GenomeNet

Database: Pfam
Entry: CAF-1_p150
LinkDB: CAF-1_p150
Original site: CAF-1_p150 
#=GF ID   CAF-1_p150
#=GF AC   PF11600.4
#=GF DE   Chromatin assembly factor 1 complex p150 subunit, N-terminal
#=GF AU   Pollington J
#=GF SE   pdb_1s4z
#=GF GA   23.00 23.00;
#=GF TC   23.00 23.00;
#=GF NC   22.90 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   14765118
#=GF RT   Structural basis of HP1/PXVXL motif peptide interactions and HP1
#=GF RT   localisation to heterochromatin. 
#=GF RA   Thiru A, Nietlispach D, Mott HR, Okuwaki M, Lyon D, Nielsen PR,
#=GF RA   Hirshberg M, Verreault A, Murzina NV, Laue ED; 
#=GF RL   EMBO J. 2004;23:489-499.
#=GF RN   [2]
#=GF RM   12697822
#=GF RT   The methyl-CpG binding protein MBD1 interacts with the p150
#=GF RT   subunit of chromatin  assembly factor 1.
#=GF RA   Reese BE, Bachman KE, Baylin SB, Rountree MR;
#=GF RL   Mol Cell Biol. 2003;23:3226-3236.
#=GF CC   CAF-1_p150 is a polypeptide subunit of CAF-1, which functions in
#=GF CC   depositing newly synthesised and acetylated histones H3/H4 into
#=GF CC   chromatin during DNA replication and repair [1]. CAF-1_p150
#=GF CC   includes the HP1 interaction site, the PEST, KER and ED
#=GF CC   interacting sites. CAF-1_p150 interacts directly with newly
#=GF CC   synthesised and acetylated histones through the acidic KER and
#=GF CC   ED domains. The PEST domain is associated with proteins that
#=GF CC   undergo rapid proteolysis [2].
#=GF SQ   104
#=GS I3MNS2_SPETR/301-455  AC I3MNS2.1
#=GS G1L5F6_AILME/308-467  AC G1L5F6.1
#=GS H3D6M0_TETNG/258-388  AC H3D6M0.1
#=GS I3J2Y4_ORENI/239-403  AC I3J2Y4.1
#=GS A7F4P3_SCLS1/785-946  AC A7F4P3.1
#=GS M3WK65_FELCA/323-468  AC M3WK65.1
#=GS F1S7L7_PIG/321-480    AC F1S7L7.1
#=GS G3HCF9_CRIGR/291-444  AC G3HCF9.1
#=GS H9Z3X5_MACMU/320-479  AC H9Z3X5.1
#=GS M3XIX8_LATCH/306-469  AC M3XIX8.1
#=GS S4RLY1_PETMA/211-378  AC S4RLY1.1
#=GS G1PI42_MYOLU/1-141    AC G1PI42.1
#=GS G3SLF5_LOXAF/345-436  AC G3SLF5.1
#=GS U3BQH3_CALJA/322-481  AC U3BQH3.1
#=GS Q3UXB7_MOUSE/296-365  AC Q3UXB7.1
#=GS V8NFM8_OPHHA/259-422  AC V8NFM8.1
#=GS M4ABP2_XIPMA/235-394  AC M4ABP2.1
#=GS C4JLZ9_UNCRE/115-285  AC C4JLZ9.1
#=GS F6VDM1_CALJA/322-420  AC F6VDM1.1
#=GS H2QF16_PANTR/320-479  AC H2QF16.1
#=GS Q6FN62_CANGA/71-221   AC Q6FN62.1
#=GS C3YNV2_BRAFL/369-543  AC C3YNV2.1
#=GS F6YQD7_XENTR/348-417  AC F6YQD7.1
#=GS CAF1A_DANRE/242-396   AC A0JMK9.1
#=GS K7FMD9_PELSI/306-469  AC K7FMD9.1
#=GS U3JEF0_FICAL/283-446  AC U3JEF0.1
#=GS H2ZYI8_LATCH/323-486  AC H2ZYI8.1
#=GS V9KAV5_CALMI/286-453  AC V9KAV5.1
#=GS U7PT59_SPOS1/274-383  AC U7PT59.1
#=GS CAF1A_BOVIN/322-481   AC A6QLA6.1
#=GS CAF1A_CHICK/293-456   AC Q5R1T0.1
#=GS U6DUV2_NEOVI/1-103    AC U6DUV2.1
#=GS M7AWT3_CHEMY/273-433  AC M7AWT3.1
#=GS G7PYM2_MACFA/284-435  AC G7PYM2.1
#=GS U3IL50_ANAPL/273-437  AC U3IL50.1
#=GS G3PN46_GASAC/1-96     AC G3PN46.1
#=GS E9IDN8_SOLIN/240-437  AC E9IDN8.1
#=GS G1QSB4_NOMLE/320-479  AC G1QSB4.1
#=GS Z4YIN8_DANRE/177-331  AC Z4YIN8.1
#=GS S6ESZ0_ZYGB2/44-203   AC S6ESZ0.1
#=GS J5RIC1_SACK1/96-259   AC J5RIC1.1
#=GS F6VDV6_CALJA/367-455  AC F6VDV6.1
#=GS W4YJY9_STRPU/299-469  AC W4YJY9.1
#=GS E7FAY6_DANRE/243-328  AC E7FAY6.1
#=GS K7EPA1_HUMAN/93-245   AC K7EPA1.2
#=GS D6W625_HUMAN/320-479  AC D6W625.1
#=GS B2GSW9_DANRE/242-396  AC B2GSW9.1
#=GS H9G514_ANOCA/261-437  AC H9G514.1
#=GS F6VEG2_MACMU/303-462  AC F6VEG2.1
