GenomeNet

Database: Pfam
Entry: CdhC
LinkDB: CdhC
Original site: CdhC 
#=GF ID   CdhC
#=GF AC   PF03598.10
#=GF DE   CO dehydrogenase/acetyl-CoA synthase complex beta subunit
#=GF AU   TIGRFAMs, Griffiths-Jones SR
#=GF SE   TIGRFAMs
#=GF GA   20.60 20.60;
#=GF TC   20.60 22.80;
#=GF NC   18.10 16.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR004461;
#=GF DR   SCOP; 1mjg; fa;
#=GF SQ   260
#=GS Q24X01_DESHY/316-728  AC Q24X01.1
#=GS D6Z1V4_DESAT/323-734  AC D6Z1V4.1
#=GS G3CWH7_9BACT/1-57     AC G3CWH7.1
#=GS E5EZQ3_9BACT/1-53     AC E5EZQ3.1
#=GS E5EZR9_9BACT/1-57     AC E5EZR9.1
#=GS E5E780_DESHA/1-125    AC E5E780.1
#=GS G3CWP5_9BACT/1-57     AC G3CWP5.1
#=GS E5EZL8_9BACT/1-57     AC E5EZL8.1
#=GS A5ZYD9_9FIRM/225-638  AC A5ZYD9.1
#=GS C4GCT7_9FIRM/22-214   AC C4GCT7.1
#=GS H6LD23_ACEWD/307-724  AC H6LD23.1
#=GS E5EZS8_9BACT/1-57     AC E5EZS8.1
#=GS F5YDA9_TREAZ/297-709  AC F5YDA9.1
#=GS E5E769_9FIRM/159-559  AC E5E769.1
#=GS ACDB_METKA/4-413      AC Q8TXF4.1
#=GS C8VX92_DESAS/320-731  AC C8VX92.1
#=GS E5E766_9FIRM/159-483  AC E5E766.1
#=GS F2ND76_DESAR/328-739  AC F2ND76.1
#=GS D6SM93_9DELT/315-726  AC D6SM93.1
#=GS ACDB1_METTE/1-412     AC P72021.3
#=GS Q1NIK7_9DELT/1-268    AC Q1NIK7.1
#=GS E5KJU0_9EURY/1-398    AC E5KJU0.1
#=GS C9L8Q0_RUMHA/295-708  AC C9L8Q0.1
#=GS G3CWS3_9BACT/1-57     AC G3CWS3.1
#=GS F8AA65_THEID/323-740  AC F8AA65.1
#=GS Q1NVC4_9DELT/323-734  AC Q1NVC4.1
#=GS F4BWM9_METCG/2-410    AC F4BWM9.1
#=GS E5EZN6_9BACT/1-57     AC E5EZN6.1
#=GS E5E762_9FIRM/159-559  AC E5E762.1
#=GS G3CWR5_9BACT/3-55     AC G3CWR5.1
#=GS E0RV81_BUTPB/30-211   AC E0RV81.1
#=GS G3CWR8_9BACT/1-57     AC G3CWR8.1
#=GS E5EZP7_9BACT/1-56     AC E5EZP7.1
#=GS E5E773_9FIRM/1-57     AC E5E773.1
#=GS D3RWP0_FERPA/22-430   AC D3RWP0.1
#=GS E5EZV3_9BACT/1-56     AC E5EZV3.1
#=GS E3GYE3_METFV/2-409    AC E3GYE3.1
#=GS E5EZP5_9BACT/1-56     AC E5EZP5.1
#=GS A9A068_DESOH/325-736  AC A9A068.1
#=GS E1YL47_9DELT/325-736  AC E1YL47.1
#=GS E5EZS4_9BACT/1-57     AC E5EZS4.1
#=GS E5EZU7_9BACT/1-57     AC E5EZU7.1
#=GS D9PUJ9_METTM/2-407    AC D9PUJ9.1
#=GS Q3ACS4_CARHZ/320-732  AC Q3ACS4.1
#=GS D9S2E9_THEOJ/294-707  AC D9S2E9.1
#=GS E5EZL6_9BACT/1-57     AC E5EZL6.1
#=GS A1RG05_SHESW/7-109    AC A1RG05.1
#=GS G2FKI1_9FIRM/309-721  AC G2FKI1.1
#=GS E3PXX6_CLOSD/294-708  AC E3PXX6.1
#=GS Q2Y4T7_9ARCH/39-455   AC Q2Y4T7.1
#=GS D7E800_METEZ/1-410    AC D7E800.1
#=GS F7JU45_9FIRM/31-217   AC F7JU45.1
#=GS E5EZN9_9BACT/1-57     AC E5EZN9.1
#=GS E5EZV4_9BACT/1-57     AC E5EZV4.1
#=GS E5EZS3_9BACT/1-57     AC E5EZS3.1
#=GS C6J8K6_9FIRM/295-708  AC C6J8K6.1
#=GS G3CWQ2_9BACT/1-57     AC G3CWQ2.1
#=GS B5YG69_THEYD/299-711  AC B5YG69.1
#=GS D1JFP6_9ARCH/7-413    AC D1JFP6.1
#=GS G3CWN7_9BACT/1-57     AC G3CWN7.1
#=GS C0CHK3_9FIRM/298-711  AC C0CHK3.1
#=GS D8GTW8_CLOLD/294-708  AC D8GTW8.1
#=GS E5EZS5_9BACT/1-57     AC E5EZS5.1
#=GS G3CWJ1_9BACT/1-57     AC G3CWJ1.1
#=GS F7NGT3_9FIRM/296-708  AC F7NGT3.1
#=GS C6PVX7_9CLOT/294-708  AC C6PVX7.1
#=GS B8GG91_METPE/262-673  AC B8GG91.1
#=GS D5XEF1_THEPJ/322-734  AC D5XEF1.1
#=GS G6B7A1_CLODI/294-708  AC G6B7A1.1
#=GS D8K0J1_DEHLB/321-732  AC D8K0J1.1
#=GS E5E781_9FIRM/160-560  AC E5E781.1
#=GS A7I7K3_METB6/265-676  AC A7I7K3.1
#=GS E5EZR7_9BACT/1-57     AC E5EZR7.1
#=GS E5EZS2_9BACT/1-57     AC E5EZS2.1
#=GS G7WKY1_METH6/24-428   AC G7WKY1.1
#=GS Q2RJ73_MOOTA/317-729  AC Q2RJ73.1
#=GS G3CWP1_9BACT/1-57     AC G3CWP1.1
#=GS G3CWP8_9BACT/1-57     AC G3CWP8.1
#=GS C9YJA6_CLODR/294-708  AC C9YJA6.1
#=GS C9XLV5_CLODC/294-708  AC C9XLV5.1
#=GS C0QAI9_DESAH/325-736  AC C0QAI9.1
#=GS D9QQM6_ACEAZ/308-720  AC D9QQM6.1
#=GS E5E767_9CLOT/157-558  AC E5E767.1
#=GS E5EZR0_9BACT/1-57     AC E5EZR0.1
#=GS F2KTA3_ARCVS/21-427   AC F2KTA3.1
#=GS E5EZP9_9BACT/1-57     AC E5EZP9.1
#=GS E5EZQ4_9BACT/1-57     AC E5EZQ4.1
#=GS ACDB2_METAC/1-412     AC Q8TJC4.1
#=GS G6BUD2_CLODI/294-708  AC G6BUD2.1
#=GS E5EZN8_9BACT/1-57     AC E5EZN8.1
#=GS E3GG19_EUBLK/298-715  AC E3GG19.1
#=GS G3CWN9_9BACT/1-57     AC G3CWN9.1
#=GS E5EZV5_9BACT/1-57     AC E5EZV5.1
#=GS C9RGX3_METVM/286-688  AC C9RGX3.1
#=GS G6BH69_CLODI/294-708  AC G6BH69.1
#=GS E5E764_9CLOT/157-556  AC E5E764.1
#=GS G6G4U6_9FIRM/314-726  AC G6G4U6.1
#=GS B1I318_DESAP/323-735  AC B1I318.1
#=GS E5EZM1_9BACT/1-57     AC E5EZM1.1
#=GS H5SP24_9BACT/338-749  AC H5SP24.1
#=GS C0CHK4_9FIRM/295-708  AC C0CHK4.1
#=GS H1L0V2_9EURY/2-409    AC H1L0V2.1
#=GS C0CR68_9FIRM/296-709  AC C0CR68.1
#=GS D3RX82_FERPA/11-359   AC D3RX82.1
#=GS E5EZN5_9BACT/1-57     AC E5EZN5.1
#=GS B1I1F4_DESAP/1-399    AC B1I1F4.1
#=GS ACDB1_METJA/295-698   AC Q57616.1
#=GS ACDB2_METMA/2-413     AC Q8PV85.1
#=GS E5EZL7_9BACT/1-57     AC E5EZL7.1
#=GS E5EZM4_9BACT/1-57     AC E5EZM4.1
#=GS G3CWH0_9BACT/1-57     AC G3CWH0.1
#=GS E5EZN0_9BACT/1-57     AC E5EZN0.1
#=GS C8W5H1_DESAS/320-731  AC C8W5H1.1
#=GS G3CWP0_9BACT/1-51     AC G3CWP0.1
#=GS D8F946_9DELT/325-736  AC D8F946.1
#=GS Q6LYK8_METMP/2-409    AC Q6LYK8.1
#=GS Q3ZX45_DEHSC/322-733  AC Q3ZX45.1
#=GS E1QGA5_DESB2/325-735  AC E1QGA5.1
#=GS Q64CV0_9ARCH/39-455   AC Q64CV0.1
#=GS G7WBL8_DESOD/314-726  AC G7WBL8.1
#=GS E6XMU9_SHEP2/7-109    AC E6XMU9.1
#=GS C9RB70_AMMDK/323-735  AC C9RB70.1
#=GS E5EZM7_9BACT/1-57     AC E5EZM7.1
#=GS E5E761_9FIRM/158-558  AC E5E761.1
#=GS A4YAC3_SHEPC/7-109    AC A4YAC3.1
#=GS B0A8V9_9FIRM/303-718  AC B0A8V9.1
#=GS E5EZM0_9BACT/1-57     AC E5EZM0.1
#=GS E5E777_9FIRM/158-431  AC E5E777.1
#=GS ACDB_METTH/2-409      AC O27745.1
#=GS F3QIZ7_9BURK/62-216   AC F3QIZ7.1
#=GS B8FJV8_DESAA/325-735  AC B8FJV8.1
#=GS E5E774_9FIRM/157-557  AC E5E774.1
#=GS E5E771_9FIRM/159-433  AC E5E771.1
#=GS A6VFR9_METM7/2-410    AC A6VFR9.1
#=GS E5EZP6_9BACT/1-57     AC E5EZP6.1
#=GS A4FY29_METM5/2-409    AC A4FY29.1
#=GS A6UNZ6_METVS/2-410    AC A6UNZ6.1
#=GS D5VTH8_METIM/280-689  AC D5VTH8.1
#=GS D3SIF7_DEHSG/322-733  AC D3SIF7.1
#=GS E5EZT2_9BACT/1-57     AC E5EZT2.1
#=GS Q3Z8K8_DEHE1/322-733  AC Q3Z8K8.1
#=GS H1ICH5_9FIRM/314-726  AC H1ICH5.1
#=GS F4C0K6_METCG/1-408    AC F4C0K6.1
#=GS F7UWA6_EEGSY/37-229   AC F7UWA6.1
#=GS F4LVQ2_TEPAE/294-707  AC F4LVQ2.1
#=GS G3CWI7_9BACT/1-57     AC G3CWI7.1
#=GS G3CWQ1_9BACT/1-57     AC G3CWQ1.1
#=GS F6CI77_DESK7/321-733  AC F6CI77.1
#=GS F8C3P7_THESO/345-762  AC F8C3P7.1
#=GS ACDB1_METMA/1-412     AC Q8PZ11.1
#=GS F6BF47_METIK/285-688  AC F6BF47.1
#=GS F7XLS4_METZD/16-428   AC F7XLS4.1
