.....LNSF.F..I.S.Q.PA........KK.A.EK--...-.------.-----------dvspepgnaagvaldd............................................
A0A091MJN7_CARIC/278-441             .........................................KVSQKFHKSLAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKR.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
C1H0H5_PARBA/128-255                 ............................psvpnnkkrklsp---------------.-----....-.--.------........-------ATKLAKAQ...EKE.AKE.RQ.R.AEEKAKK.EEE....KK..KRE....EE..RKK.---......-KE.EEK..EEE.RKKKEEKK.KS.KDEERL.....AREEEKRKKD...EE.K.M.KKE-R............SQMR--.--..-.....LNAF.F..V.K.P.AI........PS.S.ATAG...N.TSCGK-.-----------tmgnynvqn...................................................
A0A0D8XKU5_DICVI/81-218              ...............................malvnskmql---------------.-----....-.--.---SKK........NLEAMRREKEDLAAQ...LRE.EQC.KE.R.AERVRKE.REE....KA..MKA....QR..RRE.EKE......IEE.RLK..AEA.RKQKEERD.ER.RREVLR.....LQKSPGRTKT...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------tsrvvsparvlkvsaatdarvgtkllfpctpgrapsklakvlg.................
G3XLS4_ASPNA/102-247                 ........................aatttaapaakkrklsp---------------.-----....-.--.ASKEAK........QQEKEARERQKLEEK...AKK.EEE.KA.KrEEEKAKK.EEE....KR..KRE....AE..KEE.EKR......EEE.KKK..RE-.-AEKEEER.KK.KEEKRK.....VKEEEKAAKE...EE.K.R.KKEEE............-KLKKE.RAqtK.....LNSF.F..A.K.P.KT........PA.Q.PS--...-.------.-----------ssnttlsp....................................................
A0A093FEW7_TAUER/277-440             ........................................k-VPQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.RKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
T0NQ02_CAMFR/264-415                 ..............................grqaelwlvsv---------------.----Q....D.KE.RLGKQL........KLRAEKEEKEKLREE...AK-.---.RA.K.EEARKKK.EEE....KE..LKE....RE..RRE.KRE......KDE.KEK..AEK.QRRKEARR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
H2NX28_PONAB/319-478                 .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKKL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
H0YRC7_TAEGU/282-445                 .......................................qv--PQKFHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIRENMVL............................................................
F7F7P0_MONDO/380-539                 ........................................k-VPRKLIKNSAEKGK.MRLQR....D.KE.RLDKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.LRLKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
G1QFV9_MYOLU/312-385                 .........................................RITKKLVKGSVEKNK.MRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEARRRR.EEE....KE..LKE....KE..RRE.KRE......KE-.---..---.--------.--.------.....----------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------............................................................
F6VEI3_MACMU/302-461                 .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A091NEP6_9PASS/293-456             ........................................k-VPQKFHRSSAEKEK.LRLQK....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREAE............KRLNAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
L8Y2Y3_TUPCH/314-473                 ........................................q-VTKRTAKGSTEKSK.LKLQR....E.AE.RQDKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEARRRK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALG.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.RT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMAL............................................................
CAF1A_HUMAN/320-479                  .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
R7SRJ7_DICSQ/46-137                  .....sqrqlpvqkdysqafgalqsqygwgpatsvstvnkl---------------.-----....-.--.------........---------------...---.-SK.EE.K.EKREREK.RDK....KE..RKE....QE..KRE.KKE......RKE.QER..RDK.---KEQKK.KQ.KEEA--.....----------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------hstgqtgt....................................................
H2VC85_TAKRU/227-396                 ............................tttntvhdekkikRRSL-----------.KSLQE....Q.EE.RLRLQQ........EKQRQKEEAKAVKEK...KKE.EAR.KI.K.EERQREK.REK....KE..KEE....RE..RRE.KKE......KDE.KEK..AER.LKAKEDLK.KS.KLE---.....AKQEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.S.KI........QQ.A.PKTL...A.AACGKF.APFEIKENVYL............................................................
