GenomeNet

Database: Pfam
Entry: CTV_P33
LinkDB: CTV_P33
Original site: CTV_P33 
#=GF ID   CTV_P33
#=GF AC   PF07184.7
#=GF DE   Citrus tristeza virus P33 protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_16614 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   247.30 247.20;
#=GF NC   18.40 17.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11112500
#=GF RT   Closterovirus encoded HSP70 homolog and p61 in addition to both
#=GF RT   coat proteins function in efficient virion assembly. 
#=GF RA   Satyanarayana T, Gowda S, Mawassi M, Albiach-Marti MR, Ayllon
#=GF RA   MA, Robertson C, Garnsey SM, Dawson WO; 
#=GF RL   Virology 2000;278:253-265.
#=GF DR   INTERPRO; IPR010803;
#=GF CC   This family consists of several Citrus tristeza virus (CTV) P33
#=GF CC   proteins. The function of P33 is unclear although it is known
#=GF CC   that the protein is not needed for virion formation [1].
#=GF SQ   263
#=GS M9ZCG5_9CLOS/1-303  AC M9ZCG5.1
#=GS Q0PI84_9CLOS/1-144  AC Q0PI84.1
#=GS I3RWY0_9CLOS/1-303  AC I3RWY0.1
#=GS Q2I0U1_9CLOS/1-202  AC Q2I0U1.1
#=GS Q7TE49_9CLOS/1-202  AC Q7TE49.1
#=GS D5KTB0_9CLOS/1-195  AC D5KTB0.1
#=GS G8Z2R7_9CLOS/1-196  AC G8Z2R7.1
#=GS W8DW22_9CLOS/1-303  AC W8DW22.1
#=GS Q7TE18_9CLOS/1-202  AC Q7TE18.1
#=GS Q2I0T6_9CLOS/1-202  AC Q2I0T6.1
#=GS G8Z2S1_9CLOS/1-196  AC G8Z2S1.1
#=GS G8Z2S3_9CLOS/1-196  AC G8Z2S3.1
#=GS B7SCT3_9CLOS/1-195  AC B7SCT3.1
#=GS B8YFZ7_9CLOS/1-195  AC B8YFZ7.1
#=GS Q2I0X7_9CLOS/1-202  AC Q2I0X7.1
#=GS G8Z2R9_9CLOS/1-196  AC G8Z2R9.1
#=GS Q5MK83_9CLOS/1-195  AC Q5MK83.1
#=GS Q0PI80_9CLOS/1-144  AC Q0PI80.1
#=GS Q2EYW3_9CLOS/1-202  AC Q2EYW3.1
#=GS C0MNE6_9CLOS/1-128  AC C0MNE6.1
#=GS Q2I0T0_9CLOS/1-203  AC Q2I0T0.1
#=GS C0MNC9_9CLOS/1-128  AC C0MNC9.1
#=GS Q7TE41_9CLOS/1-202  AC Q7TE41.1
#=GS B8YFZ0_9CLOS/1-195  AC B8YFZ0.1
#=GS Q0PI87_9CLOS/1-144  AC Q0PI87.1
#=GS Q2I0S0_9CLOS/1-203  AC Q2I0S0.1
#=GS J9WJ56_9CLOS/1-303  AC J9WJ56.1
#=GS K0A020_9CLOS/1-195  AC K0A020.1
#=GS E1ABF6_9CLOS/1-303  AC E1ABF6.1
#=GS B7SCT5_9CLOS/1-195  AC B7SCT5.1
#=GS B8YFZ8_9CLOS/1-195  AC B8YFZ8.1
#=GS W8DXG7_9CLOS/1-303  AC W8DXG7.1
#=GS G8Z2S7_9CLOS/1-196  AC G8Z2S7.1
#=GS Q5MK85_9CLOS/1-195  AC Q5MK85.1
#=GS D5KTA6_9CLOS/1-195  AC D5KTA6.1
#=GS B7SCU1_9CLOS/1-195  AC B7SCU1.1
#=GS Q0PI95_9CLOS/1-144  AC Q0PI95.1
#=GS B8YG05_9CLOS/1-195  AC B8YG05.1
#=GS Q2EYX7_9CLOS/1-202  AC Q2EYX7.1
#=GS F8SQV2_9CLOS/1-195  AC F8SQV2.1
#=GS J9WR87_9CLOS/1-303  AC J9WR87.1
#=GS Q2I0S4_9CLOS/1-203  AC Q2I0S4.1
#=GS G8Z2R4_9CLOS/1-196  AC G8Z2R4.1
#=GS H9BQN5_9CLOS/1-303  AC H9BQN5.1
#=GS I7C1H1_9CLOS/1-202  AC I7C1H1.1
#=GS C0MND0_9CLOS/1-128  AC C0MND0.1
#=GS G8Z2R6_9CLOS/1-196  AC G8Z2R6.1
#=GS B7SCV4_9CLOS/1-195  AC B7SCV4.1
#=GS I3RWW9_9CLOS/1-303  AC I3RWW9.1
#=GS B8YFZ6_9CLOS/1-195  AC B8YFZ6.1
#=GS C0MNE5_9CLOS/1-128  AC C0MNE5.1
#=GS Q2I0W2_9CLOS/1-202  AC Q2I0W2.1
#=GS Q7TE51_9CLOS/1-202  AC Q7TE51.1
#=GS Q2I0V9_9CLOS/1-202  AC Q2I0V9.1
#=GS B7SCV2_9CLOS/1-195  AC B7SCV2.1
#=GS Q2I0X4_9CLOS/1-202  AC Q2I0X4.1
#=GS Q2EYW7_9CLOS/1-202  AC Q2EYW7.1
#=GS B5THB9_9CLOS/1-303  AC B5THB9.1
#=GS I6Y087_9CLOS/1-303  AC I6Y087.1
#=GS Q9DTG3_9CLOS/1-303  AC Q9DTG3.1
#=GS Q0PI88_9CLOS/1-144  AC Q0PI88.1
#=GS F8SQW7_9CLOS/1-195  AC F8SQW7.1
#=GS Q2I0X8_9CLOS/1-202  AC Q2I0X8.1
#=GS J9ZZJ8_9CLOS/1-195  AC J9ZZJ8.1
#=GS P87589_9CLOS/1-303  AC P87589.1
#=GS Q2EYW1_9CLOS/1-202  AC Q2EYW1.1