#=GS H1L0V7_9EURY/285-689  AC H1L0V7.1
#=GS G6I3Q9_9FIRM/320-731  AC G6I3Q9.1
#=GS D4J1C9_BUTFI/26-218   AC D4J1C9.1
#=GS Q46G06_METBF/1-411    AC Q46G06.1
#=GS H6LKY7_ACEWD/294-711  AC H6LKY7.1
#=GS A5ZYD8_9FIRM/295-708  AC A5ZYD8.1
#=GS E5E778_9FIRM/1-125    AC E5E778.1
#=GS G9XMF9_DESHA/314-726  AC G9XMF9.1
#=GS Q1PYY9_9BACT/316-727  AC Q1PYY9.1
#=GS D8WWT8_9FIRM/320-732  AC D8WWT8.1
#=GS C4Z342_EUBE2/27-223   AC C4Z342.1
#=GS G3CWN5_9BACT/1-57     AC G3CWN5.1
#=GS A0B5W3_METTP/2-410    AC A0B5W3.1
#=GS C0GF47_9FIRM/314-726  AC C0GF47.1
#=GS D5EBX2_METMS/2-410    AC D5EBX2.1
#=GS E5EZV7_9BACT/1-57     AC E5EZV7.1
#=GS C6LCL0_9FIRM/305-718  AC C6LCL0.1
#=GS G7WQP3_METH6/1-398    AC G7WQP3.1
#=GS E5EZR8_9BACT/1-57     AC E5EZR8.1
#=GS E5EZM2_9BACT/1-57     AC E5EZM2.1
#=GS Q2FQF9_METHJ/2-412    AC Q2FQF9.1
#=GS B8FZT4_DESHD/44-241   AC B8FZT4.1
#=GS E5EZP0_9BACT/1-57     AC E5EZP0.1
#=GS F8AM34_METOI/4-411    AC F8AM34.1
#=GS F8TEQ9_9CLOT/294-708  AC F8TEQ9.1
#=GS G3CWN8_9BACT/1-57     AC G3CWN8.1
#=GS E5EZM5_9BACT/1-57     AC E5EZM5.1
#=GS DCMA_MOOTH/317-729    AC P27988.1
#=GS DCMA_MOOTH/317-729    DR PDB; 2Z8Y O; 317-728;
#=GS DCMA_MOOTH/317-729    DR PDB; 1MJG N; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT A; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3S2X B; 1-136;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT E; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 1MJG M; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3S2X A; 1-136;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I01 O; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 2Z8Y N; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT C; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT D; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I04 N; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 1OAO C; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 1MJG O; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT F; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I04 O; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I01 M; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 1OAO D; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 2Z8Y M; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I04 P; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I01 N; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 2Z8Y P; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I01 P; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3I04 M; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 1MJG P; 317-729;
#=GS DCMA_MOOTH/317-729    DR PDB; 3GIT B; 317-729;
#=GS F8AM35_METOI/210-615  AC F8AM35.1
#=GS G3CWP6_9BACT/1-57     AC G3CWP6.1
#=GS P83789_CARHY/320-732  AC P83789.1
#=GS P83789_CARHY/320-732  DR PDB; 1RU3 A; 320-732;
#=GS E5EZV6_9BACT/1-53     AC E5EZV6.1
#=GS D5VUE1_METIM/1-407    AC D5VUE1.1
#=GS E5E772_9FIRM/159-559  AC E5E772.1
#=GS E5EZS6_9BACT/1-57     AC E5EZS6.1
#=GS A6TPS2_ALKMQ/294-708  AC A6TPS2.1
#=GS F5YMN8_TREPZ/302-714  AC F5YMN8.1
#=GS E5EZM6_9BACT/1-57     AC E5EZM6.1
#=GS D5Q0W1_CLODI/294-708  AC D5Q0W1.1
#=GS E5E779_MOOTH/1-125    AC E5E779.1
#=GS F6D6C0_METSW/2-408    AC F6D6C0.1
#=GS ACDB2_METJA/2-417     AC Q57620.1
#=GS G3CWJ2_9BACT/1-57     AC G3CWJ2.1
#=GS E5EZT6_9BACT/1-57     AC E5EZT6.1
#=GS B8FXA2_DESHD/314-726  AC B8FXA2.1
#=GS B8FGK7_DESAA/62-244   AC B8FGK7.1
#=GS F6CR43_DESK7/320-732  AC F6CR43.1
#=GS E5E763_9FIRM/157-561  AC E5E763.1
#=GS H1P323_9BACT/320-732  AC H1P323.1
#=GS E5EZP1_9BACT/1-57     AC E5EZP1.1
#=GS E5EZP4_9BACT/1-57     AC E5EZP4.1
#=GS A7I828_METB6/1-406    AC A7I828.1
#=GS G3CWQ4_9BACT/1-57     AC G3CWQ4.1
#=GS G3CWL8_9BACT/1-57     AC G3CWL8.1
#=GS G6I8V9_9FIRM/320-731  AC G6I8V9.1
#=GS E5EZW3_9BACT/1-57     AC E5EZW3.1
#=GS F6BF43_METIK/2-408    AC F6BF43.1
#=GS Q12XL5_METBU/2-411    AC Q12XL5.1
#=GS G3CWH1_9BACT/1-57     AC G3CWH1.1
#=GS F8TES6_9CLOT/294-660  AC F8TES6.1
#=GS D5RWL3_CLODI/294-708  AC D5RWL3.1
#=GS E5EZL9_9BACT/1-57     AC E5EZL9.1
#=GS C7P657_METFA/2-411    AC C7P657.1
#=GS E5EZP2_9BACT/1-57     AC E5EZP2.1
#=GS A6P2L5_9FIRM/31-217   AC A6P2L5.1
#=GS D9Y4G2_9BURK/62-216   AC D9Y4G2.1
#=GS H5Y4Z0_9FIRM/314-726  AC H5Y4Z0.1
#=GS F3AAB2_9FIRM/295-708  AC F3AAB2.1
#=GS G3CWN0_9BACT/1-57     AC G3CWN0.1
#=GS E5EZQ8_9BACT/1-57     AC E5EZQ8.1
#=GS G0H0D2_METMI/2-409    AC G0H0D2.1
#=GS ACDB_ARCFU/22-429     AC O29868.3
#=GS E5EZU8_9BACT/1-57     AC E5EZU8.1
#=GS G6I834_9FIRM/320-731  AC G6I834.1
#=GS E5E770_9FIRM/159-559  AC E5E770.1
#=GS F0T9G8_METSL/2-409    AC F0T9G8.1
#=GS H1J8G3_9FIRM/314-726  AC H1J8G3.1
#=GS ACDB2_METTE/1-410     AC Q9V2Z4.2
#=GS D3S711_METSF/302-712  AC D3S711.1
#=GS H7DX01_9FIRM/314-726  AC H7DX01.1
#=GS ACDB1_METAC/1-411     AC Q8TRZ6.1
#=GS Q0W881_UNCMA/2-412    AC Q0W881.1
#=GS E5E775_9FIRM/157-431  AC E5E775.1
#=GS A7B6C7_RUMGN/31-217   AC A7B6C7.1
#=GS E5EZP3_9BACT/1-57     AC E5EZP3.1
#=GS E5E768_CLODI/157-558  AC E5E768.1
#=GS Q189S5_CLOD6/294-708  AC Q189S5.1
#=GS G3CWR7_9BACT/1-57     AC G3CWR7.1
#=GS E5E765_9CLOT/1-183    AC E5E765.1
#=GS D2BHF3_DEHSV/322-733  AC D2BHF3.1
#=GS E5E776_ACEWO/157-574  AC E5E776.1
#=GS G3CWH2_9BACT/1-57     AC G3CWH2.1
#=GS G3CWS2_9BACT/1-57     AC G3CWS2.1
#=GS A0LLE1_SYNFM/325-736  AC A0LLE1.1
#=GS A9AAW4_METM6/2-409    AC A9AAW4.1
#=GS G6GFC9_9FIRM/314-726  AC G6GFC9.1
#=GS Q649S5_9ARCH/53-469   AC Q649S5.1
#=GS C9RHJ0_METVM/2-410    AC C9RHJ0.1
#=GS Q64BH1_9ARCH/7-415    AC Q64BH1.1
#=GS A8ZXU9_DESOH/37-228   AC A8ZXU9.1
#=GS A6UW76_META3/293-698  AC A6UW76.1
#=GS E5EZL5_9BACT/1-57     AC E5EZL5.1
#=GS A5FRE9_DEHSB/322-733  AC A5FRE9.1
#=GS D3S707_METSF/2-412    AC D3S707.1
#=GS Q1NJW3_9DELT/1-180    AC Q1NJW3.1
#=GS E5EZU3_9BACT/1-56     AC E5EZU3.1
#=GS Q46FC7_METBF/1-411    AC Q46FC7.1
#=GS E5EZQ0_9BACT/1-57     AC E5EZQ0.1
Q24X01_DESHY/316-728             ........................eIPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVSMV.G.PDE....VVDGQVTVIGPEID..T.VP....E.GS......RLP........LG..IKVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQVTIYTDQ.QAV......EENL.VKARERYRARDARLKS..LTDENVEEFYSCLLCQSFAPNHVCIVSPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGLAIDEVKGMWQSVNDYLRPSSNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRSYIISRKFIPAD.GGISRIVWMPKELKEFLKEDLVARSIDEGL.gEDFIDKIADESVGTTVEEIIPFLEENGHPCFSL....DPLM.........................................