A0A183B4H2_9TREM/14-170              ...................................psnvsk----KLL---KECQR.AHLKA....E.RE.RIRIQK........EYEQEQERKRKILEK..eAKL.KEK.QLkK.EEEERQK.-EE....KR..LKR....L-..-EE.QKK......RDE.EKE..AER.KRKEEERR.KK.EEE-RI.....QKEQEKKKEE...EF.K.T.KREEK............Q-----.RA..V.....LLGF.L..V.K.S.ET........KKdA.PTSG...P.TSCGPF.MQFELRKDMR-m...........................................................
U3JEF1_FICAL/280-443                 ........................................k-VPQKFHRSSAEKEK.LRLQR....D.QE.RADKLQ........RLQAEREQKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....RE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRLHAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
A0A094K2L1_ANTCR/1-164               ........................................q-VSQKLPRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRLNAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
G1MUW3_MELGA/290-451                 .........................................KVSQKLHKSSAEKEK.EIAKK....S.-Q.SVLTSQ........KLQAEREEKGRLKEE...AK-.AAK.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A087RBC0_APTFO/278-441             .........................................KVSQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
T1ENS0_HELRO/71-218                  .......................ddenftalnksqllnlng---------------.-----....-.--.------........----------VKKEA...EKL.EQL.KN.K.EMKERQK.QEE....KE..KKE....KE..KNE.LKM......RKE.KEK..EDK.EREREEKR.RQ.KLEQVE.....EKKKKEEAKL...EG.K.R.KKEEE...........kNKTEKE.KQ..L.....MQNF.F..I.K.TtKK........QT.A.ISTKqpnD.SVNPLF.MPFELKSDMRL............................................................
M3Y0Y1_MUSPF/425-584                 ........................................r-RITKKLKASAEKDK.LKLQR....D.RE.RLGKQL........KLRAEKEEKEKLKEE...AK-.---.RA.K.EEARKKR.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRRKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
K7E9K7_ORNAN/11-170                  ......................................qip---KKLISSSAERDK.LRLQR....D.QE.RLGKQL........KLQAEKEEKEKLKEE...AK-.---.RA.R.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.LRLKEEKR.KE.RQEALE.....AKLEEKRKKE...QE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PA.A.PKTL...A.GSCGKF.APFEIKENMGL............................................................
A0A091FRL6_CORBR/291-454             ........................................k-VPQKFHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....RE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRIHAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
H0WK89_OTOGA/314-473                 .........................................RITKRFLKVSTEKNQ.IKLQR....D.QE.RLGRQL........KLRAKREEKAKLKEE...AK-.---.RA.K.EEAKKRK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.LRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
W5MI24_LEPOC/244-399                 ..................................apgstat---------EDKKVK.RRSLK...qG.EE.QEQRRR........QREEQRAEREQQRSE...ARA.ARE.RA.K.EEARRRR.EE-....--..-KE....RD..KRE.KKE......KEE.KEK..AEK.LRAKEEQR.KV.KLE---.....AKLEEKRKKE...EE.K.R.LKEEK............DRIKAE.KA..E.....ITRF.L..Q.K.P.KT........LQ.V.PKTL...A.AACGKF.APFEIKENMVL............................................................
G3VAZ2_SARHA/1-150                   .........................................---------------.MKLQR....D.KE.RLDKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KDE.KEK..AEK.LRLKEEKR.KE.RQEALDeraekAKLEEKRKKE...EE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
G3SLF5_LOXAF/298-355                 .........................................RITKKCIKGSTEKNK.IRLQR....D.KE.RLGKQL........RLQAEKEEKEKLKEE...AK-.---.RA.K.EEARKRL.KE-....--..---....--..---.---......---.---..---.--------.--.------.....----------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------............................................................
A0A0P7TXQ7_9TELE/197-362             .................................adlktnan--------TAEKKLK.RRSLKi..sE.EE.RRQKQEe.....qlERNRQRQEAKAAKER...KRE.EAR.KL.K.EEREREK.KEK....KE..REE....RE..KRE.RKE......REE.KEK..AEK.QRVKEEQR.KV.KQE---.....AKLEEKRKKE...EE.K.R.LKEEK............DRIKAE.KA..E.....ITRF.L..Q.K.P.KT........LQ.A.PKTL...A.AACGKF.APFEIKENMF-m...........................................................