#=GS Q5MK48_9CLOS/1-195  AC Q5MK48.1
#=GS Q2I0T4_9CLOS/1-202  AC Q2I0T4.1
#=GS Q5MK63_9CLOS/1-195  AC Q5MK63.1
#=GS J9ZZS5_9CLOS/1-195  AC J9ZZS5.1
#=GS B5THA7_9CLOS/1-303  AC B5THA7.1
#=GS Q7TE61_9CLOS/1-202  AC Q7TE61.1
#=GS Q7TE53_9CLOS/1-202  AC Q7TE53.1
#=GS B7SCU8_9CLOS/1-195  AC B7SCU8.1
#=GS Q0PI81_9CLOS/1-144  AC Q0PI81.1
#=GS B8YDL3_9CLOS/1-303  AC B8YDL3.1
#=GS D5KTB2_9CLOS/1-195  AC D5KTB2.1
#=GS Q5MK71_9CLOS/1-195  AC Q5MK71.1
#=GS Q2I0W8_9CLOS/1-202  AC Q2I0W8.1
#=GS Q2EYW9_9CLOS/1-202  AC Q2EYW9.1
#=GS B9VB22_9CLOS/1-303  AC B9VB22.1
#=GS Q7TE16_9CLOS/1-203  AC Q7TE16.1
#=GS Q7TE37_9CLOS/1-202  AC Q7TE37.1
#=GS F8SQW5_9CLOS/1-195  AC F8SQW5.1
#=GS B8YFZ1_9CLOS/1-195  AC B8YFZ1.1
#=GS Q7TE45_9CLOS/1-202  AC Q7TE45.1
#=GS Q2EYX5_9CLOS/1-202  AC Q2EYX5.1
#=GS C0MNE4_9CLOS/1-128  AC C0MNE4.1
#=GS G0Z9H2_9CLOS/1-303  AC G0Z9H2.1
#=GS Q5MK60_9CLOS/1-195  AC Q5MK60.1
#=GS D5KTA3_9CLOS/1-195  AC D5KTA3.1
#=GS W6EAC2_9CLOS/1-303  AC W6EAC2.1
#=GS Q2I0W4_9CLOS/1-202  AC Q2I0W4.1
#=GS Q2EYV9_9CLOS/1-203  AC Q2EYV9.1
#=GS Q2I0V2_9CLOS/1-202  AC Q2I0V2.1
#=GS F8SQV4_9CLOS/1-195  AC F8SQV4.1
#=GS I7C1F9_9CLOS/1-202  AC I7C1F9.1
#=GS Q5MK77_9CLOS/1-195  AC Q5MK77.1
#=GS Q5MK73_9CLOS/1-195  AC Q5MK73.1
#=GS W8D0K6_9CLOS/1-303  AC W8D0K6.1
#=GS G8Z2T7_9CLOS/1-196  AC G8Z2T7.1
#=GS Q2EYX3_9CLOS/1-202  AC Q2EYX3.1
#=GS Q5MK75_9CLOS/1-195  AC Q5MK75.1
#=GS Q2EYY1_9CLOS/1-202  AC Q2EYY1.1
#=GS M9Z6X5_9CLOS/1-303  AC M9Z6X5.1
#=GS Q2EYY3_9CLOS/1-202  AC Q2EYY3.1
#=GS C0MND1_9CLOS/1-128  AC C0MND1.1
#=GS B8YFY9_9CLOS/1-195  AC B8YFY9.1
#=GS B8YFZ9_9CLOS/1-195  AC B8YFZ9.1
#=GS Q2I0S6_9CLOS/1-203  AC Q2I0S6.1
#=GS Q7TE59_9CLOS/1-202  AC Q7TE59.1
#=GS O10469_9CLOS/1-303  AC O10469.1
#=GS B7SCV8_9CLOS/1-195  AC B7SCV8.1
#=GS D5KTA7_9CLOS/1-195  AC D5KTA7.1
#=GS Q2I0U6_9CLOS/1-202  AC Q2I0U6.1
#=GS C0MNE3_9CLOS/1-128  AC C0MNE3.1
#=GS C0MND8_9CLOS/1-128  AC C0MND8.1
#=GS C6F420_9CLOS/1-303  AC C6F420.1
#=GS Q2I0U4_9CLOS/1-202  AC Q2I0U4.1
#=GS G8Z2S9_9CLOS/1-196  AC G8Z2S9.1
#=GS Q7TE29_9CLOS/1-202  AC Q7TE29.1
#=GS C0MND7_9CLOS/1-128  AC C0MND7.1
#=GS F8SQV0_9CLOS/1-195  AC F8SQV0.1
#=GS B8YFZ2_9CLOS/1-195  AC B8YFZ2.1
#=GS Q7TE25_9CLOS/1-188  AC Q7TE25.1
#=GS I7CB14_9CLOS/1-202  AC I7CB14.1
#=GS Q7TE43_9CLOS/1-202  AC Q7TE43.1
#=GS F8SQW3_9CLOS/1-195  AC F8SQW3.1
#=GS Q2I0W6_9CLOS/1-202  AC Q2I0W6.1
#=GS K0A1B6_9CLOS/1-195  AC K0A1B6.1
#=GS Q2EYV8_9CLOS/1-203  AC Q2EYV8.1
#=GS G0Z9I2_9CLOS/1-303  AC G0Z9I2.1
#=GS C0MND2_9CLOS/1-128  AC C0MND2.1
#=GS B9VB58_9CLOS/1-303  AC B9VB58.1
#=GS B7SCU5_9CLOS/1-195  AC B7SCU5.1
#=GS I7D847_9CLOS/1-202  AC I7D847.1
#=GS B7SCV6_9CLOS/1-195  AC B7SCV6.1
#=GS F8SQX4_9CLOS/1-129  AC F8SQX4.1
#=GS Q2XP14_9CLOS/1-302  AC Q2XP14.1
#=GS F8SQW1_9CLOS/1-195  AC F8SQW1.1
#=GS B8YG02_9CLOS/1-195  AC B8YG02.1
#=GS F8SQV7_9CLOS/1-195  AC F8SQV7.1
#=GS Q2I0Y0_9CLOS/1-202  AC Q2I0Y0.1
#=GS C0MNE7_9CLOS/1-128  AC C0MNE7.1
#=GS B7SCT0_9CLOS/1-195  AC B7SCT0.1
#=GS Q7TE55_9CLOS/1-202  AC Q7TE55.1
#=GS C0MND4_9CLOS/1-128  AC C0MND4.1
#=GS F8SQX3_9CLOS/1-195  AC F8SQX3.1
#=GS C0MND6_9CLOS/1-128  AC C0MND6.1
#=GS D5KTA5_9CLOS/1-195  AC D5KTA5.1
#=GS Q2I0W0_9CLOS/1-202  AC Q2I0W0.1
#=GS B7SCT8_9CLOS/1-195  AC B7SCT8.1
#=GS B8YG01_9CLOS/1-195  AC B8YG01.1
#=GS Q9YN85_9CLOS/1-303  AC Q9YN85.1
#=GS C0MNE1_9CLOS/1-128  AC C0MNE1.1
#=GS Q0PI94_9CLOS/1-144  AC Q0PI94.1
#=GS B8YG03_9CLOS/1-195  AC B8YG03.1
#=GS C0MNE0_9CLOS/1-128  AC C0MNE0.1