D6Z1V4_DESAT/323-734             ........................kIDIPMSFGPAFEGERIRKDDLFMECGGGR.T..TGVEVLVSK.E.MDE....VEDGKITVEGPDIQ..E.IE....Q.GQ......NLP........LG..ILVEVA.G.REM.QSD...YEP....IL..ERQFHHLINYI...QGLM.H..M..GQ..R..DIMWLRIGKAAVEKGFS.LSHIGKVLHGKLHQEFGAIVDKIQVKIYTTQ.EKV......DEVM.ELAKSVYEGRDERLGS..MTDETEEVFYSCTLCQSFAPSHVCIITPERIGMCGAYNWLDGKASYQINPTGPNQPIPKGECLDPALGIFQGINEFVDQASRGAVTDLACYSLMNSPMTACGCFEAIAAMLPQCNGIMVVNRDYM.GMTPSGMKFTTLAGMAGGGAQTPGFMGVSKHYLTSPKLFLAE.GGLARLVWLPKMLKEEIKDKLIERAEAAGL..PGFYDKIATEEEGTTEEEILEFLKKVNHPALEM....ES--vv.......................................
G3CWH7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPAGPCQVITKERVINEDLGAYEDVDEAVQKYSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZQ3_9BACT/1-53                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLNPEGPCQVVSKENPVDEGIGIWPDCDRAVNQYSHGALEHVTLY----------------------------------.------------------------------------------.------------------------------..---------------------------------....----p........................................
E5EZR9_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNETTGAYETVNEAIGEATHGAVTKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5E780_DESHA/1-125               .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..--------------------NHVCIVSPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGLAIDEVKGMWQSVNDYLRPSSNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGG-----------------------.------------------------------..---------------------------------....----l........................................
G3CWP5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATHELDPNGPCQVVTKEKPIDERIGEYEDVNEAVRKFSQGALEDVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
E5EZL8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELDPNGPCRVVTKEKCLDEVTGRFEDVDEAVFQLSHGALEHVTLYSLLT------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
A5ZYD9_9FIRM/225-638             ........................nIDIPVAFASAFEGEIIRRKDMQVEFDGSR.V..DCAELVQTC.D.ASE....VEDHKITVVGPEVD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISIDAFNAGFK.IKHIGEVLYASVKNEFDAVVDKCEVVIYTDP.AEC......TRVRhEVAIPIFDKRDERLDT..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQVITKERPIDENLGSYEDVDEAVQKFSQGALEHVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFISSKKFMKAE.GGIERIVWMPKELKEFVAERLNKTAQELYG.iENFTDMIGDETVATDPEALVEYLTEKGHPALAM....DPMM.........................................
C4GCT7_9FIRM/22-214              .........elpvskgkpwpllken-------------EFLLQRDVAYELGIRT.R..PGVCYNAVT.S.DSE...lLEQDRILLYGRDLP..E.IK....N.DT......VFS........RI..TFLHID.PiEDP.NKA...YQT....VR..RLDFTRFKIIP...KGYM.I..L..SS..SmeNRENIRVSKKAIQNGLD.FTTIGKLFIDHYKKAA--RVNRAEIIFITEE.LNA.....iGQLE.KEARKIEEI-------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----tdafdhilkglvsdcdl........................
H6LD23_ACEWD/307-724             ........................eIDCPVAVSSAFEGERVRKDTMFAEFGGNK.T..ECWELVTTG.D.LAE....MEDHKITVVGPDID..DaMF....E.GKg...vvRLP........MG..VVVKVA.G.KQM.QKD...FET....VL..ERRIHYFTNYI...EGAM.H..V..GQ..R..NIAWIRLTKEAFEKGFR.LKHIGEVLYAKMRSDFDKVVDKCEVTIYTNA.EDV......KRLGeEMVKPIYAERDERMGA..LTDESVDEFYTCLLCQSFAPSHVCIVTPERLGLCGAVSWLDAKATKELDPMGPNQPVVKGAAIDERLGVWDSVNEAVATNSQGAVEKVTLYSILEDPMTSCGCFECICGIMPEANGVIIVNREFG.DVSPVGMTFGELASMTGGGVQTPGFMGHGRFLIGSKKFMSAE.GGLPRIVWMPKELKDDVADRLNKAVFEMTG.iENFADMVCDETIANDSEAVLEFLESKGHPALAM....DPIM.........................................
E5EZS8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVPKTGCTDERLGAYESVNEAVSKYSHGALERVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
F5YDA9_TREAZ/297-709             ........................kIDIPVSFSTAFEGEIIRRADMQVDMDGSR.L..DCFELVRTK.D.SSE....IEDHNIEIIGPDID..S.VE....V.GS......RFP........IG..YVVEVA.G.KNM.QSD...FEP....VF..ERRFHNFINCA...EGVM.H..T..GQ..R..DLIRIRVSKVAFDAGFR.AKHIGEILYAKVKSEYDSVVDKCQVKIYTNP.DDL......KRLR.AEANEIYNKRDDRLKS..LTDETVPVFYNCILCQSFSPAHVCIVSPERLGLCGAVSWLDAKATNELDPNGPCQVVTKERVVDENLGIWEDVNENVQQASHGSLQQVTLYSIMQDPMTSCGCFECICGIEPMSNGVVIVNREHT.GMTPLGMTFSEMASMTGGGVQTPGFMGHGKHFIASKKFMKAD.GGSRRIVWMPKALKDLVGSRLNKTVQELWG.vEDFTEKVGDETVAEDVEGLATFLAEKGHPVLEM....EPL-l........................................
E5E769_9FIRM/159-559             ........................nVDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVHTC.E.MTE....IEDHKITVVGPEVD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QSD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFAAGFK.IKHIGEVLYSQVKNEFDAVVDKCEVVIYTDP.AEC......TRIRhEVAIPIFNKRDDRLAT..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQEITKERVIDEELGAYEDVNEAVQKYSQGALEKVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKEFVADRLNATAKELYG.iDNFTDMIGDETVAEDPETLVAFLT---------....----.........................................
ACDB_METKA/4-413                 ........................lADLPVDVSPRHEGERIRSGDMYVELAGPK.S..FGAELFKVV.D.PDE....IEPDKVEVIGPDID..E.ME....E.GG......RYP........FA..IYVKAA.G.EEL.EED...VEG....VL..ERRIHEFCNYV...EGFM.H..L..NQ..R..DQIWCRVSKNVTEKGFR.LEHLGIALRELYKEEFGNVIDSVEVTIMTDE.EKV......EEFL.EYARRVYKKRDERAKG..LSEEDVNEFYVCLMCQSFAPTHVCVITPDRPSLCGSITWHDAKAAYKIDPEGPIFPIEKGECLDPEAGEYEGVNEAVKEHSQGTVERVYLHSCLEYPHTSCGCFQAVVFYIPEVDGFGIVDREYP.GETPIGLPFSTMAGEASGGEQQPGFVGVSYGYMESDKFLQYD.GGWERVVWMPKALKERMKHAIP--------..DELYDKIATEEDATTVEELREFLEKVEHPVVERw.aeE---eeeeee...................................
C8VX92_DESAS/320-731             ........................dIDVPIMVGPAFEGESLRKKDMFVEFGGQR.T..PGFELVRM-.A.GDD....IEDGTIELVGPDID..G.LE....P.GS......QLP........IG..IVVDVY.G.RKM.QED...FEP....VL..ERRVHYFTNYG...EGLW.H..V..AQ..R..DLMWVRISKDAYAKGFR.MRHIGDILYAKFKSEFSAIVDRIKITLITDE.AKV......LEMR.EVARSYYTKRDARLKE..LTDEGVDTFYSCLLCQTFAPTHVCVVAPERVGLCGAVSWLDAKAAFEINPHGANQPIPKGEVIDDVKGQWESFNEYTFSNSQRTVEKVNFYTIMEYPMTSCGCFEAIMAMVPECNGFMVVSREHS.GMTPTGMTFSTLAGMMGGGAQMPGFMGIGKSYLLSKKFVPAD.GGLARLVWMPKALKDLLREGLTERAIDEGL.gEDFVDKIADETIGASGEEILPFLEEKGHPALTM....DSM-f........................................
E5E766_9FIRM/159-483             ........................kIDIPVSYVSAFEGEIIRKADMQIEADGSR.V..DCFEFVQMK.E.LSE....VEDHKITVVGKDFD..E.FE....V.GE......KIS........MG..IIAHVA.G.KAM.QPD...FES....VF..ERKFHSFLKTV..sKDLC.T..Q..DK..R..DLIRVRVSKDTFNQGFR.AKHIGEVIYAKLKSEYDTVIDKCEVFVYTDA.DQV......HDLRhNLVIPTFNARDARIGN..MTDESVDEFYTCILCQAFSPSHVCIVTPERLGLCGAVSWLDAKATHELQPNGPSQIVRKDHCIDEVVGRYEEVDEAVQKYSQGALEHVTLYSIMEDPMTSCGCFECICGIEPFSNGVVIVNREHV.GMTPIGMTFSELASMTGGG-----------------------.------------------------------..---------------------------------....----v........................................
F2ND76_DESAR/328-739             ........................eVPIPTAFGPAFEGERVRKDELRSQCGGGK.T..LAVEWVTSK.R.MDE....VEDGKVELFGPDLD..S.VK....E.GG......GLP........LA..VVVEVA.G.RNF.QPD...FEP....IL..ERQMHHLVNYV...QGIM.H..M..GQ..R..DIAWYRFGKAAVEKGFR.LEHIGKLLHAKYHQDFGTIFDKVQVKLYTEK.EKV......DEIA.EQARKVYAERDARIEG..MTDETTDIFYSCTLCQSFAPTHVCVVSPERTGLCGAYNWMDCKASYEINPTGPNQPVAKGNMTDERYGKFDGVDAFVQKASRQAINTVSFYSLLVDPMTTCGCCECIASVLPMCNGVMTVHRDYT.GETPCGMKFTTLAGTAGGGLQTPGFVGHSKYNICQRKYLVGD.GGLLRMVWMPKSLKEELRERLIKRGEELGY..PNLIDMIADETVGVTEDAIYPFLEEKGHPALTM....ES--il.......................................