F7C253_HORSE/307-466                 .........................................RITKKLVKGSAEKNR.MRLQR....D.QE.RLGKQL........KLQAEREEKEKLREE...AK-.---.RA.K.EEARKRR.EEE....RE..LKE....KE..RRE.RRE......KDE.KQK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0W7VTB4_9HYPO/101-262             ...........................qsssrsatnanppp------------KRK.RLTPA....E.KE.ARDKEL.......aGKKKEREEKAVAQAA...EKA.ADK.AK.K.DEEKAKK.DEE....KA..ADK....AK..KDE.EKA......KKE.EEK..ATR.AKEKEEKR.KL.KEEEDR.....IKADKKRKKE...EElQ.R.IQEEK............DRKARS.QK..T.....LGSF.F..K.I.P.ST........PK.-.----...-.------.-----------kaeaddaakdyspakvn...........................................
A0A099YY86_TINGU/287-450             .........................................KVSQKCHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A093JVU3_STRCA/291-454             .........................................KVSQKCHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
G1L5F6_AILME/308-467                 .........................................RITKKLVKASAEKDK.LRLQR....D.KE.RLGKQL........KLRAKKEEKEKLKEE...AK-.---.RA.K.EEARKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
H3D6M0_TETNG/258-388                 ..............................hkcfqkpktsp---------------.-----....-.--.------........---------------...---.---.KI.P.EDQRKSKrRSL....RN..LQE....QE..EKL.RKA......KEE.LKK..S-K.LEF-EWAH.WM.FLSCLR.....AKQEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.A.PKTL...A.AACGKF.APFEIKENVYL............................................................
A0A151WHZ7_9HYME/275-443             ....................................pktdk-----DIKNKIKKLTpKQLQK....R.QE.IVKRKE........EKQRLKMEKEKKREE...EKA.NRR.RE.K.EEKQREK.EEKekieKEqkKKE....KE..LKE.LKK......QME.IEQ..KQKeKEVKEEER.KK.REE---.....AKEEEKRRKE...EE.-.R.LEAER............KKQKAV.SN..F.....ASFF.V..SkK.Q.EV........KS.V.EEES...V.VGVKNF.MPFEIKADMR-i...........................................................
I3J2Y4_ORENI/239-403                 ................................padqkkvkr-RSLKS---------.--LQE....Q.DE.RLRLRQ........EKERQKEEAKAAKEK...KKE.EAR.KL.K.EEREREK.REK....KE..KDE....RE..KRE.KKE......KEE.REK..AER.LKAKEELR.KS.KME---.....AKLEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.A.PKTL...A.AACGKF.APFEIKENMAL............................................................
M3WK65_FELCA/323-468                 .........................................RITKKLVKASAEKDK.LRLQR....D.RE.RLGKQL........KLRAEKEEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..---....--..---.---......---.XEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0C7NCN7_9SACH/62-222              ................................hesqqpkes--------DGGIKSK.RQQQK....E.QE.KLEKVR........KKEQDKRDRELKREQ...ERQ.EKEnKK.Q.EEKQRKE.TER....KE..REL....KK..VQE.KRN......REL.KKE..QEK.QE--REQR.KE.IE--KR.....KKMEEKIKRE...ED.K.R.LKEET............--IDRS.QT..K.....IGSF.F..K.KfS.SS........RN.V.LDTK...T.DYQKCF.LPFYVKDGF--vm..........................................................
G3HCF9_CRIGR/291-444                 ...............................pickvnkklv---------------.-RGST....E.KG.RSKLHR........DREQQREEKEKLREE...TR-.---.QA.K.EEARRRK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
G1PI42_MYOLU/1-141                   ........................................q---------------.-----....D.KE.RLGKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEARRRR.EEE....KE..LKE....KE..RRE.KRE......KEE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.T.PKTL...A.GSCGKF.APFEIKENMVL............................................................
A0A093FL86_GAVST/292-455             .........................................KVSQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A091DEY6_FUKDA/295-447             .....................................vrri--TKKCVKGSTEKSK.LKLQR....-.--.------........GKEQLREEKEKLK--...--E.EAR.RA.R.EEARRRK.EQE....KE..LKE....KE..RRR.KRE......KDE.KER..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...KE.K.R.LREEE............KRLKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKERMVL............................................................