#=GS Q2EYW5_9CLOS/1-202  AC Q2EYW5.1
#=GS Q2EYW0_9CLOS/1-203  AC Q2EYW0.1
#=GS I7D836_9CLOS/1-202  AC I7D836.1
#=GS M9Z736_9CLOS/1-303  AC M9Z736.1
#=GS Q0PI96_9CLOS/1-144  AC Q0PI96.1
#=GS G8Z2U1_9CLOS/1-196  AC G8Z2U1.1
#=GS Q2I0S8_9CLOS/1-203  AC Q2I0S8.1
#=GS Q5MK80_9CLOS/1-195  AC Q5MK80.1
#=GS Q8B3T7_9CLOS/1-303  AC Q8B3T7.1
#=GS Q89539_9CLOS/1-302  AC Q89539.1
#=GS B0F3U4_9CLOS/1-303  AC B0F3U4.1
#=GS G8Z2S5_9CLOS/1-196  AC G8Z2S5.1
#=GS Q7TE22_9CLOS/1-202  AC Q7TE22.1
#=GS Q2I0Y2_9CLOS/1-202  AC Q2I0Y2.1
#=GS B8YG04_9CLOS/1-195  AC B8YG04.1
#=GS Q5MK65_9CLOS/1-195  AC Q5MK65.1
#=GS Q2EYX9_9CLOS/1-202  AC Q2EYX9.1
#=GS C0MNE8_9CLOS/1-128  AC C0MNE8.1
#=GS D5KTA1_9CLOS/1-195  AC D5KTA1.1
#=GS B7SCT6_9CLOS/1-195  AC B7SCT6.1
#=GS D5KTB3_9CLOS/1-195  AC D5KTB3.1
#=GS Q2I0V0_9CLOS/1-202  AC Q2I0V0.1
#=GS I7D864_9CLOS/1-203  AC I7D864.1
#=GS Q7T711_9CLOS/1-302  AC Q7T711.1
#=GS Q5MK51_9CLOS/1-195  AC Q5MK51.1
#=GS K0A1E3_9CLOS/1-195  AC K0A1E3.1
#=GS Q5MK56_9CLOS/1-195  AC Q5MK56.1
#=GS Q2I0X2_9CLOS/1-202  AC Q2I0X2.1
#=GS Q2I0X0_9CLOS/1-202  AC Q2I0X0.1
#=GS G8Z2T9_9CLOS/1-196  AC G8Z2T9.1
#=GS G8Z2T3_9CLOS/1-196  AC G8Z2T3.1
#=GS B8YFZ3_9CLOS/1-195  AC B8YFZ3.1
#=GS B8YG07_9CLOS/1-195  AC B8YG07.1
#=GS K0A1C1_9CLOS/1-195  AC K0A1C1.1
#=GS Q2I0U8_9CLOS/1-202  AC Q2I0U8.1
#=GS Q2I0T2_9CLOS/1-202  AC Q2I0T2.1
#=GS D0EAM1_9CLOS/1-303  AC D0EAM1.1
#=GS Q7TE33_9CLOS/1-202  AC Q7TE33.1
#=GS Q2I0V4_9CLOS/1-202  AC Q2I0V4.1
#=GS I7CB27_9CLOS/1-202  AC I7CB27.1
#=GS Q7TE57_9CLOS/1-202  AC Q7TE57.1
#=GS C0MND3_9CLOS/1-128  AC C0MND3.1
#=GS F8SQW9_9CLOS/1-195  AC F8SQW9.1
#=GS G8Z2T5_9CLOS/1-196  AC G8Z2T5.1
#=GS Q5MK42_9CLOS/1-195  AC Q5MK42.1
#=GS C0MND9_9CLOS/1-127  AC C0MND9.1
#=GS B5THD1_9CLOS/1-303  AC B5THD1.1
#=GS W8D0Q4_9CLOS/1-303  AC W8D0Q4.1
#=GS Q2LK64_9CLOS/1-303  AC Q2LK64.1
#=GS Q5MK68_9CLOS/1-195  AC Q5MK68.1
#=GS Q0PI99_9CLOS/1-144  AC Q0PI99.1
#=GS Q0PI85_9CLOS/1-144  AC Q0PI85.1
#=GS I7DBK8_9CLOS/1-202  AC I7DBK8.1
#=GS Q5MK70_9CLOS/1-195  AC Q5MK70.1
#=GS D5KTA8_9CLOS/1-195  AC D5KTA8.1
#=GS D0EAN3_9CLOS/1-303  AC D0EAN3.1
#=GS G1DBA8_9CLOS/1-303  AC G1DBA8.1
#=GS Q0PI82_9CLOS/1-144  AC Q0PI82.1
#=GS Q9IFW8_9CLOS/1-303  AC Q9IFW8.1
#=GS M9ZTH7_9CLOS/1-303  AC M9ZTH7.1
#=GS Q7TE21_9CLOS/1-202  AC Q7TE21.1
#=GS Q2EYX1_9CLOS/1-202  AC Q2EYX1.1
#=GS C0MND5_9CLOS/1-128  AC C0MND5.1
#=GS Q0PI86_9CLOS/1-144  AC Q0PI86.1
#=GS B7SCU6_9CLOS/1-195  AC B7SCU6.1
#=GS I7CYL3_9CLOS/1-202  AC I7CYL3.1
#=GS B8YG06_9CLOS/1-195  AC B8YG06.1
#=GS B7SCU3_9CLOS/1-195  AC B7SCU3.1
#=GS Q5MK46_9CLOS/1-195  AC Q5MK46.1
#=GS D5KTA9_9CLOS/1-195  AC D5KTA9.1
#=GS Q7TE47_9CLOS/1-202  AC Q7TE47.1
#=GS Q7TE35_9CLOS/1-202  AC Q7TE35.1
#=GS B7SCV0_9CLOS/1-195  AC B7SCV0.1
#=GS D5KTB1_9CLOS/1-195  AC D5KTB1.1
#=GS B7SCT1_9CLOS/1-195  AC B7SCT1.1
#=GS B9VB10_9CLOS/1-303  AC B9VB10.1
#=GS B7SCT9_9CLOS/1-195  AC B7SCT9.1
#=GS C0MNE2_9CLOS/1-128  AC C0MNE2.1
#=GS Q7TE27_9CLOS/1-202  AC Q7TE27.1
#=GS Q5MK44_9CLOS/1-195  AC Q5MK44.1
#=GS Q2I0T8_9CLOS/1-202  AC Q2I0T8.1
#=GS M4MF16_9CLOS/1-303  AC M4MF16.1
#=GS M9Z606_9CLOS/1-303  AC M9Z606.1
#=GS I3XHN0_9CLOS/1-303  AC I3XHN0.1
#=GS B9VB34_9CLOS/1-303  AC B9VB34.1
#=GS Q7TE39_9CLOS/1-202  AC Q7TE39.1
#=GS Q0PI83_9CLOS/1-144  AC Q0PI83.1
#=GS F8SQV9_9CLOS/1-195  AC F8SQV9.1
#=GS G8Z2T1_9CLOS/1-196  AC G8Z2T1.1
#=GS B8YG08_9CLOS/1-195  AC B8YG08.1
#=GS D5KTA2_9CLOS/1-195  AC D5KTA2.1