#=GS L5L8Q0_PTEAL/391-550  AC L5L8Q0.1
#=GS M0R3S3_RAT/301-458    AC M0R3S3.1
#=GS Q4S3E0_TETNG/1-148    AC Q4S3E0.1
#=GS W5LF66_ASTMX/255-415  AC W5LF66.1
#=GS G5BZA2_HETGA/302-452  AC G5BZA2.1
#=GS CAF1A_MOUSE/299-458   AC Q9QWF0.1
#=GS F6X520_CANFA/323-481  AC F6X520.1
#=GS L8IJG9_9CETA/322-478  AC L8IJG9.1
#=GS G1MUV9_MELGA/293-455  AC G1MUV9.2
#=GS E7QAE9_YEASB/92-265   AC E7QAE9.1
#=GS E7FAY6_DANRE/323-371  AC E7FAY6.1
#=GS Q4V7J2_XENLA/229-333  AC Q4V7J2.1
#=GS M1EN07_MUSPF/1-134    AC M1EN07.1
#=GS C1H0H5_PARBA/128-255  AC C1H0H5.1
#=GS C0S899_PARBP/132-256  AC C0S899.1
#=GS C1GJR6_PARBD/131-255  AC C1GJR6.1
#=GS G3XLS4_ASPNA/102-247  AC G3XLS4.1
#=GS L5MGP6_MYODS/304-463  AC L5MGP6.1
#=GS T0NQ02_9CETA/264-415  AC T0NQ02.1
#=GS H2NX28_PONAB/319-478  AC H2NX28.1
#=GS H0YRC7_TAEGU/282-445  AC H0YRC7.1
#=GS F7F7P0_MONDO/380-539  AC F7F7P0.2
#=GS G1QFV9_MYOLU/312-385  AC G1QFV9.1
#=GS F1P5R3_CHICK/293-456  AC F1P5R3.1
#=GS I3J2Y3_ORENI/277-443  AC I3J2Y3.1
#=GS CA1AA_XENLA/358-420   AC Q98TA5.1
#=GS F6VEI3_MACMU/302-461  AC F6VEI3.1
#=GS L8Y2Y3_TUPCH/314-473  AC L8Y2Y3.1
#=GS Q0CE47_ASPTN/117-246  AC Q0CE47.1
#=GS CA1AA_XENLA/240-366   AC Q98TA5.1
#=GS K7AZ59_PANTR/330-489  AC K7AZ59.1
#=GS F6VDM1_CALJA/418-462  AC F6VDM1.1
#=GS CAF1A_HUMAN/320-479   AC Q13111.2
#=GS R7SRJ7_DICSQ/46-137   AC R7SRJ7.1
#=GS W0VNP3_ZYGBA/44-203   AC W0VNP3.1
#=GS H2VC85_TAKRU/227-396  AC H2VC85.1
#=GS U3JEF1_FICAL/280-443  AC U3JEF1.1
#=GS G7NLX1_MACMU/303-462  AC G7NLX1.1
#=GS G1MUW3_MELGA/290-451  AC G1MUW3.2
#=GS F6VDV6_CALJA/322-374  AC F6VDV6.1
#=GS H0VJM6_CAVPO/382-474  AC H0VJM6.1
#=GS T1ENS0_HELRO/71-218   AC T1ENS0.1
#=GS M3Y0Y1_MUSPF/425-584  AC M3Y0Y1.1
#=GS S7NZA1_MYOBR/304-463  AC S7NZA1.1
#=GS K7E9K7_ORNAN/11-170   AC K7E9K7.1
#=GS CA1AB_XENLA/239-404   AC A0JMT0.2
#=GS W5PIZ1_SHEEP/321-480  AC W5PIZ1.1
#=GS H0WK89_OTOGA/314-473  AC H0WK89.1
#=GS W5MI24_LEPOC/244-399  AC W5MI24.1
#=GS G3VAZ2_SARHA/1-150    AC G3VAZ2.1
#=GS G3SLF5_LOXAF/298-355  AC G3SLF5.1
#=GS F7C253_HORSE/307-466  AC F7C253.1
#=GS R7U633_CAPTE/253-366  AC R7U633.1
#=GS H2MK30_ORYLA/6-102    AC H2MK30.1
#=GS D2I029_AILME/292-451  AC D2I029.1
I3MNS2_SPETR/301-455             ..................................tpvhri--TKKFVKGSTEKNRMRPQR....-.--.------........DKEQLREEKEKLKEEAR----RAK.E....EARRKK.EEEKELKE....KE..RRE.KRE......KDE.KER..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
G1L5F6_AILME/308-467             ........................................RITKKLVKASAEKDKLRLQR....D.KE.RLGKQL........KLRAKKEEKEKLKEEAK----RAK.E....EARKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
H3D6M0_TETNG/258-388             .............................hkcfqkpktsp--------------------....-.--.------........---------------------KIP.E....DQRKSKrRSLRNLQE....QE..EKL.RKA......KEE.LKK..S-KLEF-EWAH.WM.FLSCLR.....AK........QEEKRKKE...EEKRMKEEEkrl.....keekDRLKAEK....A..E.....ITRFLQK.P.KI........Q.QA.PKTL...AAACGKF.APFEIKENVYL............................................................
I3J2Y4_ORENI/239-403             ...............................padqkkvkr-RSLKS-----------LQE....Q.DE.RLRLRQ........EKERQKEEAKAAKEKKKEEARKLK.E....EREREK.REKKEKDE....RE..KRE.KKE......KEE.REK..AERLKAKEELR.KS.KME---.....AK........LEEKRKKE...EEKRMKEEEkrl.....keekDRLKAEK....A..E.....ITRFLQK.P.KI........Q.QA.PKTL...AAACGKF.APFEIKENMAL............................................................
