#=GF ID CagZ
#=GF AC PF09053.14
#=GF DE CagZ
#=GF AU Mistry J;0000-0003-2479-5322
#=GF AU Sammut SJ;0000-0003-4472-904X
#=GF SE pdb_1s2x
#=GF GA 25.00 25.00;
#=GF TC 26.60 462.80;
#=GF NC 22.50 22.20;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -Z 75585367 -E 1000 HMM pfamseq
#=GF TP Domain
#=GF WK CagZ
#=GF RN [1]
#=GF RM 15223328
#=GF RT Crystal structure of CagZ, a protein from the Helicobacter
#=GF RT pylori pathogenicity island that encodes for a type IV secretion
#=GF RT system.
#=GF RA Cendron L, Seydel A, Angelini A, Battistutta R, Zanotti G;
#=GF RL J Mol Biol. 2004;340:881-889.
#=GF DR INTERPRO; IPR015139;
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC CagZ is a 23 kDa protein consisting of a single compact L-shaped
#=GF CC domain, composed of seven alpha-helices that run antiparallel to
#=GF CC each other. 70% of the residues are in alpha-helix conformation
#=GF CC and no beta-sheet is present. CagZ is essential for the
#=GF CC translocation of the pathogenic protein CagA into host cells
#=GF CC [1].
#=GF SQ 1
#=GS O25261_HELPY/1-199 AC O25261.1
O25261_HELPY/1-199 MELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
#=GC seq_cons MELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
//