#=GS Q5MK58_9CLOS/1-195  AC Q5MK58.1
#=GS Q2I0S3_9CLOS/1-203  AC Q2I0S3.1
#=GS M9Z3L6_9CLOS/1-303  AC M9Z3L6.1
#=GS Q7TE31_9CLOS/1-202  AC Q7TE31.1
#=GS B8YFZ5_9CLOS/1-195  AC B8YFZ5.1
#=GS Q2I0U2_9CLOS/1-202  AC Q2I0U2.1
#=GS Q2I0V6_9CLOS/1-202  AC Q2I0V6.1
#=GS B8YG00_9CLOS/1-195  AC B8YG00.1
#=GS F8SQX1_9CLOS/1-195  AC F8SQX1.1
#=GS Q5MK54_9CLOS/1-195  AC Q5MK54.1
#=GS D5KTA4_9CLOS/1-195  AC D5KTA4.1
#=GS B8YFZ4_9CLOS/1-195  AC B8YFZ4.1
#=GS F8SQU8_9CLOS/1-195  AC F8SQU8.1
#=GS B9VB46_9CLOS/1-303  AC B9VB46.1
M9ZCG5_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFV....
Q0PI84_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNREGNVTYVKTVDKSRFAILVKVVPAPMRGYYSFRAFLTGDVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.DTVTNEFSVATDDVEDVKYV----------------------------------------------------------------------------------------------------------....
I3RWY0_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLSIIFI....
Q2I0U1_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSGFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q7TE49_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFLRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
D5KTB0_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
G8Z2R7_9CLOS/1-196             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRTFVSGDVASERSEFICSFVGSRFLCCCTQTISENLSSVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
W8DW22_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLATDVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q7TE18_9CLOS/1-202             MFAFASESQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2I0T6_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIEKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEYICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
G8Z2S1_9CLOS/1-196             MFAFASENQDILEEKVFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNCEGNVAYVKTIDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
G8Z2S3_9CLOS/1-196             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTVDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
B7SCT3_9CLOS/1-195             MFAFASEDQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVRSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YFZ7_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVDKSRFSILIKAVPAPMRGYYSFRAFLANDVASERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0X7_9CLOS/1-202             MFAFASENQDILEEKIFRHRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFAIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
G8Z2R9_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLADDVTSERSNFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSAAIDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q5MK83_9CLOS/1-195             MFAFASEDQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSKFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q0PI80_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVNNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
Q2EYW3_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAIS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
C0MNE6_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVGKSRFAILIKAVPAPMRGYYSFRAFLASDVTSERSDFMCSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDV----------------------------------------------------------------------------------------------------------------....