D6SM93_9DELT/315-726             ........................eIPIPLSYGPAFEGERVRKDDLFAECGGRK.S..TCCELLRMR.E.MEE....VEDGRIEVVGPDID..E.LE....P.VG......VLP........LA..IVVDVA.G.RKM.QKD...FEP....IL..ERQFHHLINSA...EGIM.H..M..GQ..R..DISWIRISRQAREKGFK.LSHIGDILHAKLLSDFPSIADKVQVTLYTEE.DKV......NEIL.QEARTLYNERDERLAG..LKDESVDTFYSCSLCQSFAPNHVCVITPERLGLCGAYNWLDGQASYEIDPSGPNKPVAKGEVIDQHKGEWQGVNEFISQASKGNLERLKAYSILEDPMTSCGCFECIVALLPAANGVMVVDRDFS.GMTPSGMTFSTLAGMVGGGIQTPGFLGVGKFYLGSDKFISAE.GGFKRLVWMPSHLKERLRNMLQAQAEKVGE..PDMLDKIADETVATTEMEVLEYLEKVGHPALGM....DPMM.........................................
ACDB1_METTE/1-412                ........................mAEFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAA.D.MDA....IEDDKVTIVGPDLK..D.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EPD...LES....VV..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAGKMDS.FEPFGKAVMMLFKTEL-PFIEKMQVTFYTGK.EEV......EKQM.ELAKEIFKARDARTKD..LHDEDVDVFYGCTLCQSFAPTNVCVVSPDRISLCGAINWFDGRAAAKVDPEGPQFEIAKGDLLDAVTGEYTGVNEIAKKLSSGEFDKIKLHSFFDSPHTSCGCFEVVGFYIPEVDGIGWVDREYQ.GMAPNGIGFSTMAGQTGGGKQIVGFLGIGVNYFYSPKFIQAD.GGWNRVVWLPSGLKAKIDEAIP--------..ADLKDKIATENDATDIASLKDFLEAKNHPVVATwaaaE---eeeeeeee.................................
Q1NIK7_9DELT/1-268               ........................r-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.---------------------QIQIKIYTES.EKV......NEVI.EMAKNVYEARDERLGS..MTDETEEIFYSCTLCQSFAPSHVCIITPERVGMCGAYNWLDGKASYQINPTGPNQPIDKGECLDSKLGIFQGINDFINQASRGAVTDLSCYSLMVDPMTACGCFEAIAAMLPQCNGIMVVNRDFM.GMTPSGMKFTTLAGMAGGGAQTPGFMGVSKHYLTSPKLFLAE.GGLPRLVWLPKMLKDELQDKLQERCQAIGM..PELFDKIATEENGTSEEEILEFLKKVGHPALEM....ES--vv.......................................
E5KJU0_9EURY/1-398               .........................------MSPMYEGERIRKDEIWVEMGGPK.A..KAFELSVAG.T.MDE....IQDGKVTVIGPDIS..E.LE....V.GK......TID........FG..MIFKVA.G.ELI.EKD...LES....II..ERRNHALLSYI...HGWM.H..L..NQ..R..DAIWMRAGLDLKKAGVTsFEQIFKNVMTLYKAEM-PFIEKMEVTILTDP.AAV......AKGL.EQAHTAYHARDERAKG..LHDEEVDVFYGCTLCQAFAPTSACCVTPDRPSLCGAITWFDGRAAAKVDPEGPQFAIPKTGVIDEIAGEYESVNEMAGSRSGGEYSRMALYTFFDAPHTSCGCFETIGFYMPEVDGIGVVDRDFR.NPTPNGLPFSTMAGQAGGGKQVVGFLGMGILYYFSPKFLQAD.GGWRRIVWMPKQLKERVKDGID--------..PEMYPKIATEEDAPDLAALKAFLLKVDHPVVD-....----gverkv...................................
C9L8Q0_RUMHA/295-708             ........................nIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVQTV.D.ASE....IEDHKITVVGPEAD..E.ME....L.GS......KNN........IA..YVVKVA.G.KNM.QSD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFNAGFR.IKHIGEVLYASVKNEFDAVVDKCEVVIYTDP.AEC......TRIRhEVAIPTFDKRDDRLKS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPNGPCQVITKERPIDERIGEYEDVNEAVQKFSQGALQDVSLYSIMEKPMTSCGCFECICGIEPFSNGVVITNREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKETVAERVNQTAKELYG.iDNFIDMVGDETIATDPEELVAFLTEKNHPALSM....DPMM.........................................
G3CWS3_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPAGPCQVITKERPIDENLGSYEDVDEAVQKFSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
F8AA65_THEID/323-740             ........................kLDIPVAYAPAFEGERVRKGDLYLECGGGR.T..PAVELLMAK.E.LDE....VEDGKIEVIGPEIN..E.VEklglE.GPp....yRLP........FA..VLVEVA.G.ANM.QED...FEA....IL..ERQFHHLINYA...QGIM.H..V..GQ..R..NIMWLRISKAAVEKGFL.FRHIGEILYAKLRQEYGAIVDKCQVKIYTEE.EKV......KEIL.ELAKQVYARRDEKIAG..MTDESVDVYYSCTLCQSFAPSHVCVITPERIGMCGAYNWLDGKACYEINPTGPNQPIPKGELIDETLGQYSGINEFVKQASRGKVERVSLYSIMVDPMTACGCFECIAAVLPTCNGIMIVNRDYM.GLTPTGMKFTTMAGMVGGGQVTPGFMGVSKHYITSRKFLTAE.GGLKRVVWMPKNLKEELMDKLKARAEEIGV..PDLIEKIADETVANTEEEVAAWIEKVGHPVKDM....PPL-m........................................
Q1NVC4_9DELT/323-734             ........................kIDIPMSFGPAFEGERIRKDDLFMECGGGR.T..PGVEVLISK.E.MEE....VEDGKVIIEGPDIK..D.IE....Q.GQ......NLP........LA..ILAEVA.G.REM.QSD...YEP....IL..ERQFHHLINYV...QGLM.H..M..GQ..R..DIMWLRIGKAAVEKGFS.LAHIGKVLHGKLHQDFGSIVDKIQIKIYTES.EKV......NEVI.EMAKNVYEARDERLGS..MTDETEEIFYSCTLCQSFAPSHVCIITPERVGMCGAYNWLDGKASYQINPTGPNQPIDKGECLDSKLGIFQGINDFINQASRGAVTDLSCYSLMVDPMTACGCFEAIAAMLPQCNGIMVVNRDFM.GMTPSGMKFTTLAGMAGGGAQTPGFMGVSKHYLTSPKLFLAE.GGLPRLVWLPKMLKDELQDKLQERCQAIGM..PELFDKIATEENGTSEEEILEFLKKVGHPALEM....ES--vv.......................................
F4BWM9_METCG/2-410               .......................ta-EVKLDISPMYEGERIRKEDLWVEMGGPK.A..DGFELSIAT.L.MDQ....IEDGKVNIIGPDLK..D.IK....E.GS......TIP........FG..MSFKVG.G.EKV.EKD...LES....II..ERRNHSLLSYI...SGLM.H..L..NQ..R..YDIWMRLGKSLQKKGVTsWEQIFKPVIELYKAEM-PFIEKMEVTVVTDP.AKV......KEEL.ASAMTIYKARDERAKG..LHDEDVDVFYGCTLCQAFAPTSSCVVTPDRPSLCGAITWFDGRAAAKVDPEGPQFPIPKTGLKDAIAGEYESVNEAAAKRSGGEYNIMKLYTFFDAPHTSCGCFETIGFYIPEVDGIGLADRDFK.GSAPNGLPFSTMAGQTGGGKQVVGFLGIGILYYFSSKFLQAD.GGWRRIVWMSKNLKERVKEGIP--------..EEIYSKIATEEDARDISSLKEFLLEVDHPVVE-....----gvvrpvddkk...............................
E5EZN6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVKKDHVIDERVGRIEEVNEAVKKYSQGALEEVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5E762_9FIRM/159-559             ........................kIDIPVSYASAFEGEIIRKADMQIEADGSR.V..DCFEFVQMK.D.LNE....VEDHKITVVGKDFD..E.FE....V.GE......KIS........MG..IIAHVA.G.KAM.QSD...FES....VF..ERKFHSFLNCI...EGLM.H..T..GQ..R..DLIRVRVSKDTFNQGFR.AKHIGEVIYAKLKSEYDTVIDKCEVFVYTDA.DQV......NDLRhNLVIPTFNARDARIGN..MTDESVDEFYTCILCQAFSPSHVCIVTPERLGLCGAVSWLDAKATHELQPNGPSQIVRKDHCIDEVVGRYEEVDEAVKKYSQGALEHVTLYSIMEDPMTSCGCFECICGIEPMSNGVVIVNREHV.GMTPIGMTFSELASMXGGGVQTPGFMGHGKHFIASKKFMKAE.GGLERLVWLPKKLKDEVADAINKTAKELYN.iXNFADMIADETIAEDGETLFNFLT---------....----.........................................
G3CWR5_9BACT/3-55                ......................rgg-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..----------------------------------------------ELDPNGPCQIVPKTRMIDERTGRYEDVNEAVNKYSHGALEQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E0RV81_BUTPB/30-211              ..............kgsswkdngss-------------EFIMQRDVALELGAGG.E..PSVNYTLVT.T.SGI....VTENETLVYGPDIN..E.IH....-.-G......NIS........FA..RIVILE.T.EDL.EEDk.dQEK....AF.aAIRNLEFVRYHvfpKGYMvR..V..SA..R.sNQEQIRISQGAYVNGIS.FAKVGALYIRKYKE-V-SGVKNVRVVFITDR.ELV......EKLM.PNADK-----------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----vdtitktlthildg...........................
G3CWR8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELDATGPSQPVPKDGLIDERTGRYEAVNKAVTEATHGAVENVTLYSL--------------------------------.------------------------------------------.------------------------------..---------------------------------....----xxx......................................