A7F4P3_SCLS1/785-946             ...........................lvshyesfrddia-------------ERRHEEF....D.KR.RRDAEK........ELEKQVAQRRKEFKERKIREKRER.E....EQERKL.REEEERAQ....KE..KAE.KDE......REE.KRK..AEFAQLKAIRE.KE.RQEALE....iAA........LQERRAEE...ASKRRAEEK............ARGPVRG....A..P.....IERS-DS.T.GE........R.RA.PLAL...AGASGKI.N----------wrekerlr....................................................
M3WK65_FELCA/323-468             ........................................RITKKLVKASAEKDKLRLQR....D.RE.RLGKQL........KLRAEKEEKEKLKEEAK----RAK.E....EAKKKK.EEEKE---....--..---.---......---.XEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
F1S7L7_PIG/321-480               ........................................RMSNKLLKGSAEKNKMRLQR....D.KE.RLGKQL........KLRAEKEEKEKLREEAK----RAK.E....EAKKKK.EEEKELKE....RE..RRE.KRE......KDE.KEK..AEKQRRKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
G3HCF9_CRIGR/291-444             ..............................pickvnkklv----------------RGST....E.KG.RSKLHR........DREQQREEKEKLREETR----QAK.E....EARRRK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
H9Z3X5_MACMU/320-479             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
M3XIX8_LATCH/306-469             ........................................KGSQNSSKSKGLKEKRRLEK....E.QE.REEKRK........KLQAEKEEKERLREEVKAVKERAK.E....EAKKKK.EEEKEQKE....KE..RKE.KKE......KEE.KEK..AEKLRLKEEKR.KE.KQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRIKAEK....A..E.....ITRFLQK.S.KT........P.QV.PKTL...AGSCGKF.APFEIKENMVL............................................................
S4RLY1_PETMA/211-378             .............................atsrklgsvkk------------RPGVRKQK....M.-K.NYERKG........DFEAELEQKQRHRQEEKVEKERQR.E....EARLAR.EESRRK--....--..IKE.ERE......QKE.QEK..AEKSKLKEEKK.RE.KQEAID.....QTrwlrmrppMEEKRKKE...EEKSKMEEE............KRMKKEK....S..Ke...aFASFFTK.G.KT........P.QA.PKTL...TGTCGPF.APFEIKNNMR-v...........................................................
G1PI42_MYOLU/1-141               .......................................q--------------------....D.KE.RLGKQL........KLQAEKEEKEKLKEEAK----RAK.E....EARRRR.EEEKELKE....KE..RRE.KRE......KEE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QT.PKTL...AGSCGKF.APFEIKENMVL............................................................
G3SLF5_LOXAF/345-436             .......................................a--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.KEE..A-RKRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEEkvl.....rakvKRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIREHMVL............................................................
U3BQH3_CALJA/322-481             ........................................RITKKFVKSPTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
Q3UXB7_MOUSE/296-365             ...........................stpacrvaknfvk-----------------GST....E.KG.RSKLHR........DREQQREEKEKLREEIR----RAK.E....EARKKK.EEEKELKE....KE..RRE.KRE......KD-.---..-----------.--.------.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------............................................................
V8NFM8_OPHHA/259-422             ......................................na--ASKVHRISEEKEKLKLQR....D.QE.RAEKLQ........KLEAKREEKRQLKKEAQAAKERAR.E....ETKRKK.EEEKELKD....KE..RRE.KKE......KDE.KEK..AEKQRAKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRLKAEK....A..E.....ITRFFQK.P.KT........Q.PA.PKTL...AGWCGKF.APFEIKENMVL............................................................
M4ABP2_XIPMA/235-394             ..............................kipaeekkikRRSLKSLQEQ----------....-.EE.RLRLRQ........EKERQKEEAKAAKEKKKEEARMLK.E....EKEREK.REKKEKEE....RE..KRE.KKE......KEE.KEK..AERLKAKEELR.KS.KLE---.....AK........LEEKRKKE...EEKRMKEEF............QRLKAEK....A..E.....ITRFLQK.P.KI........Q.QA.PKTL...AAACGKF.APFEIKGNMSL............................................................
C4JLZ9_UNCRE/115-285             .................................egcrplv-----------KKQRPRKKQ....G.KT.RLANFW.......eEEKQKREEEKKRREEEREAEKRRR.E....EVRKKK.EEEKEEEK....RK..REEeKKK......KDE.EKE..AER-KKREEKR.KQ.KEDERI.....AR........EEEKKKKE...RSQ------............-------....-..-.....-------.-.--........-.--.----...-------.-----------mrlnafftkpsipnstnkavepkaveesnqasasqspdtkavsdysdefppffvqshvcl
F6VDM1_CALJA/322-420             ........................................RITKKFVKSPTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....Q-........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------r...........................................................
H2QF16_PANTR/320-479             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
Q6FN62_CANGA/71-221              ................................qssnggta--------SSSQSESRQSEK....N.RM.RELKRV........QREAEKLRREQLKAEEKLKKEKKK.E....EERLRR.EEEKKKRE....EE..KRL.KEL......QRE.EEK..RKREQAKEEER.KK.KEQLRL.....QK........EEEKRQKE...EEKRLKEEA...........kERA---Q....S..R.....IGNFFRK.-.--........-.--.----...-------.-----------vsddanknvsrktdyek...........................................