A0A091WPA8_OPIHO/292-455             .........................................KVSQKSHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A091UHU8_PHALP/278-441             .........................................KVSQKFHKCSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.RKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
V8NFM8_OPHHA/259-422                 .......................................na--ASKVHRISEEKEK.LKLQR....D.QE.RAEKLQ........KLEAKREEKRQLKKE...AQA.AKE.RA.R.EETKRKK.EEE....KE..LKD....KE..RRE.KKE......KDE.KEK..AEK.QRAKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRLKAE.KA..E.....ITRF.F..Q.K.P.KT........QP.A.PKTL...A.GWCGKF.APFEIKENMVL............................................................
Q6FN62_CANGA/71-221                  .................................qssnggta--------SSSQSES.RQSEK....N.RM.RELKRV........QREAEKLRREQLKAE...EKL.KKE.KK.K.EEERLRR.EEE....KK..KRE....EE..KRL.KEL......QRE.EEK..RKR.EQAKEEER.KK.KEQLRL.....QKEEEKRQKE...EE.K.R.LKEEA...........kERA---.QS..R.....IGNF.F..R.K.-.--........--.-.----...-.------.-----------vsddanknvsrktdyek...........................................
H2ZYI8_LATCH/323-486                 .........................................KGSQNSSKSKGLKEK.RRLEK....E.QE.REEKRK........KLQAEKEEKERLREE...VKA.VKE.RA.K.EEAKKKK.EEE....KE..QKE....KE..RKE.KKE......KEE.KEK..AEK.LRLKEEKR.KE.KQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRIKAE.KA..E.....ITRF.L..Q.K.S.KT........PQ.V.PKTL...A.GSCGKF.APFEIKENMVL............................................................
U3JEF0_FICAL/283-446                 ........................................k-VPQKFHRSSAEKEK.LRLQR....D.QE.RADKLQ........RLQAEREQKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....RE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRLHAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
U7PT59_SPOS1/274-383                 ............................ivyeyvesggmdk---------------.-----....-.--.------........---------------...---.---.--.-.-ERARVR.HSK....TW..QGQ....QR..AKA.KAE......AEA.KE-..ALA.VGVETRNQ.RA.QREALA.....ARQKEQKEKQ...RQ.E.R.LKEDQ............QQEHDR.VA..A.....VARF.L..H.L.A.GI........SF.C.PQSL...A.C-----.-----------nwkn........................................................
CAF1A_BOVIN/322-481                  .........................................RITKKLVRGSAEKNK.MKLQR....D.KE.RLRRQL........KLRAEKEEKEKLREE...AK-.---.RA.K.EEARKKR.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0L1HPH9_9PLEO/63-201              ............nksangqapspqnastststqqpakrrkf---------------.-----....-.--.------........---------------...---.--T.SQ.E.KEAQRLD.KEA....KA..KAR....EE..KKA.QKE......AED.RLK..AEQ.KAQKDEEK.RK.KNE---.....ERDEKKRLKE...EE.QqR.LEEEK............AKKARS.QM..K.....LNAF.F..V.K.P.KT........GS.S.PSQ-...-.------.-----------avvassqtpiaptslp............................................
G7PYM2_MACFA/284-435                 ...............................tspfptstpv---------------.---RR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
S6ESZ0_ZYGB2/44-203                  ...........................qpngeqitkqqpea-------------QS.LKGKSs..sT.GElVSTKKQ........EAQKEKERRKRQREE...EKR.RRE.QE.R.EDEKRRR.EEQ....KE..-EE....KR..KRE.KRK......EDQ.KEK..REE.LKRRKESE.KR.QRE---.....---EEKLKKE...QE.K.K.LKQEA............KE--RS.QA..R.....IGNF.F..K.K.V.SD........SS.K.QLNV...A.SDYEKFfLPFYAKESVS-v...........................................................