E5EZP7_9BACT/1-56                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..----------------------------------------DAKATNELDPNGPCQIVPKTRLIDERVGRYEDVNEAVSKYSHGALEQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5E773_9FIRM/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPAGPCQVITKERPIDENIGAYEDVDEAVQKYSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
D3RWP0_FERPA/22-430              .......................pe-SFPFEISPMFEGERVRKGDMYVELGGPS.Q..PGFELVIAL.P.KDQ....VEDMKVTLIGPDLD..E.ME....E.GK......AYP........YA..MIYYVA.G.DQV.DND...LEP....VI..ERRNHDFQNYI...EGYM.H..L..NQ..R..YDIWIRISKGAIKKGLKsLTEIALATMFLFKNEL-PFIEKIEAVYITDK.ELV......EKLLnEMAMPIYEERDARVEQ..LHDEDVDEFYSCTLCQSFAPTNVCIVSPDRPSLCGAITWFDGRAAARVDPEGPNRAVPKGECIDPIGGEYTGVNEFAKEESGGEYDRIKLHSFFEYPHTSCGCFEVIGFYMPEVDGIGWVHRGYP.DPAPNGLTFSTMAGQTGGGKQVVGFLGIGIAYFRSKKFIQAD.GGWYRTVWMPKELKERVLKYIP--------..EDMRDKIATEEDAKTIEELKEFLKRVNHPVVT-....----gvvrpvdgk................................
E5EZV3_9BACT/1-56                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATKELDPNGPCQIVPKTGCTDERLGAYDSVNEAVSTYSHGALEKVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E3GYE3_METFV/2-409               ........................fENIPVNVGAAYEGERIRSANMFVELAGPK.S..IGAELVRV-.-.KED....VEDGRIKVIGPDLD..E.MK....Q.GE......RHP........FG..IKIEIA.G.KDL.EED...LEG....VI..ERKIHELCNYV...QGFM.H..L..NQ..R..DQIWCRVSVEAKEAGFR.LKHLGEVLIALFKEEF-NIIDKISVTLITDE.EKV......KEFV.EEARKVYEKRDARVRE..LSEEDVDVFYGCVMCQSFAPTHVCIVTPDRPALCGAMNWFDCRAAHKIDPEGPIFEVEKGEVIDEIRGEYSGANDAVLEKSQGTIEKVYLHSVFEYPHTSCGCFEAIAFYIPELDGIGIVHRNYK.GETPLGIPFSTMAGQCSGGKQVEGFCGLSIEYMRSPKFLRAD.GGYERIVWMPKEIKEMVFDFIP--------..EELRDKIPTEEEAVTIEEIKEFLKEKGHPIVKRw..kE---ekevtkek.................................
E5EZP5_9BACT/1-56                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..----------------------------------------DAKATYELDPNGPCSVVTKERCLDEVIGRYEDVDEAVSQLSHGALEHVTLYSLLT------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
A9A068_DESOH/325-736             ........................eIDIPCAFGPAYEGERVRGKDLHSQMGGGK.T..QCTELVKSA.D.MKE....IEDGKVTVVGKDIP..D.LK....E.GD......TLP........LG..IFVQIA.G.REF.QED...FEP....IL..ERQTHHLVNYI...QGVM.H..I..GQ..R..DISWVRVSKAAVEKGFT.LKDIGVVLHAKLHQDFGKILDKVQVTLYTDK.KDV......DKLT.ETARAEYKRRDERVDK..MTDDDVETYYSCTLCQSFAPNHVCTVSPERTGLCGAYNWMDCKASFEINPTGPNQPIQKGECLDPVLGQWKGVNDFVYKTSRGAVEKYNLYSMVHDPMTTCGCCECIAATLPGLNGVMTVGRDYT.GDTPCGMKFTTLAGVMGGGAVSPGFVGHSKYNITQGKFIKGD.GGLLRMVWMPKMLKEEIKERIEARGKAMGV..PDLYDKIADETIGTTEEEIRPWLEEKGHPALSM....DPLM.........................................
E1YL47_9DELT/325-736             ........................kIDIPCSFGPAYEGERVRGADLYCQMGGGK.S..QATELVKMA.E.MNE....IEDGKVEVIGPDIK..D.MK....Q.GE......SVN........LG..IFVQVA.G.REF.QSD...FEP....IL..ERQIHHLVNYI...QYIM.H..I..GQ..R..DISWVRVSKAAVEKGFS.LKDIGVVLHAKFHQDFQKIVDKVQVTLYTKK.EDV......NKLT.KRARAEYRTRDERVEK..MTDESVEIYYSCTLCQSFAPNHVCTVSPERTGLCGAYNWMDCKASFEINPTGPNQPIEKGECLDPVLGQWKGVNDFVFKASRGAVTHYNFYSMIKDPMTTCGCCEAIAATLPTCNGVMTVHRDYN.GETPCGMKFTTLAGVMGGGASSPGFVGHSKFNITQGKFLKGD.GGLLRMVWMPKSLKEEIKDRIIKRGEALGY..PNLYDMIADETVGITEEEIMPFLQKVGHPALTM....P---sll......................................
E5EZS4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPQGPCQIITKERCIDERTGAYEDVNEAVKQFSQGALENVTLYSTIE------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5EZU7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPTGPCQVVPKERCIDENLGRYEDVDEAIQKYSHGALEHVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
D9PUJ9_METTM/2-407               ........................fEDIPVDVSPMHEGERIRSANMFVELAGPK.S..IGAELVQV-.-.KDS....VEDGKVEVIGPEIS..E.ME....Q.GQ......IYP........FA..INVEIA.G.SEL.EEE...LES....VI..ERRLHELCNYV...QGFM.H..L..NQ..R..DQIWCRVSTEARDAGFM.LEHLGKALSVLFREEF-PIIESISVTIMTDE.DAV......KEFL.ETAREKYEIRDSRARE..LSDEDVDVFYGCLMCQSFAPTHVCIVTPDRTALCGAINWFDCRAAYKMDPDGPIFEIQKGDVIDPEKGEYENVNAAVAENSQGTTERVYLHSVFGYPHTSCGCFEAVAFYIPELDGIGIVNRDFR.GETPLGIPFSAMAGQCSGGKQVEGFSGLSLEYMRSPKFLQAD.GGYSRIIWMPKDLKESVIDFIP--------..EDLRDKIATEVDATSIKELRRFLREKEHPVLER....AP--aeveeae..................................
Q3ACS4_CARHZ/320-732             ........................dIDLPINFGPAFEGESIRKGDMHVEFGGGK.T..PSFELVRMV.G.PDE....IEDGKVEVIGPDID..S.VE....P.GG......RLP........IG..IVVDIY.G.RKM.QED...FEP....VL..ERRIHYFTNYG...EGFW.H..T..AQ..R..DLTWVRISKEAFAKGAR.LKHLGQLLYAKFKQEFPSIVDRVQVTIYTDE.QKV......LELR.EIARKKYAERDARLRE..LSDEAVDTYYSCLLCQSFAPTHVCIVSPERVGLCGAISWLDAKAAYEINPNGPNQPIPKEGLIDPVKGQWESFNEYIYKNSQRTIERMNLYTIMEYPMTSCGCFEAIMAYLPELNGFMIVNREHS.GMTPIGMTFSTLAGMVGGGTQTPGFMGIGKSYIGSRKFVKAD.GGLARVVWMPKDLKEQLRSIIEERAEEEGL.gRDFIDKIADETVGTTVDEVLPFLEEKGHPALSM....EPL-l........................................
D9S2E9_THEOJ/294-707             ........................eVPIPVGFAAAFEGERVRKEDMFAEFGGGR.T..PAWELVRKR.D.LAE....VEDHKIEVIGPDID..T.LG...pD.GG......KLP........LA..ILVEVA.G.KNM.QED...FEP....VI..ERRIHYFLNYI...EGVM.H..I..GQ..R..DIMWLRISKSTYEAGFR.LHHIGEALYAKMLDEFGNIIDKIQVKIYTDG.EKV......EKLGeEIAKPKYEARDARLAG..LTDESVDTFYSCLLCQSFAPSHVCIVTPERLGLCGAVSWLDAKATKEINPTGPCQPIVKGECKDEVKGIWDSVNKAVQELSHGGVKEVTIYSILENPMTSCGCFECICGIMPEANGVIIVNREYA.GMTPLGMTFGELASTTGGGVQTPGFMGMGRQYITSKKFLLAE.GGIKRLVWMPKELKDAIRDKLNQRGKEIGI..ENFADMIADETVGTDPDSVLEFLNKVGHPALTM....DPIM.........................................
E5EZL6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNEKTGAYETVNEAIGEATHGAVTQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A1RG05_SHESW/7-109               ......................kql-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..------------------------------------------------------------------------------------------------------------------------KKQFQ.GSIPAGMTVEELLASAAGGKKSKGLLGAIQNNTSNQFLLGALlGATAAYVLSNDEMREKIVRSAVKLYTDIAGgmEELKEQVADIQA---------------------....----emavqtgd.................................
G2FKI1_9FIRM/309-721             ........................dIPIPVNFGPAFEGETIRKADTYVEFGGGR.T..TSFELVHSV.G.PDE....ITDGQITVIGPEID..T.VP....E.GT......KMP........LG..IVVNVY.G.RKM.QDD...FEG....VL..ERRIHYFTNYG...EGIW.H..V..AQ..R..DMCWVRISKDARAKGFL.IRHIGELLMAKLKQEFPAIIDRVEVVLYTDQ.AAV......EENL.VKAREVYRKRDDRMRA..LTDDSVEDFYSCLLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASFEIAPTGPNQPIPKGPAIDDLKGMWKSCNDYLYTTSNNTLEEVNLYTIMDKPMTSCGCFEAIMAIIPEVNGIMVTTREHS.GMTPCGMSFSTLAGTCGGGYQTPGFMGIGRTYLVSKKFIPAD.GGLARIIWMPKELKEFLREDLKQRCIDEGL.gEDFIDKIADETIGTTTEEITPFLEENGHPCFNL....DPLM.........................................
E3PXX6_CLOSD/294-708             ........................eIPIPVSFAAAFEGERIRKGDMFVEFGGGK.S..ESFEIVLMK.D.ASE....VEDHKIEIIGPDID..T.VT....DvPG......RMP........LA..VIVKIA.G.KAM.QTD...FEP....VL..ERRIHYFMNYI...EGVM.H..V..GQ..R..DITWIRIGKEAYEKGFR.LNHIGEVLYAKMMDEFDTVVDKCEITIITDE.EKI......KALKgEIATPKYEARDERLAS..LTDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDATGPCQPILKEGVIDENKGIWEKVNETVSEISQGAVNSVTLYSIMEDPMTSCGCFECICGIEPASNGVVIVNREFG.GVTPIGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFMRAE.GGIQRIVWMPKELKEYVQDKLNATAKELYD.iDNFTDMIADETIAADGEALIDFLSQKGHPALGL....DPL-m........................................