C3YNV2_BRAFL/369-543             ...................................rvktp----KQLAKEAELQRKREEK....E.KE.KQEKLR........LKEEERAEKERLRSEARRQKELEK.E....ELRKKK.EEEKRQKE....AE..KQK.LKE......AEE.KER..QEKLRIKEEER.KK.KQEAIE.....AK........LEEKKKKE...EEKQKQEEEkkkv...eeekaRKQQKVK....A..A.....FQSFFVK.P.KF........D.PAePKEE...QQPVGAF.MPFEVKKDMKL............................................................
F6YQD7_XENTR/348-417             ................................seslikts--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.---..-----------.--.------.....-K........ATTRRHKD...TNMNPSHCK............KRLKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTF...ARSCGKF.APFEIKKDMAL............................................................
CAF1A_DANRE/242-396              ...................................ankvkRRSLKSVQEQEEKQRQRDEK....-.--.------........--ERLKQEAKAAKEKKKEEARKMK.E....EKEREK.KEKKEKDE....KE..RRE.KKE......RDE.KEK..ADKLKAKEEQR.QM.KIE---.....AK........LEEKRKKE...EEKRLKEEK............DRIKAEK....A..E.....ITRFLQK.P.KT........Q.LA.PKTL...ASACGKF.APFEIKAHMSL............................................................
K7FMD9_PELSI/306-469             .......................................k-VYQKCLSSSVKKEKLRLQR....D.QE.RADKLQ........KLQAEKEEKGRLKEEAKAAKERAK.E....EAKKKK.EEERELKE....KE..RRE.KKE......KDE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QT.PKTL...AGSCGKF.APFEIKENMVL............................................................
U3JEF0_FICAL/283-446             .......................................k-VPQKFHRSSAEKEKLRLQR....D.QE.RADKLQ........RLQAEREQKGRLKEEAKAAKERAK.E....EAKKRK.EEEKELKE....RE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRLHAQK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
H2ZYI8_LATCH/323-486             ........................................KGSQNSSKSKGLKEKRRLEK....E.QE.REEKRK........KLQAEKEEKERLREEVKAVKERAK.E....EAKKKK.EEEKEQKE....KE..RKE.KKE......KEE.KEK..AEKLRLKEEKR.KE.KQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRIKAEK....A..E.....ITRFLQK.S.KT........P.QV.PKTL...AGSCGKF.APFEIKENMVL............................................................
V9KAV5_CALMI/286-453             ..........................ttprrkisegprmk--------------GERFQK....Q.QE.RDEKKQ........KLQMEKQEKGRARDEARIAKERAK.E....EAKKKR.DEEKEQKD....KE..RRE.KKE......KEE.KEK..AERLRIKEEKR.KE.KQDAME.....AK........LEEKRKKE...EEKRLKEEE............KRMKAEKvkesS..E.....ISRFFQK.P.KA........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
U7PT59_SPOS1/274-383             ...........................ivyeyvesggmdk--------------------....-.--.------........------------------------.-....ERARVR.HSKTWQGQ....QR..AKA.KAE......AEA.KE-..ALAVGVETRNQ.RA.QREALA.....AR........QKEQKEKQ...RQERLKEDQ............QQEHDRV....A..A.....VARFLHL.A.GI........S.FC.PQSL...AC-----.-----------nwkn........................................................
CAF1A_BOVIN/322-481              ........................................RITKKLVRGSAEKNKMKLQR....D.KE.RLRRQL........KLRAEKEEKEKLREEAK----RAK.E....EARKKR.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
CAF1A_CHICK/293-456              ........................................KVSQKLHKSSAEKEKLRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEEAKAAKERAK.E....EAKKKK.EEEKELKE....RE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKIL...AGSCGKF.APFEIKENMVL............................................................
U6DUV2_NEOVI/1-103               ........................................--------------------....-.--.------........------------------------.-....------.-EEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
M7AWT3_CHEMY/273-433             .........................qnrsdtsplaasipv------------------RK....D.QE.RADKLQ........KLQAEKEEKGRLKEEAKAAKERAK.E....EAKKKK.EEEKELKE....KE..RRE.KKE......KDE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
G7PYM2_MACFA/284-435             ..............................tspfptstpv------------------RR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
U3IL50_ANAPL/273-437             .......................................k-VPQKFPKSSAEKEKLRLQR....Q.TL.PERVGA........AREVHGHSRERLNLKEAAAARGAL.E....QAALCE.WALQVLLV....LP..RKL.RCE......INK.KKR..EEVNAFRESRR.SEaEQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKIL...AGSCGKF.APFEIKENMVL............................................................
G3PN46_GASAC/1-96                ......................................pr--------------------....-.--.------........------------------------.-....------.--------....-R..RSS.KSE......QEE.KVRlqQEKERQKEETK.AA.KMK---.....IK........EEARRVAE...IKVRVSNAS............QRLKAEK....A..E.....ITRFLQK.P.KI........Q.QP.PKTL...AAACGKF.APFEIKEHMAL............................................................
E9IDN8_SOLIN/240-437             etsseldksisnrneevtenkettpatsvtpktdknikri----------KRLTPKQLEK....R.EE.IARRKE........ERLKLKMEKEKKREEEKANRRREK.E....EKQKEK.EEK-EKIE....KElkKKE.KELk...elKKQ.MEL..EQKQKEKEARE.EE.RKKREE.....AK........EEEKRKKE...DE-RLEAER............KKQKAVS....N..F.....VSFFVPKkQ.EV........K.SM.EEES...VVKVKNF.MPFEIKADMR-v...........................................................