Q2I0T0_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDSTIDIGYGTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
C0MNC9_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
Q7TE41_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRVRVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRA------------------------------------------------------------------------------------------------------r...
B8YFZ0_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q0PI87_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRVNAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
Q2I0S0_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
J9WJ56_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYYRRYFGDVVRDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVGGTYKIRAHVDNQPNCEGNVTYVKTVYKSRFAILIKAVPASMRGYYSFRAFTAGDVTSERSDFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETTTNEFSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTTGNVAVVVPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSTLIMSGLLTVIFI....
K0A020_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAVPATMRGYYSFRAFLSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
E1ABF6_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQRNSVVNGTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRMDTAGNVAVTIPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
B7SCT5_9CLOS/1-195             MFAFASEDQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADCFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YFZ8_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
W8DXG7_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNTNLGDSSGVQSRTIEEEGYRTDTASNVAVTIPNTPLVNAVSPYVAEFNESTRSRISLIRRVCCYAVCVLVVSLLIMSGLLGVIFI....
G8Z2S7_9CLOS/1-196             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDLGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYIKTMDKNRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q5MK85_9CLOS/1-195             MFAFASENQDILDEKIFRRRTCHRKYLGDVVRDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA6_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTVDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B7SCU1_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCWTQTISEKLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q0PI95_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVNNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
B8YG05_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDSTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2EYX7_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFPAADVTSERSEFICSFVGSRFLCCCTQTISENSSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
F8SQV2_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTCYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
J9WR87_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAIS.ETAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYKTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q2I0S4_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
G8Z2R4_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYHRRYFDDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTCKIRAHIDNQPNREGNVTYVKTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTVSENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
H9BQN5_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNTNLGDSSGVQSRTIEEEGYRTDTVSNVAVTIPNTPLVNAVSPYVVEFNESTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAVMFI....
I7C1H1_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYIKTVDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
C0MND0_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
G8Z2R6_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDTTDRDPAVLADYFSLYFFLLNNDSVGPVAASIVVSPPVSGTYKLRAHVGSQPNCEGNVTYVKSIDKSRFVIRVKAVPASMRGYYSFRAFLSGDVASERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.DTVTNEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
B7SCV4_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNNNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
I3RWW9_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINATPASMRGYYSFRAFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLGDSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCCYAVCVLVVSLLIMSGLIAIIFI....
B8YFZ6_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTANKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETANNEFSVATDDVEDIK------------------------------------------------------------------------------------------------------------....
C0MNE5_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYFSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDV----------------------------------------------------------------------------------------------------------------....
Q2I0W2_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q7TE51_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q2I0V9_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
B7SCV2_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNNNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDXSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0X4_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRGFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPAPIRGYYSYRAFVSGDVASERSEFICSFVGSRFPCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q2EYW7_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDIVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRISAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCYCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B5THB9_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDLVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTTDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
I6Y087_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYSGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPAPTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSTVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLGDSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCCYAVCVLVVSLLIMSGLIAIIFI....
Q9DTG3_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLSIIFI....
Q0PI88_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVAYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
F8SQW7_9CLOS/1-195             MFAFASESQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDDTDRDPTVLADYFSLYFFLLNNDNVGPIAASIVVNPPVSGNHKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSLFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0X8_9CLOS/1-202             MFAFASENQDILEEKIFRHRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTHVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCRTQTISENLNNVCSSSFFFRAVP.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
J9ZZJ8_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCRRKYLGDVVRDFTIDIGYTTVDRGPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAVPATMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
P87589_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYLSLYFFLLNNDYIGPLAASIMVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSLRAFLSGDVASATVEFICSFVGSRFLCCGTQTISENLNKVCSSSFFFRVVS.ETATNEFSVVTDDVEDVKYVRKRAEGFLHCADPYPPRCYRNANLGDCSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLTIILI....
Q2EYW1_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q5MK48_9CLOS/1-195             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0T4_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRGHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAAGVTSERGEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q5MK63_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVAYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRALS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
J9ZZS5_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLGDVVRDFTIDIGYNTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B5THA7_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIRAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFV....
Q7TE61_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q7TE53_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B7SCU8_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q0PI81_9CLOS/1-144             -----------------------------------------------------FSLYFYLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
B8YDL3_9CLOS/1-303             MFAFASGNQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADCDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRMKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLGDSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCCYAVCVLVVSLLIMSGLIAIIFI....
D5KTB2_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADCDPTVLADYFSLYFFLLNNDNIGPLAASIVASPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK71_9CLOS/1-195             MFAFASESQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDDTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVNPPVSGNYKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKTVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0W8_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDMVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQMISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2EYW9_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRISAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B9VB22_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTANKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETANNEFPVATDDVEDIKYVRKRAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q7TE16_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
Q7TE37_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDEVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
F8SQW5_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTINVGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLANEVNSERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YFZ1_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHIDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q7TE45_9CLOS/1-202             MFAFASEDQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLHFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYAKTMDKSRFVIRIKAIPASMRGYYSFRAFPSGDVASERSGFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q2EYX5_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSSDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MNE4_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSIAIDDV----------------------------------------------------------------------------------------------------------------....