K7EPA1_HUMAN/93-245                  ...............................stspfptstp---------------.--LRR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0V0R3J4_PSEPJ/117-271             .vrkdqvcgkcdscgkksildnmhkiarfivqnppknvgme---------------.-----....-.--.------........---------------...---.---.-D.K.E--ADKK.QEK....KE..KKE...kKE..KKE.KKE......KKEkKEK..TEK.ESKTTELS.QE.QIDEYI.....ATLSEKFQTF...LN.K.E.NQIEN............ESIPAI.YS..E.....LKSFgI..S.K.S.LA........DK.I.YHIL...F.SSC---.-----------ftiniahqvqrniil.............................................
E7FAY6_DANRE/243-328                 .....................................nkvkRRSLKSVQEQEEKQR.QRDEK....-.--.------........--ERLKQEAKAAKEK...KKE.EAR.KM.K.EEKEREK.KEK....KE..KDE....KE..RRE.KKE......RDE.KEK..ADK.LKAKEEQ-.--.------.....----------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------d...........................................................
A0A093PYY2_9PASS/267-430             ........................................k-VPQKLHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKRK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIRENMVL............................................................
A0A091RDH2_9GRUI/292-455             ........................................k-VPQKFHKSSVEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
L5L8Q0_PTEAL/391-550                 .........................................RVTKKLVKDSAEKNK.MRLQR....D.KE.RLGKQL........KLRAEKEEKEKLKEE...AK-.---.RA.K.EEARKRR.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRRKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKENMVL............................................................
F6VEG2_MACMU/303-462                 .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A093BN37_CHAPE/292-455             .........................................KVSQKCHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.PPFEIKENMVL............................................................
A0A0F8BY49_LARCR/102-230             .....................................vist----ELSTSKEVHQH.LMLTN....-.KD.FTQVKK........ENQQVKEENQQVKEEiqqVKE.ENQ.QV.K.EENQQVK.KEN....QQ..VKE....EN..Q-Q.VKE......ENQ.QVK..VEN.QQVKEENQ.QV.KVENQQ.....VKVENQQLKV...EI.Q.Q.VKVEN............QQLK--.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------lclm........................................................
G5BZA2_HETGA/302-452                 ..................................vrritkk-----CIKGSTE---.-----....-.--.--KSKL........KLQRDKEQLREEKEK...LKE.EAR.RA.K.EEARKKK.EEE....KE..LKE....KE..RRK.KRE......KDE.KEK..AEQ.RLIKEXXX.--.XXXALE.....AKMEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
CAF1A_MOUSE/299-458                  ..............................acrvaknfvkg---------------.---ST....E.KG.RSKLHR........DREQQREEKEKLREE...IR-.---.RA.K.EEARKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEEkrl.....reeeKRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0F8XGQ6_9EURO/56-194              ...................dqsqthpqmqmppaakkrkvsp---------------.-----....-.--.------........ASREARQQEKEAKEK...LKL.EER.AK.K.DEEKKAK.EEE....KR..KRD....AE..KEE.EKK......KRE.AGK..EEE.RKRKEEKR.KV.KEEEKA.....AKEEEKRKKE...EE.K.M.KKERA...........qTRLN--.--..-.....--AF.F..-.-.-.--........--.-.----...-.------.-----------mkpkptiiehpvssaggs..........................................
M0R3S3_RAT/301-451                   ...............................rvdknlvkgs----------TE---.-----....-.KG.KSKLHR........DKEQQREEKEKLREE...I--.--R.RA.K.EEARRKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRRKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
E7FAY6_DANRE/323-371                 ........................................a---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......---.---..---.--------.--.------.....----------...--.-.-.-KEEQ............DRIKAE.KA..E.....ITRF.L..Q.K.P.KT........QL.A.PKTL...A.SACGKF.APFEIKAHMSL............................................................
A0A067R7P4_ZOONE/356-518             ..............................irnltpkqllk---------QLRSAK.KKEEK....E.RQ.RQEREQ........KKAEEKEEREKKRAE...EKE.EKL.RQ.K.LEKEEQK.K--....KE..KEE....KE..EQR.RKE......KEE.REE..IKK.-KEKEEKE.RK.KQVELE.....IKNEEKRAKD...EE.K.R.KKEDK............R--QAE.IA..A.....FTSF.FlpK.K.A.ET........KP.V.EEPK...A.KAEENF.MPFEVKADMRL............................................................