G1QSB4_NOMLE/320-479             ........................................RITKKFVKGPTKKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKRKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
Z4YIN8_DANRE/177-331             ...................................ankvkRRSLKSVQEQEEKQRQRDEK....-.--.------........--ERLKQEAKAAKEKKKEEARKMK.E....EKEREK.KEKKEKDE....KE..RRE.KKE......RDE.KEK..ADKLKAKEEQR.QM.KIE---.....AK........LEEKRKKE...EEKRLKEEK............DRIKAEK....A..E.....ITRFLQK.P.KT........Q.LA.PKTL...ASACGKF.APFEIKAHMSL............................................................
S6ESZ0_ZYGB2/44-203              ..........................qpngeqitkqqpea-------------QSLKGKSs..sT.GElVSTKKQ........EAQKEKERRKRQREEEKRRREQER.E....DEKRRR.EEQKE-EE....KR..KRE.KRK......EDQ.KEK..REELKRRKESE.KR.QRE---.....--........-EEKLKKE...QEKKLKQEA............KE--RSQ....A..R.....IGNFFKK.V.SD........S.SK.QLNV...ASDYEKFfLPFYAKESVS-v...........................................................
J5RIC1_SACK1/96-259              ..........kesigsdgnadkqrpgealsivsesksksp--------------------....-.--.------........SPSSKKEPSTMRKENAKME----K.E....LKRQQR.EEEKHRKEllrqAE..RRK.KEL......KTE.EER..HKRAELKKQKE.EA.RLETKR.....RK........EEEKSKKE...QEIRLKEEA............KE--RAQ....S..R.....IGNFFKK.V.SD........S.NA.PPVE...KSDYEKFfLPFYAKD----gvkv........................................................
F6VDV6_CALJA/367-455             .....................................kra--------------------....-.--.------........------------------------.-....------.--------....--..---.---......--K.EEA..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
W4YJY9_STRPU/299-469             ......................................pm--SAKALQRLKEQEEKKEEK....L.KL.REDKKR........KLEEENEMKKRQKLEQKQAKEEEK.E....AQRKEK.AEEKKKKE....ME..KQL.KKE......KEE.QER..MEKKKAKEEER.LK.KQEEIE.....AK........QEEKKKKQ...EER-IKQEE............EKKQKEA....A..E.....LSKKSKQ.S.QVfknffsvqA.QA.PVKK...PEVKGWF.APFEVKSDQVL............................................................
E7FAY6_DANRE/243-328             ....................................nkvkRRSLKSVQEQEEKQRQRDEK....-.--.------........--ERLKQEAKAAKEKKKEEARKMK.E....EKEREK.KEKKEKDE....KE..RRE.KKE......RDE.KEK..ADKLKAKEEQ-.--.------.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------d...........................................................
K7EPA1_HUMAN/93-245              ..............................stspfptstp-----------------LRR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
D6W625_HUMAN/320-479             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
B2GSW9_DANRE/242-396             ...................................ankvkRRSLKSVQEQEEKQRQRDEK....-.--.------........--ERLKQEAKAAKEKKKEEARKMK.E....EKEREK.KEKKEKDE....KE..RRE.KKE......RDE.KEK..ADKLKAKEEQR.QM.KIE---.....AK........LEEKRKKE...EEKRLKEEK............DRIKAEK....A..E.....ITRFLQK.P.KT........Q.LA.PKTL...ASACGKF.APFEIKAHMSL............................................................
H9G514_ANOCA/261-437             ........................................KVSQKTHQSAEEKEKLKLQKnildN.KE.GLRKSLlniklafaGQDQERAEKGRLKEEAKAAKERAR.E....EARRKK.EEEKELKE....KE..RKE.KKE......KDE.KEK..AEKLRVKEEKR.KE.KQEALE.....AK........LEEKRKKE...EEKRLKEEE...........kRRIKAEK....A..G.....ITRFFQK.P.KT........Q.PV.PKTL...AGWCGKF.APFEIKENMVL............................................................
F6VEG2_MACMU/303-462             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
L5L8Q0_PTEAL/391-550             ........................................RVTKKLVKDSAEKNKMRLQR....D.KE.RLGKQL........KLRAEKEEKEKLKEEAK----RAK.E....EARKRR.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRRKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
M0R3S3_RAT/301-458               ..............................rvdknlvkgs----------TE--------....-.KG.KSKLHR........DKEQQREEKEKLREEI----RRAK.E....EARRKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRRKE...EEKRLREEEklv.....sfppQRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
Q4S3E0_TETNG/1-148               .......................................q--------------------....-.EE.KLRLQQ........EKQRQKEEAKAAKEKKKEEARRLK.E....EQQREK.REKKEKEE....RE..RRE.KKE......KDE.KEK..AERLKAKEELK.KS.KLE---.....AK........QEEKRKKE...EEKRMKEEEkrl.....keekDRLKAEK....A..E.....ITRFLQK.P.KI........Q.QA.PKTL...AAACGKF.APFEIKENVYL............................................................
W5LF66_ASTMX/255-415             ..................................prtdae-------QKKAKRRSLKSAQ....EmEE.KQRQRE........ERERLKEEARAAKEKKREDARRLK.E....EKEKEK.KEKREKDE....RE..RRE.KKE......RDD.KEK..AEKQRAKEEQR.KV.KME---.....AK........LEEKRKKE...EEKRLREEK............DQIKAEK....A..A.....ITRFLQK.S.KT........Q.LA.PKTL...ASVCGKF.APFEIKEHMIL............................................................