Q2Y4T7_9ARCH/39-455              ........................fTGISYDISPRQAGQRVRKHDMYCELGGPK.QrySSFFFIEVV.K.GED...kIEDGRVEVIGPEIK..E.I-....E.GQ......SLP........FG..FWIRYY.G.KEL.TED...YLD....LL..TRWTYFALEEG...EGWM.L..L..NT..R..DTIWLRLHKKNADK-HD.FEHLGQAMINLCKIQF-PLVEKADAKIMIAT.EDLggseltKGIIdNVCAPYWERVDKRARA..FSDDDADTFYGCTICQTFAPSHVCAVAPDRPPYCGIITWIGAKVMCDLDPYGYIFEMPKGECVDPEGGEYTGINEKIYEKSNRTYKRVVMYSSITYPQTNCGCFEAAIFYIPDVDGLGLVDRRYG.GETPLGLTFSKLAGLISGGQQNHGYCGISVRTPRSRKFVRAD.GGWNRIVWIPKEYKQILTEFIP--------..AEMFDKIATEEDCIDPEELKEFLKRVHHPVVTL....----wkngetpdpl...............................
D7E800_METEZ/1-410               ........................mAEFPLEISPMFEGERIRKNDMYVELAGPK.S..KGFELVRAT.D.SDE....IEDGKFTLIGPDIS..E.ME....E.GS......RYP........FA..MLYKIG.G.ELV.EPD...LEA....IV..ERRNHDFYNYM...QGVM.H..L..NQ..R..YDIWVRLSKDAVNKGLNsFEQMAAAMMSLFKNEL-SFIEKIEAVYITDP.EEI......DKEL.ENAMEIYKERDERTAN..LHEEDVDTFYGCTLCQSFAPSNVCVITPDRIALCGAINWFDGRAAAKVDPEGPQFPIEKGEVIDEVGGEYSGVNEAAKSLSGGEFDRIKLHSFFEYPHTSCGCFEVVGFYIPEVDGIGWVDRDFT.GNAPNGLPFSTMAGQTGGGKQVVGFLGIGINYFRSPKFLQAD.GGWDRVVWMPSHLKEKVVDYIP--------..EDVVNKIPTEQDVGDISELETYLKETEHPVIERw..sE---eeeeete..................................
F7JU45_9FIRM/31-217              ..................wnllken-------------EFLLQKEVAFELGIRS.Q..PSTCYQAVT.S.SKE...lLPEDKILLYGPDLP..E.IK....K.NV......PFT........RI..TWIQID.PiEDQ.DKA...YQR....IK..KLEFAKFKIIP...EGYM.M..L..SS..SmdQKEQVRVSKKAMKKALD.FATVGNLMIQKYKEEF--QAKHVQILFITRE.LPV......MDQL.---IAQGKKVDE----..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----itnafdhilkniildcdlcpl....................
E5EZN9_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYQLSPAGPSHPIKKEGLIDERLGKYEEVNRVVAEATHGAIEHVTLYSLIE------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5EZV4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPQGPCQIITKERCIDERTGAYEDVNEAVKQFSQGALENVTLYSIIED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZS3_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPNGPCQEITKERVIDERIGEYEDVNEAVRKFSQGALEEVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
C6J8K6_9FIRM/295-708             ........................nIDIPVAFASAFEGEIIRRKDMQVEFDGSR.V..DCAELVHTC.D.ASE....VEDHKITVVGPEVD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFAAGFK.IKHIGEVLYTQVKNEFDAVVDKCEVTIYTDP.AEC......TRIRhEVAIPIFEKRDDRLNT..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHELDPNGPCQVITKERPIDENLGSYEDVDEAVKKLSQGALEHVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFSEMASMTGGGVQTPGFMGHGKHFISSKKFMKAE.GGIERIVWMPKELKEFVAERLNNTAKELYG.iENFTDMIGDETIATDPETLVGFLTEKGHPALAL....DPMM.........................................
G3CWQ2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIPKEGCTNERTGAYESVNKAIGEATHGAVNQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
B5YG69_THEYD/299-711             .......................kp-PIPVAYGPAFEGERVRKEDTFIEFGGQK.T..PAFEWVRMK.E.IQE....LEDEKVEIVGADWQ.aK.YE....A.GG......KMP........LG..IVVNVA.G.KKM.QKD...FEP....VI..ERQIHTFINEA...EGLW.H..I..GQ..R..DINWIRISKKAKESGIT.LNHLGIIISSMIKSKFRSIVDKVEVYLYVDE.KEV......LELR.EQARKEYRQRDLRLAT..LTDEEVKEFYSCLLCQSFAPKHVCVITPERPGLCGAFTWLDAKAAYEIEPTGGNQPVQKGELFDPIYGRYSGVDEYVKKHSGGEIETINLYSIMENPMTSCGCFECIVAVVPEANGVLIVNRGYS.GMTPIGMKFSTIAGMIGGGIQTPGFMGVGVNYITSRKFLKGD.GGIRRIVWMPKELKERIKESFQKRAEEEGI..PELIEKIADETVCEDIECLLDYLSRIEHPALEM....EPI-i........................................
D1JFP6_9ARCH/7-413               ........................kAEFPFGINPMYEGERVRKSGMYVELGGVN.K..PGFELVLFEpD.PAK....INDGEVTLIGPDIE..D.ME....E.GG......LYA........YA..MIYRVS.G.EEL.EKD...LEA....VI..ERRDHEYQGYI...QGYM.H..L..NQ..R..AEIWVRISKDAVKKGLKsLKQIGEATISLFKAEL-PFIEKMEATYITDE.ETV......IQKL.EEANQIYEARDVRSRG..LHDEDVDEFYQCSLCQSFAPTNVCVVTPDRTALCGAMSWFDSRAAARVDPEGPNASIPKGECIDPIGGEYTGVNEAAVKLSSGEYDSIKLHSFLEKPHTSCGCFEVAGFYIPEVDGIGWVHRGSKvSETPIGLPFSTVAGSVGGGKQVRGFLGIGIQYFYSPKFIQYD.GGWRRVVWMASDLKDRVGDAIP--------..EEMKELIATENNAKDLEELSEFLKSVNHPVVD-....----gvtrev...................................
G3CWN7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPTGPCQIVTKERLIDERVGRYEDVNEAVQQYSHGALEQVTLYSILED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
C0CHK3_9FIRM/298-711             ........................nVDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVHTC.E.MTE....IEDHKITVVGPEVD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFAAGFK.IKHIGEVLYSQVKNEFDAVVDKCEVVIYTDP.AEC......TRIRhEVAIPIFNKRDDRLAT..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQEITKERVIDEELGAYEDVNEAVQKYSQGALEKVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKEFVADRLNATAKELYG.iDNFTDMIGDETVAEDPETLVAFLTEKGHPALGL....EPMM.........................................
D8GTW8_CLOLD/294-708             ........................eIPIPVSFAAAFEGERIRKNDMLAEFGGNK.T..KAWELVMCA.D.QGE....VEDHKIEVIGPDID..T.ID...kA.PG......RMP........LG..MLIKVS.G.TNM.QKD...FEP....VL..ERRLHYFLNYI...EGVM.H..V..GQ..R..NLTWVRIGKEAFEKGFR.LKHFGEVIYAKMLDEFGSVVDKCEVTIITDP.DKA......EELEgKYAVPRYSERDARLES..LVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFG.ATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGE.GGLGRIVWMPKELKDFVAEKLNKTAKELYD.iDNFADMICDETIATESEDVVKFLEEKGHPALKM....DPIM.........................................
E5EZS5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELNPNGPCQPIFKEGCTDERLGRYDSVNKAISEATHGAVENVTLYSLLED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G3CWJ1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQVITKERPINEELGAYEDVDEAVQKFSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
F7NGT3_9FIRM/296-708             ........................dIPVPITVGPAFEGETIRRADTYLEFGGGK.T..TAFELVRMV.G.PDD....IEDGKITVIGPEIT..D.VK....E.GD......RLP........LG..IMVNIY.G.RKM.QED...FEG....VL..ERRIHYFVNYG...EGLW.H..V..AQ..R..DLAWVRIGKNAAAAGLK.IRDIGEILIAKFKSDYPAIVDRVQVTIYTDQ.AKV......DENI.KIAREKYAARDARLKG..LTDESVDTFYSCILCQSFAPNHVCIVTPERVGLCGAVSWLDAKASNEITPTGPNQPIAKGTCLDEVKGMWQNVNEYLYNNSHHTLEEVNLYTLLDRPMTSCGCFEAIMAILPEANGIMITTREFG.GDTPCGMSFSTLAGSVGGGLQSPGFMGIGRRYIVSNKFIPAD.GGLGRIVWMPKELKEYLRADFIEQAKKQGL.gEDFLDKIADESIGTAIDEVLPFLEEKGHPALTM....DPLM.........................................
C6PVX7_9CLOT/294-708             ........................eIPIPVAFAAAFEGERIRKGDMHIEFGAGK.T..EAWELVMSG.D.SSE....VEDHKIEIIGPDID..S.LK....DvPG......RLP........MG..MLVKVS.G.ANM.QKD...FEP....VL..ERRLHYFLNYI...EGVM.H..V..GQ..R..NMTQVRISKEAFDKGFR.LKDFGEVIYAKMLDEFGSVVDKCEVTLITEL.DKV......HELKdKLAMPRFAERDERLES..LIDENVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKDGLVDENAGIWDKVNETVSKISQGAVNNVTLYSILQDPMTSCGCFECITGIMPEANGVVIVNREHG.ATTPLGMTFVELASMTGGGVQTPGFMGHGRSFIPSKKFMKAE.GGIGRIVWMPKELKDFVAEKLNKTAKELYG.iDNFADMICDESIAVESDAVVAFLEEKGHPALTM....DPIM.........................................
B8GG91_METPE/262-673             ........................aIPIPMACSPAFEGKSIRKEEMYAEFGGGR.S..PAFELLRVR.P.EAE....VEDGKVTVIGPEIE..T.IP....E.GS......AAP........LG..IVIEVA.G.KTM.KKE...YEP....VL..ERRIHNFVNYG...EGSW.H..V..AQ..R..DLIWVRLSKEAVKNGVR.VEHIGKLLASKFRIDFPDLLDAVQVTLITDP.EQV......LTAK.KEAEAIYDERDARIKG..MKDDDADTFYSCTLCQTFAPDHVCVITPERPGLCGAISWLDGKIAYEISPAGANQPVQKGGLISAENGEFEGVNRFVRKASHGAIERCQLYNFMEYPMTACGCFEVIALVLPEVNGIMVVNREYK.GETPSGMSFSTLAGTIGGGVQTPGFAGISKSYILSDRFLQAE.GGIDRLVWMPSVLKEELASRLKERLKAQGK..GDLFEKIADERNAETIEALTEFLAGVDHPALTM....DS--il.......................................