G0Z9H2_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHIDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCPSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRMDTAGNVAVTIPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
Q5MK60_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLDDEVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA3_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYIKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
W6EAC2_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKNRFAIVIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYKTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q2I0W4_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2EYV9_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
Q2I0V2_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASTVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
F8SQV4_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTVSEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
I7C1F9_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCRRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q5MK77_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHIDNQPNREGNVTYVKTMDKSRFVIRIKAVPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSHFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK73_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRIVIRIKAMPASMRGHYSFRAFVSGDIASERSEFICSFVGSRFLCCCTQTISENLNKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
W8D0K6_9CLOS/1-303             MFAFASENQDILDEKIFRRRTCHRKYLGDVVRDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFAIRVKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNTNLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFI....
G8Z2T7_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q2EYX3_9CLOS/1-202             MFAFASENQDILEEKIFRHRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVXSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q5MK75_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRMKAIPASMRGYYSFRAFLSGDVASERSEFVCSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2EYY1_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFPLYFFLPNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISQNLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIKYVRKRAE-----------------------------------------------------------------------------------------------------....
M9Z6X5_9CLOS/1-303             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLGDSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYVAEYNENARSRVSLIRRVCCYAVCVLVVSVLIMSGLLAIIFI....
Q2EYY3_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MND1_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGIHKIRAHVDSQPNREGNFTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
B8YFY9_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKVRAHVDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDSITSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTPINEFSVATDDVQDVK------------------------------------------------------------------------------------------------------------....
B8YFZ9_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHIDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0S6_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
Q7TE59_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVATERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
O10469_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
B7SCV8_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNNNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA7_9CLOS/1-195             MFAFVSENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDVAGERSEFMCSFVGSRYLCCCTQTISENLSNVCSSCFFFRAVS.ETATNEFSVVTDDVKDVK------------------------------------------------------------------------------------------------------------....
Q2I0U6_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAAGVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
C0MNE3_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVASPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDV----------------------------------------------------------------------------------------------------------------....
C0MND8_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCSTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
C6F420_9CLOS/1-303             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQPNREGNVTYIKTMDKSRFVIRIKALPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQGRTIEEEGYRTDTAGNVAVTIPNTPLVNAVSPYVTEYNENARSRISLIRRVCCYAVCVLVVPLLIMSGLLAVIFI....
Q2I0U4_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYLFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
G8Z2S9_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDNVGPVAASIVVSPPVSGTYKLRAHVGSQPNCEGNVTYVKTIDESRFVIRVKAVPASMRGYYSFRAFLSSDVASERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.DTATNEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q7TE29_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MND7_9CLOS/1-128             ---------------------------------------------------------------DYIGPLAASIMVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSLRAFLSGDVASATVEFICSFVGSRFLCCGTQTISENLNKVCSSSFFFRVVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
F8SQV0_9CLOS/1-195             MFASASENQGLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISKDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YFZ2_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHIDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q7TE25_9CLOS/1-188             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDGRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTIDKSRFAILIKSVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KPRLTSF-----------------------------------------------------------------------------------------------------------------------llrl
I7CB14_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVYGAYEIRTHVDNQPNREGNVTYVKIMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFPCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q7TE43_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
F8SQW3_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTINVGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLANEVNSERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0W6_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
K0A1B6_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAVPATMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2EYV8_9CLOS/1-203             MFAFASESQGLLEEKVFRRRTYHRKYLGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
G0Z9I2_9CLOS/1-303             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTVDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGAYKIRAHIDNQPNREGNVTYVNTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRMDTAGNVAITVPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
C0MND2_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKTVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
B9VB58_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPISGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTGTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRIALIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
B7SCU5_9CLOS/1-195             MFAFASEDQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
I7D847_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYIKTVDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
B7SCV6_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNNNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINATPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
F8SQX4_9CLOS/1-129             ------------------------------------------------------------------GPIAASIVVNPPVSGNHKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2XP14_9CLOS/1-302             MFAFASESQDLLEEIVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVFRVKASP-SMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEPFSRCADPYPPRCYRSTNLGDSTGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYIAGYNENARSRVSLIRRVCCYAVCVLVVSVLIMSGLLAIIYI....
F8SQW1_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTINVGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLANEVNSERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFPVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YG02_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFAIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVNKSRFAILVKAVPAPMRGYYSFRAFLTDNITSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRADS.ATAINEFSVATDDVKDVK------------------------------------------------------------------------------------------------------------....
F8SQV7_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVKDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAIFIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0Y0_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYMDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHRIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MNE7_9CLOS/1-128             ---------------------------------------------------------------DNVGPLSASIVVSPPVSGTYKIRAHVNNQPNCEGNVTYVKTANKSRFAVLVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFISSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDV----------------------------------------------------------------------------------------------------------------....
B7SCT0_9CLOS/1-195             MFAFASEDQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q7TE55_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MND4_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
F8SQX3_9CLOS/1-195             MFAFASESQDLLEEKIFRRRTYHRKYFDDVAKDFTIDIGYDDTDRDPTVLADYFSLYFFLLNNDNVGPIAASIVVNPPVSGNHKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
C0MND6_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNITYVKTVDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
D5KTA5_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0W0_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
B7SCT8_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YG01_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVDKSRFSILIKAVPAPMRGYYSFRAFLANDVASERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
Q9YN85_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDFSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
C0MNE1_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDV----------------------------------------------------------------------------------------------------------------....
Q0PI94_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVNKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETASNEFSVATDDVEDVKYV----------------------------------------------------------------------------------------------------------....
B8YG03_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVRKRAEIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPVRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
C0MNE0_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVSGTYKIRAHIDNQPNREGNVTYVKTVDKSRFVIRVKAVAASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFLFRAVS.ETATNEFSVATDDV----------------------------------------------------------------------------------------------------------------....
Q2EYW5_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTTDVGYDVVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2EYW0_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
I7D836_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
M9Z736_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIKYVRKRAEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFI....