G5BZA2_HETGA/302-452             .................................vrritkk-----CIKGSTE--------....-.--.--KSKL........KLQRDKEQLREEKEKLKEEARRAK.E....EARKKK.EEEKELKE....KE..RRK.KRE......KDE.KEK..AEQRLIKEXXX.--.XXXALE.....AK........MEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
CAF1A_MOUSE/299-458              .............................acrvaknfvkg------------------ST....E.KG.RSKLHR........DREQQREEKEKLREEIR----RAK.E....EARKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEEkrl.....reeeKRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
F6X520_CANFA/323-481             ........................................RITKKLIKASAEKDKLRLQR....D.KE.RLGKQL........KLRAEKEEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EE-RLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
L8IJG9_9CETA/322-478             ........................................RITKKLVRGSAEKNKMKLQR....D.KE.RLRRQL........KLRAEKEEKEKLREEAK----RAK.E....EARKKR.EEEKELKE....KE..RRE.KRE......---.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
G1MUV9_MELGA/293-455             ........................................KVSQKLHKSSAEKEKLRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEEAK-AAKRAK.E....EAKKKK.EEEKELKE....KE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKIL...AGSCGKF.APFEIKENMVL............................................................
E7QAE9_YEASB/92-265              .knspizstkydrntnkqvpngniiaietksrssspcsxr--------------------....-.--.------........----------ELSSSKKEEAKREK.E....LKKQQR.AEEKHRKE....LL..RXE.EKXkkelkvEEErQRR..AELKKQKEEEK.RR.KEE---.....AR........LEAKRRKE...EERLKKEEE............IRLKEEA....K..EraqsrIGNFFKK.L.SD........S.NT.PVVE...KSDYEKFfLPFYAKD----gvrv........................................................
E7FAY6_DANRE/323-371             .......................................a--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.---..-----------.--.------.....--........--------...-----KEEQ............DRIKAEK....A..E.....ITRFLQK.P.KT........Q.LA.PKTL...ASACGKF.APFEIKAHMSL............................................................
Q4V7J2_XENLA/229-333             ..............................pststtptgk----------ATSNKTSAEK....-.KK.TKDKAE........KRQAEKEER----ECARREARAAK.D....LAKKKR.EGEREQRE....KD..KKE.KKE......RED.REK..AEKNRLKEEKK.KE.KLEALE.....AK........QEKKKKK-...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------............................................................
M1EN07_MUSPF/1-134               ........................................--------------------....-.--.---KQL........KLRAEKEEKEKLKEEAK----RAK.E....EARKKR.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRRKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
C1H0H5_PARBA/128-255             ...........................psvpnnkkrklsp--------------------....-.--.------........-------ATKLAKAQEKEAKERQR.A....EEKAKK.EEEKKKRE....EE..RKK.---......-KE.EEK..EEERKKKEEKK.KS.KDEERL.....AR........EEEKRKKD...EEKMKKE-R............SQMR---....-..-.....LNAFFVK.P.AI........P.SS.ATAG...NTSCGK-.-----------tmgnynvqn...................................................
C0S899_PARBP/132-256             ...........................svpnnkkrklspa--------------------....-.--.------........--------TKLAKAQEKEAKERRR.A....EEKAKK.EEEKKKRE....EE..RK-.---......KKE.EEK..EEERKKKEEKK.RT.KDEERL.....AR........EEEKRKKD...EEKTKKERS...........qMRL----....-..-.....-NAFFVK.P.AT........P.SS.ATAG...NTSCGK-.-----------tmgnynv.....................................................
C1GJR6_PARBD/131-255             ...........................svpnnkkrklspa--------------------....-.--.------........--------TKLAKAQEKEAKERRR.A....EEKAKK.EEEKKR--....--..REE.ERK......KKE.EEK..EEERKKKEEKK.RT.KDEERL.....AR........EEEKRKKD...EEKTKKERS...........qMRL----....-..-.....-NAFFVK.P.AT........P.SS.ATAG...NTSCGK-.-----------tmgnynv.....................................................
G3XLS4_ASPNA/102-247             .......................aatttaapaakkrklsp--------------------....-.--.ASKEAK........QQEKEARERQKLEEKAKKEEEKAKrE....EEKAKK.EEEKRKRE....AE..KEE.EKR......EEE.KKK..RE--AEKEEER.KK.KEEKRK.....VK........EEEKAAKE...EEKRKKEEE............-KLKKER....AqtK.....LNSFFAK.P.KT........P.AQ.PS--...-------.-----------ssnttlsp....................................................
L5MGP6_MYODS/304-463             ........................................RITKKLVKGSAEKNKMRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEEAK----RAK.E....EARRRR.EEEKELKE....KE..RRE.KRE......KEE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QT.PKTL...AGSCGKF.APFEIKENMVL............................................................
T0NQ02_9CETA/264-415             .............................grqaelwlvsv-------------------Q....D.KE.RLGKQL........KLRAEKEEKEKLREEAK----RAK.E....EARKKK.EEEKELKE....RE..RRE.KRE......KDE.KEK..AEKQRRKEARR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
H2NX28_PONAB/319-478             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKKL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
H0YRC7_TAEGU/282-445             ......................................qv--PQKFHRSSAEKEKLRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEEAKAAKERAK.E....EAKKRK.EEEKELKE....KE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIRENMVL............................................................
F7F7P0_MONDO/380-539             .......................................k-VPRKLIKNSAEKGKMRLQR....D.KE.RLDKQL........KLQAEKEEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKLRLKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
G1QFV9_MYOLU/312-385             ........................................RITKKLVKGSVEKNKMRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEEAK----RAK.E....EARRRR.EEEKELKE....KE..RRE.KRE......KE-.---..-----------.--.------.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------............................................................