D5XEF1_THEPJ/322-734             ........................eIDIPINHGPAFEGETIRKGDMFLEMGGGR.T..PSFELVRM-.A.DDT....IEDGKIELIGPDID..S.LP...pE.GG......RLP........IG..IVVDIY.G.RKM.QPD...FEP....VL..ERRIHYGINYG...EGLW.H..V..AQ..R..DLNWMRVSKDAYAKGFR.LKHLGDLLYAKFKAEFASIVDRVQVTIYTDE.QKV......LEMR.EVAREYYRKRDARLKE..LTDEGVEEFYSCTLCQSFAPTHVCVVAPERVGLCGAVSWLDAKAAYEIDPHGANQPILKGECEDEVKGSWKSFNEFIYQHSQRTVEKVNFYTIMENPMTSCGCFEVILTMVPECNGFMAVNREHS.GMTPCGMNFSTLAGTCGGGAQLPGFMGIGKAYFGSRKFIKAD.GGLARIVWMPKALKEQLRPILEERAEEDGL.gKDFVDKIADETVGVTGEEILPFLEEKGHPALTM....PP--ll.......................................
G6B7A1_CLODI/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
D8K0J1_DEHLB/321-732             ........................eVPVPVAYGPAFEGERVRGDDIYLECGGGR.T..AMLEWVTTR.P.SSA....ITDGQVEVIGPEIT..D.VT....A.GS......KLP........LA..IVIEVA.G.RQM.QED...YEP....IL..ERQVHHLINYA...QGVM.H..I..GQ..R..DLAWLRISKGAVEKGFR.LEHIGRLLHARLHQDFGRIFEKLQVKIYTGE.DDV......AHVA.VPAGQAYTARDKRIEG..MTDESTDVFYSCLMCQSFAPSHVCVVSPERTGLCGSYNWMDCKASYEINPTGPNQPVTKGATLDARLGQWQGVNEYVQQASRGKVDHYNFYSIMTDPMTACGCMECISALAPMCNGVMTVSREHN.GMTPCGMKFTTLAGTIGGGVTTPGFVGHSKFNITQRKFLAAE.GGIKRLVWMPRALKEEVAERFNRRAAELGI..PDLLDRVADETVGTTEEEILTFLTEKEHPALTM....EPL-i........................................
E5E781_9FIRM/160-560             ........................nIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVQSA.E.ATE....IEDHKITVIGPEAD..E.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QSD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFNAGFR.LKHIGEVLXASVKNEFDAVVDKCEVVIYTDS.AEC......KRIRhEVAIPTFNKRDDRLKS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPNGPCQVITKEKCIDERIGEYEDVNEAVRKFSQGALEEVSLYSIMEKPMTSCGCFECICGIEPFSNGVVITNREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKEFVAERLNQTAKELYG.iDNFTDMVGDETIATDPEELVAFLT---------....----.........................................
A7I7K3_METB6/265-676             ........................aIPIPMGCSPAFEGKSIRKEEMQVEFGGGR.S..PAFELLRMK.N.PGE....IEDGKVTVVGPEID..T.MK....E.GG......AYP........LG..IVIEVT.G.KGM.KKD...YEP....VL..ERRIHNFVNYG...EGSW.H..V..AQ..R..DLVWVRISKEAFAKGVK.IEHLGKLLASKFRMDFPQLLDAVSVTLITDP.EKV......LAGK.NEAEKIYEERDARIKG..MRDNDVDTYYSCTLCQTFAPNHVCVITPERPALCGAISWLDGKIAYEMSPSGANQPVEKGAPVNVQNGEFEGVNRFVKKASHGEIERCSLYSVMEFPMTCCGCFEAIALMLPEVNGIMVVNREYK.GMTPSGMTFSTLAGTIGGGAQTPGFAGISKNYILSDRFLQGE.GGIERLVWMPSQLKEELKPRLVPLLAAKGH..PDLFDKIADEVSAPTIEDLMAFLERVGHPALAM....KPLM.........................................
E5EZR7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDTKAGHEISPNGPFQPLDKGAVIDDNKGEFIGVNNMIASATAGNIERLCLYSIMD------------------------------.------------------------------------------.------------------------------..---------------------------------....----s........................................
E5EZS2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATKELDPNGPCQIVPKEGCTDERLGAYESVNEAVSKYSHGALERVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
G7WKY1_METH6/24-428              ........................aEEIELDMSPMYEGERIRKGDIWVEMGGPK.A..KAFELSVAG.S.MNE....VQDGKVTVVGPDIS..A.IP....E.GS......TIP........FG..MIFKVA.G.ELI.EKD...LES....II..ERRNHALLSYV...HGLM.H..L..NQ..R..DAIWMRAGLDLKKAGVTsFEQVFKNVMNLYKAEM-PFIEKMEVTVLTDP.AAV......EKGL.EQAHAAYHARDERAKG..LHDEEVDVFYGCTLCQAFAPTSACCVTPDRPSLCGAITWFDGRAAAKVDPEGPQFAIPKTGVIDEIAGEYESVNEMAGSRSGGEYSRMALYTFFDAPHTSCGCFETIGFYMPEVDGIGVVDRDFR.NPTPNGLPFSTMAGQAGGGKQVVGFLGMGILYYFSPKFLQAD.GGWRRIVWMPKQLKERVKDGID--------..PEMFSKIATEEDAPDLAALKAFLLKVDHPVVD-....----gverkv...................................
Q2RJ73_MOOTA/317-729             ........................kLDLPINFGPAFEGESIRKGDMYVEMGGNR.T..PAFELVRTV.S.ESE....ITDGKIEVIGPDID..Q.IP....E.GS......KLP........LG..ILVDIY.G.RKM.QAD...FEG....VL..ERRIHDFINYG...EGLW.H..T..GQ..R..NINWLRVSKDAVAKGFR.FKNYGEILVAKMKEEFPAIVDRVQVTIFTDE.AKV......KEYM.EVAREKYKERDDRMRG..LTDETVDTFYSCVLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASYEINHAGPNQPIPKEGEIDPIKGIWKSVNDYLYTASNRNLEQVCLYTLMENPMTSCGCFEAIMAILPECNGIMITTRDHA.GMTPSGMTFSTLAGMIGGGTQTPGFMGIGRTYIVSKKFISAD.GGIARIVWMPKSLKDFLHDDFVRRSVEEGL.gEDFIDKIADETIGTTVDEILPYLEEKGHPALTM....DPIM.........................................
G3CWP1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATYELDNNGPCQIVTKEKVIDERIGEYEDINEVVKKLSQGALEDVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
G3CWP8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNEKTGAYETVNEAIGEATHGAVNQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
C9YJA6_CLODR/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
C9XLV5_CLODC/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
C0QAI9_DESAH/325-736             ........................dIDIPMSFGPAFEGERVRGADLHAQCGGGK.T..QCTELVKMA.Q.MNE....IEDGKIIIDGPDVG..D.LK....V.GD......TFP........LG..IFVQIA.G.REF.QSD...FEP....IL..ERQIHHLVNYI...QGIM.H..I..GQ..R..DISWVRISKSAMEKGFT.LKDIGVVLHAKFHQDFTKILDKVQVTLYTKQ.ADV......DKLT.ATARDEYHTRDSRVDK..MKDEDVETYYSCSLCQSFAPNHVCTVSPERTGLCGAYNWMDCRAAFEINPTGPNQPIEKGECLDPKLGQWKGVNDFVYKASRGAVARYNLYSMVVDPMTTCGCCECIAAMLPGCNGVMTVGRDYP.GETPCGMKFTTLAGVMGGGASSPGFVGHSKHNITQGKFILGD.GGLLRMVWMPKMLKEEIKDRIEKRGAEMGC..PGLYDMIADETVGITEEEILPFLKEKGHPALTM....ES--li.......................................
D9QQM6_ACEAZ/308-720             ........................dIPVPITVGAAFEGQQIRSDDMYVEFGGQR.T..TAFELVKKR.D.KDE....VEDGNVELIGPDID..E.VE....E.GG......QLP........LG..IMVDIY.G.RDM.QED...FEG....VL..ERQTHHFCNYG...EGLW.H..M..GQ..R..DINWIRISKEAKEAGFT.IKGIGEILYAKFKSEFPSIIDRLQIRLITDQ.DKV......EEKL.EEAKARYDKRDERMEK..LSDESVDVFYDCTLCQSFAPDHVCVVTPDRVGLCGAISWLDAQAAYEIDPAGPNQPIELGETIDEEKGQWEGCNKRTEKESGGNVTEVNLYSMMESPMTSCGCFEAIMAMVPEANGIMIVNREHG.GQTPVGMTFSTLAGSVGGGNQTPGFMGIGKTYVTSDKFIQAD.GGIARIIWMPKEFKEQLEDDIKQRAKEEGL.gEDFYDKIADETVGTAAEEILPYLQEKGHPALDM....DPLM.........................................
E5E767_9CLOT/157-558             ........................eIPIPVGFAAAFEGERVRKDDLNVEFGGNK.T..ECWELVKAR.D.LGD....IEDHKIEIIGPDID..Q.IE...gT.PK......RLP........LA..IIVEVA.G.KNM.QED...FEP....VL..ERRIHYFMNYT...EGVM.H..V..GQ..R..DTSWIRINHDTFNAGFR.LKHIGEVLYAKMRDEFDAVVDKCQITIVTDP.EKV......AAMKeTHAIPKYTARDERLAS..LTDDSVDTFYSCLLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATKELDPTGPCQPILKEGVEDEDKGIWNSVNEHVAEKSQGAVERITLYSLMEDPMTSCGCFECIAGIMPEANGVVIVNREHG.GTTPVGMTFGELASMSGGGVQTPGFMGHGRFFISSKKFAAYE.GGPKRIVWMPKELKDYVSERLNQTAKEMYG.iDNFTDMICDETIAVDPEEVLNFLT---------....----.........................................