Q0PI96_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
G8Z2U1_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDDVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q2I0S8_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
Q5MK80_9CLOS/1-195             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q8B3T7_9CLOS/1-303             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLGDSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYIAEYNENARSRVSLIRRVCCYAVCVLVVSVLIMSGLLAIIFI....
Q89539_9CLOS/1-302             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKASP-SMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLGDSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYIAGYNENARSRVSLIRRVCCYAVCVLVVSVLIMSGLLAIIFI....
B0F3U4_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLGDSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCCYAVCVLVVSLLIMSGLIAIIFI....
G8Z2S5_9CLOS/1-196             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q7TE22_9CLOS/1-202             MFAFASENQDFLEEKVFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVDESRFSILIKAVPAPVRGYYSFRAFLANDVASERSDFICSFVGRRFLCCCTQTISENLSKVCSSSFSFRAVS.KTATNEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2I0Y2_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERNESICSSVGSRFLCCCTQTISENLNNVCPSPFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B8YG04_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK65_9CLOS/1-195             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2EYX9_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MNE8_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLNKVCSSSFSFRAVS.ETAINEFSVATDDV----------------------------------------------------------------------------------------------------------------....
D5KTA1_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVDKSRFSILIKAVPAPMRGYYSFRAFLANDVASERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
B7SCT6_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIIDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISKNLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTB3_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTCHRKYLDDVVRDFTVDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0V0_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
I7D864_9CLOS/1-203             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYIKTVDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVSkKTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q7T711_9CLOS/1-302             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIGVGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIEVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKASP-SMRGYYSFRVFLCSDVASERSEFVCSFVGSRFLCCWKQTISENLSKVCSSSFFFRAVS.ERATNEFSVATDDVEDVKYIRKQAEGFSRCADPYVPRCYRSTNLGDSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVPPYIAGYNENARSRVSLIRRVCCYAVCVLVVSVHLMSGLLAIIFI....
Q5MK51_9CLOS/1-195             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPACMRGRYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATIEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
K0A1E3_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLGDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAVPATMRGYYSFRAFLSGDVASERSEFICSFVGSKFPCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK56_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILMKAVPAPMRGYYSFRAFLADDVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0X2_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIHIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISQNLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q2I0X0_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
G8Z2T9_9CLOS/1-196             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLSKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
G8Z2T3_9CLOS/1-196             MFAFASENQDILEEKVFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRIKATPASMRGYYSFRAFVSGDVASERSEFVCSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
B8YFZ3_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YG07_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
K0A1C1_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFNDVVKDFTIDIGYDTTDRDPAVLADYFSLYFFLLNNDSVGPVAASIVVSPPVNGTYKLRAHVGDQPNCEGNVTYVKSIDKSRFVIRVKAVPASMRGYYSFRAFLSSDVASERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.DTVTNEFSIATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0U8_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYLDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2I0T2_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTHHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
D0EAM1_9CLOS/1-303             MFASASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAATIIVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVDKSRFAILIKSVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q7TE33_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASIRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q2I0V4_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGGRFLCCCTQTISENLSKVCLSSFSFRAVS.KTAINEFSVAIDDVEGVKYARKRAE-----------------------------------------------------------------------------------------------------....
I7CB27_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYTKTVDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q7TE57_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSRFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MND3_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
F8SQW9_9CLOS/1-195             MFAFASESQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDDTDRDPTVLADYFSLYFFVLNNDNVGPIAASIVVNPPVSGNHKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
G8Z2T5_9CLOS/1-196             MFAFASESQDLLEEKIFRRRTYHRKYFDDVVKDFTIDIGYDDTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVNPPVSGNYKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKTVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKY-----------------------------------------------------------------------------------------------------------....
Q5MK42_9CLOS/1-195             MFAFASESQDILEEKIFRRRTRHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
C0MND9_9CLOS/1-127             ---------------------------------------------------------------DSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKASP-SMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDV----------------------------------------------------------------------------------------------------------------....
B5THD1_9CLOS/1-303             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFKAVS.ETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLGDSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYVAEYNENARSRVSLIRRVCCYAVCVLVVSVLIMSGLLAIIFI....
W8D0Q4_9CLOS/1-303             MFAFASENQDILDEKIFRRRTCHRKYLGDVVRDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRARVDNQSNREGNVTYVKTVDKSRFAIRVKAMPASMRGHYSFRAFVSGDVASERSEFICSFIGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNTNLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFI....
Q2LK64_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTAGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLSIIFI....
Q5MK68_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q0PI99_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINATPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETAANEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
Q0PI85_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRALS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
I7DBK8_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTCKIRAHVDNQPNCEGNVTYIKTVDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q5MK70_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASMRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA8_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNHEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIK------------------------------------------------------------------------------------------------------------....
D0EAN3_9CLOS/1-303             MFAFASENQDVLEEKIFRRRTCHRKYSDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNVGPLAASIIVSPPVNGTHKIRAHVDNQPNHEGNVTYVKTVDKSRFVIRIKTIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
G1DBA8_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLSASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTTNKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFISSRFLCCCTQTISENLSKVCSSSFSFRAAS.ETAINEFSVATDDVEDIKYVRKQAEGFSRCADPYPPRCYRGVSLGDSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q0PI82_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVNNQPNCEGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
Q9IFW8_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
M9ZTH7_9CLOS/1-303             MFAFASESQDILEEKIFRRRTRHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTYKIRAHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRMDNAGNVAITIPNTPLVNAVSPYVAEYNENALSRISLIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
Q7TE21_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFSLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVATDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2EYX1_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISQNLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIKYVRKRAE-----------------------------------------------------------------------------------------------------....
C0MND5_9CLOS/1-128             ---------------------------------------------------------------DNIGPLAASIIVSPPVSGTHKIRAHVDNQPNCEGNVTYVKTVDKSRFVIRVKVMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDV----------------------------------------------------------------------------------------------------------------....