F1P5R3_CHICK/293-456             ........................................KVSQKLHKSSAEKEKLRLQR....D.QE.RADKLQ........KLQAEREEKGRLKEEAKAAKERAK.E....EAKKKK.EEEKELKE....RE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKIL...AGSCGKF.APFEIKENMVL............................................................
I3J2Y3_ORENI/277-443             .............................kipadqkkvkr-RSLKS-----------LQE....Q.DE.RLRLRQ........EKERQKEEAKAAKEKKKEEARKLK.E....EREREK.REKKEKDE....RE..KRE.KKE......KEE.REK..AERLKAKEELR.KS.KME---.....AK........LEEKRKKE...EEKRMKEEEkrl.....keekDRLKAEK....A..E.....ITRFLQK.P.KI........Q.QA.PKTL...AAACGKF.APFEIKENMAL............................................................
CA1AA_XENLA/358-420              .......................................q--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.---..-----------.--.------.....-K........EEEKRQKE...EEKRLKEEE............KRVKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTF...SRSCGKF.APFEIKKGMAL............................................................
F6VEI3_MACMU/302-461             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
L8Y2Y3_TUPCH/314-473             .......................................q-VTKRTAKGSTEKSKLKLQR....E.AE.RQDKQL........KLRAEREEKEKLKEEAK----RAK.E....EARRRK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALG.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.RT........P.QA.PKTL...AGSCGKF.APFEIKEHMAL............................................................
Q0CE47_ASPTN/117-246             ............................aagpaakkrkls--------------------....-.--.------........----------PASREAKQQEKEAK.E....KARLEE.RAKKEEER....RA..REE.EKR......KRE.AER..EEEKKKREEKR.KA.REEEKA.....AK........EEEKRKKEaakEEERRKKEE............DRLKKER....A..Qp...kLNAFFAK.P.KV........P.V-.----...-------.-----------qassagvnasp.................................................
CA1AA_XENLA/240-366              ............................ststtptgkvta-------------NKTSADK....N.K-.TKDKDK........QRQAEKEERERAKKEARSAKKKKR.QgllkNLQRKR.GKTSESSG....KE.yKKE.KKE......RED.KEK..AEKMKLKEEKK.RE.KLEALE.....AK........QEEKRKKD...EEKRQKEEE............KRQK---....-..-.....-------.-.--........-.--.----...-------.-----------............................................................
K7AZ59_PANTR/330-489             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
F6VDM1_CALJA/418-462             ........................................--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.---..-----------.--.------.....--........--------...--------E............QRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
CAF1A_HUMAN/320-479              ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
R7SRJ7_DICSQ/46-137              ....sqrqlpvqkdysqafgalqsqygwgpatsvstvnkl--------------------....-.--.------........-------------------SKEEK.E....KREREK.RDKKERKE....QE..KRE.KKE......RKE.QER..RDK---KEQKK.KQ.KEEA--.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------hstgqtgt....................................................
W0VNP3_ZYGBA/44-203              ..........................qpngeqitkqqpea-------------QSLKGKSs..sT.GElVSTKKQ........EAQKEKERRKRQREEEKRRREQER.E....DEKRRR.EEQKE-EE....KR..KRE.KRK......EDQ.KEK..REELKRRKESE.KR.QRE---.....--........-EEKLKKE...QEKKLKQEA............KE--RSQ....A..R.....IGNFFKK.V.SD........S.SK.QLNV...ASDYEKFfLPFYAKESVS-v...........................................................
H2VC85_TAKRU/227-396             ...........................tttntvhdekkikRRSL-----------KSLQE....Q.EE.RLRLQQ........EKQRQKEEAKAVKEKKKEEARKIK.E....ERQREK.REKKEKEE....RE..RRE.KKE......KDE.KEK..AERLKAKEDLK.KS.KLE---.....AK........QEEKRKKE...EEKRMKEEEkrl.....keekDRLKAEK....A..E.....ITRFLQK.S.KI........Q.QA.PKTL...AAACGKF.APFEIKENVYL............................................................
U3JEF1_FICAL/280-443             .......................................k-VPQKFHRSSAEKEKLRLQR....D.QE.RADKLQ........RLQAEREQKGRLKEEAKAAKERAK.E....EAKKRK.EEEKELKE....RE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRLHAQK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
G7NLX1_MACMU/303-462             ........................................RITKKFVKGSTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
G1MUW3_MELGA/290-451             ........................................KVSQKLHKSSAEKEKEIAKK....S.-Q.SVLTSQ........KLQAEREEKGRLKEEAK-AAKRAK.E....EAKKKK.EEEKELKE....KE..RRE.KKE......KEE.KEK..AEKLRVKEEKR.KE.RQEALE.....AK........LEEKRKKE...EEKRLKEEE............KRINAQK....A..E.....ITRFFQK.P.KT........P.QA.PKIL...AGSCGKF.APFEIKENMVL............................................................
F6VDV6_CALJA/322-374             ........................................RITKKFVKSPTEKNKLRLQR....D.QE.RLGKQL........KLRAEREEKEKLKEEAKRA----K.E....E-----.--------....--..---.---......---.---..-----------.--.------.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------aa..........................................................
H0VJM6_CAVPO/382-474             ....................................sqdr--------------------....-.--.------........------------------------.-....------.--------....--..---.---......---.---..--EQRRREERR.RE.RQEALD.....AS........A---RRDS...PGPRLGDPGqlpelsalllypQRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGNF.APFEIKEHMVL............................................................
