GenomeNet

Database: Pfam
Entry: Cas_Csx9
LinkDB: Cas_Csx9
Original site: Cas_Csx9 
#=GF ID   Cas_Csx9
#=GF AC   PF09658.7
#=GF DE   CRISPR-associated protein (Cas_Csx9)
#=GF AU   TIGRFAMs, Coggill P
#=GF SE   TIGRFAMs
#=GF GA   25.00 25.00;
#=GF TC   865.30 865.20;
#=GF NC   20.20 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR013488;
#=GF CC   Clusters of short DNA repeats with nonhomologous spacers, which
#=GF CC   are found at regular intervals in the genomes of
#=GF CC   phylogenetically distinct prokaryotic species, comprise a family
#=GF CC   with recognisable features. This family is known as CRISPR
#=GF CC   (short for Clustered, Regularly Interspaced Short Palindromic
#=GF CC   Repeats). A number of protein families appear only in
#=GF CC   association with these repeats and are designated Cas
#=GF CC   (CRISPR-Associated) proteins. This entry describes archaeal
#=GF CC   proteins encoded in cas gene regions.
#=GF SQ   2
#=GS H3ZK36_THELN/23-399  AC H3ZK36.1
#=GS Q5JGB3_THEKO/23-399  AC Q5JGB3.1
H3ZK36_THELN/23-399             MSWVVMDAGIEPDEEELADALEGALKSLGSRMKAHTSKMGRNDRSSFDKVLNAWFGRSAPETYGELFELVVTETIKLLRDGDIDPSESLSSIKIDKNGTYLGVTYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFTALGFFTGFAGFIGGKYYLMTKPGIEGFWPYEVEDVIRNGLLQLTGAGASGRISLSTEELYEMKLAMKLAEEGRNVVEEVYPVTLHLISLERQVYTELKTTQLNLAGLSEYMTKYMRKIEAISIGGLPLLVELKEGNATVQKYPLWALLDVAEKELWKGVNGDGEMLAYIFVKDLYRAINSGRRELIRDAVFRLFRQGRALLEGSSRASGEFRKVMKTFMWQEHLGVLL
Q5JGB3_THEKO/23-399             MSWVVMDAGIEPDEEELADTLEGALKSLGSRVKIHTSKMGRNDRSSFDKVLKAWFGRSAPETYGELFELVVTETIKLLRDGNIDPGESLSTIKTDKNGTYLGIAYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFMALGFFTSFAGFIGGKYYLMTKPGIEVFWPYEVEEIIEKGILPLTGAGASGRISLSTEELYEMKLAMKLAEEGRDVIEEVYPVTLHLISLEGQVYTELKTTQLNLTGLSEYMEEYVNRIESASMGGLPILVELKAGNATIQKYPLWALVDIAERELWKGVNGDGEMLAYIFVKDLYRAINSGRRELIRDAVFRLFRQGRALLEGSGRASGEFRKVMKTFMWQEHLEVLL
#=GC seq_cons                   MSWVVMDAGIEPDEEELADsLEGALKSLGSRhKhHTSKMGRNDRSSFDKVLpAWFGRSAPETYGELFELVVTETIKLLRDGsIDPuESLSoIKhDKNGTYLGlsYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFhALGFFTuFAGFIGGKYYLMTKPGIEsFWPYEVE-lIcpGlL.LTGAGASGRISLSTEELYEMKLAMKLAEEGRsVlEEVYPVTLHLISLEtQVYTELKTTQLNLsGLSEYMpcYhp+IEuhShGGLPlLVELKtGNATlQKYPLWALlDlAE+ELWKGVNGDGEMLAYIFVKDLYRAINSGRRELIRDAVFRLFRQGRALLEGSuRASGEFRKVMKTFMWQEHLtVLL
//
DBGET integrated database retrieval system