Q0PI86_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFMIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
B7SCU6_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
I7CYL3_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVPSERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B8YG06_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKICSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B7SCU3_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK46_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLGDVVRDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA9_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISQNLNNVCSSSFFFRAVS.ETATNEFSVMTDDVEDIK------------------------------------------------------------------------------------------------------------....
Q7TE47_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVYSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q7TE35_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B7SCV0_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNNNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRINAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLKNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTB1_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADRDPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENLSNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B7SCT1_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
B9VB10_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLNKVCSSSFSFRAVS.ETAINELSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTDTAGDIAVTIPNTPLVSAVSPYVAEYNENTRSRISLVRRVCCYAVCVLVVSLLIMSGLLTIIFI....
B7SCT9_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
C0MNE2_9CLOS/1-128             ---------------------------------------------------------------DNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKNRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDV----------------------------------------------------------------------------------------------------------------....
Q7TE27_9CLOS/1-202             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISQNLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDIKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q5MK44_9CLOS/1-195             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKAVPASMRGYYSYRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0T8_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGAYKIRAHVDNQPNCEGNVTYIKTIDKSRSAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
M4MF16_9CLOS/1-303             MFAFASENQDILEEKIFRRRTRHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDSQPNREGNVTYVKTVDKSRFVIRVKVMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENLNNVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNESTRSRISLIRRVCCYAVCVLVVSLLIMSGLLTIIFI....
M9Z606_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLVADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
I3XHN0_9CLOS/1-303             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKTMDKSRFVIRVKAMPASMRGYYSFRAFLSGDVASERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLGDSSGVQSRTIEEEGYRMDTAGNVAVTIPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLAVIFI....
B9VB34_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFSLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLGKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTDTAGDVAVTIPNTPLVSAVSPYVAEYNENTRSRISLVRRVCCYAVCVLVVSLLIMSGLLTIIFI....
Q7TE39_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
Q0PI83_9CLOS/1-144             -----------------------------------------------------FSLYFFLLNNDNIGPLAASIIVSPPVNGTYKIRAHIDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYV----------------------------------------------------------------------------------------------------------....
F8SQV9_9CLOS/1-195             MFAFASENQDLLEEKVFRRRTYHRKYFDDVVRGFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTVNKSRFAILVKAVPAPMRGYYSFRAFLANEVNSERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
G8Z2T1_9CLOS/1-196             MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGTHKIRAHVDNQPNREGNVTYVKTVDKSRFVIRIKALPASMRGYYSFRTFVSGDVASERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVVTDDVEDVKY-----------------------------------------------------------------------------------------------------------....
B8YG08_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA2_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGIYKIRAHVDNQPNCEGNVTYVKTVDKSRFSILIKAVPAPMRGYYSFRAFLANDVASERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK58_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTFKIRAHVDNQPNRKGNVTYVKTVNKSRFAILIKAVPAPMRGYYSFRAFLADDVTSERSDFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
Q2I0S3_9CLOS/1-203             MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDRDPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKTFDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVKYIRKQAEG----------------------------------------------------------------------------------------------------....
M9Z3L6_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI....
Q7TE31_9CLOS/1-202             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRARVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVKYVRKRAE-----------------------------------------------------------------------------------------------------....
B8YFZ5_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKTANKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETANNEFSVATDDVEDIK------------------------------------------------------------------------------------------------------------....
Q2I0U2_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAVLIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
Q2I0V6_9CLOS/1-202             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYGIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKTIDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVKYARKRAE-----------------------------------------------------------------------------------------------------....
B8YG00_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHIDKQPNCEGNVTYVKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
F8SQX1_9CLOS/1-195             MFAFASESQDLLEERIFRRRTYHRKYFDDVVKDFTIDIGYDDTDRDPTVLADYFSLYFFLLNNDNVGPIAASIVVNPPVSGNHKIRAHIDNQPNREGNVTYVRTVDKSRFVIRVKAVPASMRGYYSFRVFLSSDAASERSEFVCSFVGSRFLCCCTQTISENLSKVCSSSFFFRAVS.ETATNEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
Q5MK54_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENLSKVCSSSFSFRAVS.KTAINEFSVAIDDVEDVK------------------------------------------------------------------------------------------------------------....
D5KTA4_9CLOS/1-195             MFAFASENQDVLEEKIFRRRTCHRKYLDDVVKDFTIDVGYDTVDRDPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVNGAYKIRTHVDNQPNREGNVTYVKTMDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENLGKVCSSCFFFRAVS.ETATNEFSVVTDDVEDVK------------------------------------------------------------------------------------------------------------....
B8YFZ4_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKIVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLNKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
F8SQU8_9CLOS/1-195             MFAFASENQDLLEEKIFRRRTYYRKYFDDVVRDFTIDVGYSVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDSQPNCEGNVTYVKTVDKSRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISEDLSKVCSSSFSFRAVS.ETAINEFSVATDDVEDVK------------------------------------------------------------------------------------------------------------....
B9VB46_9CLOS/1-303             MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYAKTVDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENLGKVCSSSFSFRAVS.ETAINEFSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRGANLGDSSGVQSRTIEEEGYRTDTAGDVAVTIPNTPLVSAVSPYVAEYNENTRSRISLVRRVCCYAVCVLVVSLLIMSGLLTIIFI....
#=GC seq_cons                  MFAFASENQDlLEEKIFRRRThHRKYhDDVV+DFTIDlGYDssDRDPTVLADYFSLYFFLLNNDNlGPLAASIlVSPPVsGTaKIRAHVDNQPNpEGNVTYVKTlDKSRFsIRIKAlPAoMRGYYSFRAFLSuDVASERSEFICSFVGSRFLCCCTQTISENLuKVCSSSFFFRAVS.ETATNEFSVsTDDVEDVK................................................................................................................
//
DBGET integrated database retrieval system