A0A0L9SZT9_9HYPO/56-209              ...spqsasettspkqfnhdkqsvspsaatskatasatkpa---------------.-----....-.--.------........----------PQRKR...LSA.EEK.QA.R.EKDKAQK.QKE....KE..VQA....AL..RAA.DKA......RQE.EEK..VAR.AKEREEKR.KK.KEEEDM.....ARAEKKRKKE...EE.Q.RrMQEDR............DKKARS.QT..R.....LNSF.F..R.L.P.NT........--.-.PKKT...A.A-----.-----------epgshsasp...................................................
L5MGP6_MYODS/304-463                 .........................................RITKKLVKGSAEKNK.MRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEARRRR.EEE....KE..LKE....KE..RRE.KRE......KEE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.T.PKTL...A.GSCGKF.APFEIKENMVL............................................................
C1GJR6_PARBD/131-255                 ............................svpnnkkrklspa---------------.-----....-.--.------........--------TKLAKAQ...EKE.AKE.RR.R.AEEKAKK.EEE....KK..R--....--..REE.ERK......KKE.EEK..EEE.RKKKEEKK.RT.KDEERL.....AREEEKRKKD...EE.K.T.KKERS...........qMRL---.--..-.....-NAF.F..V.K.P.AT........PS.S.ATAG...N.TSCGK-.-----------tmgnynv.....................................................
A0A091VN52_NIPNI/292-455             .........................................KVSQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A0F7ZU94_9HYPO/111-239             ............................sgsvgnadskpai---------------.-----....-.--.------........------------KRK...RLTpQEK.EA.R.EKEIADK.KKE....KE..AQA....AA..RAA.QKA......KLE.EDK..AAR.AKERDEKR.KK.KEEEDQ.....AKAEKKRKKE...EEqK.R.AQEEK............EKKERS.QM..K.....LNNF.F..Q.L.P.KT........PK.T.PAA-...-.------.-----------esnsnaaspv..................................................
A0A095A0T6_SCHHA/10-151              .................................lensdaks---------------.-----....-.--.--TEKI........VTDYQKAHKRAELER...LRI.ARE.HQ.R.ELERKQK.ILE....KE..RQQ....RE..RQE.KRD......AEE.RKK..EEKrLKRKEEQR.KK.EEE---.....--RENERKKK...EE.E.E.LKTQ-............-REEKQ.RA..V.....LLGF.L..V.K.S.ES........KK.E.TNTI...ScTDCGPF.IQFEVRKDMR-m...........................................................
A0A087XMB6_POEFO/256-422             ...............................kipaeekkikRRSLKSLQEQ-----.-----....-.EE.RLRLRQ........EKERQKEEAKAAKEK...KKE.EAR.KL.K.EEKEREK.REK....KE..KEE....RE..KRE.KKE......KEE.KEK..AER.LKAKEELR.KS.KLE---.....AKLEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.P.KV........QQ.A.PKTL...A.AACGKF.APFEIKENMSL............................................................
F1P5R3_CHICK/293-456                 .........................................KVSQKLHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....RE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LKEEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
I3J2Y3_ORENI/277-443                 ..............................kipadqkkvkr-RSLKS---------.--LQE....Q.DE.RLRLRQ........EKERQKEEAKAAKEK...KKE.EAR.KL.K.EEREREK.REK....KE..KDE....RE..KRE.KKE......KEE.REK..AER.LKAKEELR.KS.KME---.....AKLEEKRKKE...EE.K.R.MKEEEkrl.....keekDRLKAE.KA..E.....ITRF.L..Q.K.P.KI........QQ.A.PKTL...A.AACGKF.APFEIKENMAL............................................................
E7QAE9_YEASB/90-265                  ccknspiestkydrntnkqvpngniiaietksrssspcsxr---------------.-----....-.--.------........----------ELSSS...KKE.EAK.RE.K.ELKKQQR.AEE....KH..RKE....LL..RXE.EKXkkelkvEEErQRR..AEL.KKQKEEEK.RR.KEE---.....ARLEAKRRKE...EE.R.L.KKEEE............IRLKEE.AK..EraqsrIGNF.F..K.K.L.SD........SN.T.PVVE...K.SDYEKFfLPFYAKD----gvrv........................................................