T1ENS0_HELRO/71-218              ......................ddenftalnksqllnlng--------------------....-.--.------........----------VKKEAEKLEQLKNK.E....MKERQK.QEEKEKKE....KE..KNE.LKM......RKE.KEK..EDKEREREEKR.RQ.KLEQVE.....EK........KKKEEAKL...EGKRKKEEE...........kNKTEKEK....Q..L.....MQNFFIK.TtKK........Q.TA.ISTKqpnDSVNPLF.MPFELKSDMRL............................................................
M3Y0Y1_MUSPF/425-584             .......................................r-RITKKLKASAEKDKLKLQR....D.RE.RLGKQL........KLRAEKEEKEKLKEEAK----RAK.E....EARKKR.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRRKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
S7NZA1_MYOBR/304-463             ........................................RITKKLVKGSVEKNKMRLQR....D.KE.RLGKQL........KLQAEKEEKEKLKEEAK----RAK.E....EARRRR.EEEKELKE....KE..RRE.KRE......KEE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QT.PKTL...AGSCGKF.APFEIKENMVL............................................................
K7E9K7_ORNAN/11-170              .....................................qip---KKLISSSAERDKLRLQR....D.QE.RLGKQL........KLQAEKEEKEKLKEEAK----RAR.E....EAKKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKLRLKEEKR.KE.RQEALE.....AK........LEEKRKKE...QEKRLKEEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.AA.PKTL...AGSCGKF.APFEIKENMGL............................................................
CA1AB_XENLA/239-404              ..............................pststtptgk----------ATSNKTSAEK....-.KK.TKDKAE........KRQAEKEER----ECARREARAAK.D....LAKKKR.EGEREQRE....KD..KKE.KKE......RED.REK..AEKNRLKEEKK.KE.KLEALE.....AK........QEEKRKKE...EEKRQKEEEkrl.....keeeKRIKAEK....A..E.....ITRFLQK.P.KT........P.QA.PKTF...ARSCGKF.APFEIKKGMAL............................................................
W5PIZ1_SHEEP/321-480             ........................................RITKKLVRGSAEKNKMKLQR....D.KE.RLWRQL........KLQAEKEEKEKLREEAK----RAK.E....EARKKR.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
H0WK89_OTOGA/314-473             ........................................RITKRFLKVSTEKNQIKLQR....D.QE.RLGRQL........KLRAKREEKAKLKEEAK----RAK.E....EAKKRK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKLRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
W5MI24_LEPOC/244-399             .................................apgstat---------EDKKVKRRSLK...qG.EE.QEQRRR........QREEQRAEREQQRSEARAARERAK.E....EARRRR.EE----KE....RD..KRE.KKE......KEE.KEK..AEKLRAKEEQR.KV.KLE---.....AK........LEEKRKKE...EEKRLKEEK............DRIKAEK....A..E.....ITRFLQK.P.KT........L.QV.PKTL...AAACGKF.APFEIKENMVL............................................................
G3VAZ2_SARHA/1-150               ........................................---------------MKLQR....D.KE.RLDKQL........KLQAEKEEKEKLKEEAK----RAK.E....EAKKKK.EEEKELKE....KE..RRE.KKE......KDE.KEK..AEKLRLKEEKR.KE.RQEALDeraekAK........LEEKRKKE...EEKRLKEEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKENMVL............................................................
G3SLF5_LOXAF/298-355             ........................................RITKKCIKGSTEKNKIRLQR....D.KE.RLGKQL........RLQAEKEEKEKLKEEAK----RAK.E....EARKRL.KE------....--..---.---......---.---..-----------.--.------.....--........--------...---------............-------....-..-.....-------.-.--........-.--.----...-------.-----------............................................................
F7C253_HORSE/307-466             ........................................RITKKLVKGSAEKNRMRLQR....D.QE.RLGKQL........KLQAEREEKEKLREEAK----RAK.E....EARKRR.EEERELKE....KE..RRE.RRE......KDE.KQK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
R7U633_CAPTE/253-366             .......................................e--------------------....-.--.------........------------------------.-....KERLEK.EREKQEKE....KE..RQE.KLE......QIQ.KEK..EEKLKAKEEER.RK.KQEVIE.....AK........NEERKKKE...EERVKDEEE............KTMKKEKe..rA..F.....FKQFFKK.S.EK........SsSK.LSEE...ASQHGPF.MPFEVKKDMR-i...........................................................
H2MK30_ORYLA/6-102               .....................................ptp--------------------....-.--.------........------------------------.-....------.--------....--..-KN.TKR......RSL.KEH..DEKLRLRRKSKiEA.KLEEKR.....KR........EEEKRIKE...EEKRLKEEK............DRLKAEK....A..E.....ITRFLQK.S.KT........Q.QV.PKTL...AAACGKF.APFEIKENMAL............................................................
D2I029_AILME/292-451             ........................................RITKKLVKASAEKDKLRLQR....D.KE.RLGKQL........KLRAKKEEKEKLKEEAK----RAK.E....EARKKK.EEEKELKE....KE..RRE.KRE......KDE.KEK..AEKQRLKEERR.KE.RQEALE.....AK........LEEKRKKE...EEKRLREEE............KRIKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AGSCGKF.APFEIKEHMVL............................................................
#=GC seq_cons                    ......................................................t.p.p+....p.pc.+.tcp.........chptc+EE+c+hKEEtK....RAK.E....Es+++K.EEEKEhKE....KE..RRE.K+E......K-E.KEK..AEK.RhKEE+R.KE.+QEALE.....AK........LEEKRKKE...EEKRL+EEE............KRlKAEK....A..E.....ITRFFQK.P.KT........P.QA.PKTL...AuSCGKF.APFEIKEpMsL............................................................
//
DBGET integrated database retrieval system