Q0CE47_ASPTN/117-246                 .............................aagpaakkrkls---------------.-----....-.--.------........----------PASRE...AKQ.QEK.EA.K.EKARLEE.RAK....KE..EER....RA..REE.EKR......KRE.AER..EEE.KKKREEKR.KA.REEEKA.....AKEEEKRKKEaakEE.E.R.RKKEE............DRLKKE.RA..Qp...kLNAF.F..A.K.P.KV........PV.-.----...-.------.-----------qassagvnasp.................................................
F6VDM1_CALJA/418-462                 .........................................---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......---.---..---.--------.--.------.....----------...--.-.-.----E............QRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A099ZWH0_CHAVO/290-453             .........................................KVSQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A091G5C5_9AVES/292-455             .........................................KVSQKCHKSSAEKEK.LRLQR....D.QE.RAGKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.KQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
F6VDV6_CALJA/322-374                 .........................................RITKKFVKSPTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AKR.A--.--.K.EE-----.---....--..---....--..---.---......---.---..---.--------.--.------.....----------...--.-.-.-----............------.--..-.....----.-..-.-.-.--........--.-.----...-.------.-----------aa..........................................................
H0VJM6_CAVPO/382-474                 .....................................sqdr---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..---.---......---.---..--E.QRRREERR.RE.RQEALD.....ASA---RRDS...PG.P.R.LGDPGqlpelsalllypQRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGNF.APFEIKEHMVL............................................................
A0A091GX49_BUCRH/278-441             .........................................KVHQKIHRSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PP.A.PKIL...A.GSCGKF.APFEIRENMVL............................................................
S7NZA1_MYOBR/304-463                 .........................................RITKKLVKGSVEKNK.MRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEE...AK-.---.RA.K.EEARRRR.EEE....KE..LKE....KE..RRE.KRE......KEE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.T.PKTL...A.GSCGKF.APFEIKENMVL............................................................
A0A091JRE8_9AVES/278-441             ........................................k-VPQKFHKSSAEKEK.LRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KEK..AEK.LRVKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
W5PIZ1_SHEEP/321-480                 .........................................RITKKLVRGSAEKNK.MKLQR....D.KE.RLWRQL........KLQAEKEEKEKLREE...AK-.---.RA.K.EEARKKR.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
A0A0Q3MK46_AMAAE/2-158               ..................................assglaq--------------Q.LHIPL....D.QE.RADKLQ........KLQAEREEKGRLKEE...AKA.AKE.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KKE......KEE.KXK..AEK.LRAKEEKR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRINAQ.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKIL...A.GSCGKF.APFEIKENMVL............................................................
A0A0D9RDU6_CHLSB/302-461             .........................................RITKKFVKGSTEKNK.LRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEE...AK-.---.RA.K.EEAKKKK.EEE....KE..LKE....KE..RRE.KRE......KDE.KEK..AEK.QRLKEERR.KE.RQEALE.....AKLEEKRKKE...EE.K.R.LREEE............KRIKAE.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKTL...A.GSCGKF.APFEIKEHMVL............................................................
H2MK30_ORYLA/6-102                   ......................................ptp---------------.-----....-.--.------........---------------...---.---.--.-.-------.---....--..---....--..-KN.TKR......RSL.KEH..DEK.LRLRRKSKiEA.KLEEKR.....KREEEKRIKE...EE.K.R.LKEEK............DRLKAE.KA..E.....ITRF.L..Q.K.S.KT........QQ.V.PKTL...A.AACGKF.APFEIKENMAL............................................................
#=GC seq_cons                        .............................................p..ttttc+p+.h+hp+....-.pE.Rht+..........chptE+EEKt+LKEE...sK..ttc.RA.K.EEA+++K.EEE....KE..hKE....KE..RRE.K+E......K-E.KEK..AEK..RlKEE+R.KE.RQEALE.....AKLEEKRKKE...EE.K.R.L+EEE............KRIpAp.KA..E.....ITRF.F..Q.K.P.KT........PQ.A.PKsL...A.GSCGKF.APFEIKEpMlL............................................................
//
DBGET integrated database retrieval system