E5EZR0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELSPAGPSQPITKEGLIDEKLGAYESVNKMVASATHGAVEKVTLYSLVQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
F2KTA3_ARCVS/21-427              ........................eLDFPFDISPMHEGERIRKGEMYVELGGPK.Q..PGFELVVAL.K.PEE....VEDMKVTLIGSDLD..E.LE....E.GK......AHP........YA..MIYYVA.G.SQV.DPD...LEP....II..ERRNHDFQNFI...EGYM.H..L..NQ..R..YDVWVRISKEAVKKGLNsLTQIAKATMMLFKNEM-PFIEKIEALYITDG.ELV......EKLLkEYAMPIYDERDARIES..LHDEDVEEFYSCTLCQSFAPTNVCIISPDRPSLCGAITWFDGRAAARVDPEGPNRAVPKGEVIDPIGGEYTGVNEFAKDESGGECERIKLHSFFEYPHTSCGCFEVIGFYMPEVDGIGWVHRGYG.EPAPNGLTFSTMAGQTGGGKQIVGFLGVGVGYFRSKKFIQAD.GGWYRVVWMPKELKQRIEKYIP--------..EDIRDKIATEEDAKTIDELKEFLKKVNHPVVT-....----gvvrpvd..................................
E5EZP9_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNQLNPNGPCQIVSKDDCQDERVGIWPDVDRAVKEFSQGHLEKVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5EZQ4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVKKEHVIDEAVGRYEEVDEAVHKYSQGALEHVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
ACDB2_METAC/1-412                ........................mAEFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAK.P.MDE....IEDDKVTIVGPDLK..E.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EPD...LES....VV..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FEPFGQAVMMLFKTEL-PFIEKMQVTFYTEQ.AEV......EKQL.EEAKAIFKARDERTKD..LHDEDVDVFYGCTLCQSFAPTNVCVVSPDRVSLCGAINWFDGRAAAKVDPEGPQFEITKGDLIDAEKGEYTGVNDIAKKLSAGEFDKIKLHSFFDAPHTSCGCFEVVGFYIPEVDGIGWVNREYQ.GMAPNGIGFSTMAGQTGGGKQIVGFLGIGINYFYSPKFIQAD.GGWNRVVWLPSMLKDKIAETIP--------..EDLKDKIATENDATDIESLKAFLQEKGHPVVATwaaaE---eeeeeeee.................................
G6BUD2_CLODI/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
E5EZN8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQVVTKERILDERIGTWEDVDEMVYKLSHGALEHVSLYSILED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E3GG19_EUBLK/298-715             ........................eIDCPVSVSFAFEGERVRKDNMKAEFGGNR.T..KAWELVHTV.E.LGD....IEDHKITVVGPDID..D.PQ...fD.GVd...vvRIP........FG..LEIKVA.G.KAM.QSD...FES....VL..ERRLHYFLNYI...EGSM.H..V..GQ..R..NICWVRLTKEAFDAGFR.LRHFGEVVYAKMLDEFGKVVDKVEVTIYTKE.EDV......VRLEeELVRPIYNVRDDRLNS..LTDESVDVFYTCTLCQSFAPSHVCVVTPERLGLCGAVSWLDSKATKELDPTGPAQPIEKNGVIDERLGAWEEVNDVVAKCSQGAVEKVTLYSILEDPMTSCGCFECICGIMPEANGVVIVNREFG.GMTPTGMTFSELASMTGGGVQTPGFMGHGRRFISSKKFMAAE.GGIERIVWMPKELKDDVAERLNKSVQELYG.iENFTDMVCDETIAVDSEAVLEFLTEKGHPALEM....DPIM.........................................
G3CWN9_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNQLNPNGPCQVVSKENVVDEEIGIWPDVNRAVHEFSQGALEEVTLYSII-------------------------------.------------------------------------------.------------------------------..---------------------------------....----vn.......................................
E5EZV5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPQGPCQIITKERVIDERIGEYEDVNEAVRKFSQGALEDVSLYSIIE------------------------------.------------------------------------------.------------------------------..---------------------------------....----x........................................
C9RGX3_METVM/286-688             ........................eFDIPVSVGPMNEGERIRGPDMYVELAGPK.S..YGFELVRVV.-.-DN....-ADDEVKIIGKDID..E.ME....E.GS......RNP........FA..VIVRVS.G.ENL.EED...LEG....VL..ERRVHEFFNYI...EGVM.H..L..NQ..R..DQVWIRISKDAYQKGLR.LKHIGEVIKQLFKEHF-PIIEKCDVLLITDP.EKI......KEEL.EKAREIYKKRDEKTKS..IREEDVDVFYGCIMCQSFAPTHVCVITPDRPSLCGSINYLDARAAAKIDPNGPIFEIKKGECLDEKLGVYSGVNEVVREKSQGSVEEMALHTALENPCTSCGCFEAIVFYIPEVDGFGVVHRHFR.GETPFGLPFSSLAGQCSGGKQVPGFVGISISYMKSPKFLQGD.GGWERIVWLPKELKERVKDAIP--------..EGLFDKIATEEEVKTTDELIKFLKEKGHPVFKQ....EEE-keee.....................................
G6BH69_CLODI/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
E5E764_9CLOT/157-556             ........................nIDVPIMVGPAFEGETIRKGDTYVEFGGGR.T..TAFELVKMV.G.PDE....IEDGKITVHGPEID..E.IE....E.GS......KLP........LG..IKIKIY.G.RKM.HQD...FES....VL..ERRVHYFINYG...EGLW.H..V..AQ..R..DLCWLRISKDAKAKGFK.IRHFGELLIAKFKSEYPALVDRVEVELYTDE.KLV......NEQI.KEARGIYVKRDERLKG..LTDESVEELYSCTLCQSFAPNHVCVVAPERVGLCGAVSWLDAKASYEITPTGPNRPIKKEGAIDEVKGIWKSVNDFVYNNSNHMLEEVSLYTLMENPMTSCGCFEAIIAMMPEVNGVMITSREHG.GITPCGMSFSTLAGTVGGGTQSPGFMGIGRRYILSRKFLKAD.GGMARIVWMPKELKDYLREEFIKRSIEEGL.gEDFINKIADESIGTSAEEIVPFLE---------....----.........................................
G6G4U6_9FIRM/314-726             ........................eLPIPINFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVRMV.G.PDN....IVDGQVTVIGPDID..T.VP....E.GT......KLP........LG..LKIDIY.G.RKM.QED...FEG....VF..ERRIHYFANYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHFGDLLIAKLKEEFPAIIDRVEVTIMLDQ.AAV......DEGI.VIARERYRARDDRMRS..LTDESVEDFYSCLLCQSFAPNHVCITTPERVGLCGAVSWLDAKASHEIAPNGPNQPIPKGPAIDELKGMWQSCNDYLYKASNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMLTTREHS.GMTPCGMTFSSLAGTCGGGMQTPGFMGIGRTYLLSKKFIPAD.GGIARIVWMPKELKEFLGEDFVQRSIDEGL.gADFIDKIADESVGTTAEEIIPFLEENGHPCFGL....DPL-m........................................
B1I318_DESAP/323-735             ........................rVPVPVAFGPAFEGETVRREDMHVEFGGQK.T..PGFELVRTA.G.PDT....VEDGRITLSGPDVD..A.VE....E.GG......ALP........LG..IVVDIY.G.RKM.EPD...FEP....VL..ERRLHHYLNYA...QGVW.H..I..GQ..R..DVNWVRISKEAYGRGFR.LRHLGVILYAKLKSEFASIVDRVQVRLSTEA.GEV......TAWR.GEAREYYARRDARLAV..LSDENVDTFYSCTLCQSFAPTHVCVVLPERVGLCGSVSWLDARAAHEIDPHGCNQPVPKKDVLDAAGGEWASCNEFIRTHSRGTIERVKFYTIMDSPLTSCGCFEALVCIVPECNGFLIVNREHA.GMTPAGMTFSTLAGSIGGGVQTPGFMGVGKAYLGSRKFLKAD.GGLARIVWMPAAFKEQMRPVLEKRAAEDGL.gADFVDRIADETVGVEVEEILAFLYEKEHPALSL....EPL-f........................................
E5EZM1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELDPNGPCSVVTKERCLDEVIGRYEDVDEAVSQLSHGALEHVTLYSLLT------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
H5SP24_9BACT/338-749             ........................kIPIPVPYGAGFEGERVRKENLYVEFGGKY.S..TAFELLRAR.P.MDE....VEDGKIELIGPDID..K.AK....E.GE......AMP........LG..VLIDVA.G.RNL.KPD...FEP....VL..ERRIHHFISCI...NGVM.H..I..GQ..R..DIPWVRISKEAYEKGFR.LKHYGEVLVAKFKEDFGALVDKVQVKIVTEQ.AQV......EALL.KEAREIYRQRDERVMG..MKDEDVDKFYSCILCQSYAPNHVCIVTPQRLGLCGAYTWLDCGASYEMDPHGPNKPVPKGVCLDPVLGEWQGVNEYVRVASNGNLERVSMYSIMQNPQTSCGCFECIVAVLPETNGVMVASREYQ.GETPIGMTFSTMAGEVGGGVQTPGFLGVGKLYLTSEKFISAE.GGIKRLVWMPSELKEEIKERLQKRLEEIGM..PELFDKIATEKDATTSEELLEFLQRVGHPALEM....EPI-v........................................
C0CHK4_9FIRM/295-708             ........................qIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCCELVQTK.E.MDE....IEDHKIELIGPDVD..A.FE....V.GS......KHS........LA..YVVEVA.G.RKM.QSD...FES....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMFRIRISKEAYEAGFR.AKHIGEVLYAQVMNEFEAVVDKCQVKIYTDP.AEC......TRIRhEVAVPTFNKRDARLDS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPNGPCQVITKERPIDENLGAYEDVNEAVQKYSQGALEKVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFIASKKFMKAE.GGIERIVWMPKELKETVADRLNKTAKELYG.iDNFTDIVGDETVATDPETLVAFLTEHNHPALSM....EPMM.........................................
H1L0V2_9EURY/2-409               ........................fDDIPVSVGPMNEGERVRGPDMHVELAGPK.S..YGFELVRV-.-.-GE....ASD-KVEIIGKDIS..E.VE....E.GT......RTP........FA..IIVRVG.G.DNL.EED...LEG....VL..ERRIHEFFNYI...EGVM.H..L..NQ..R..DSVWIRVNKSSASKGLT.LEHIGKVIQRLYKAEF-PFIKSVDVELITDP.DKV......KEEL.EKAREVYAKRDARARE..LSEEDVDVFYGCVMCQSFAPTHVCIITPDKPALCGGITYFDARAAAKIDPEGPIFEVPKGELLDGKLGIYSGVNEAVKEKSQGSIEEVALHSVMYKPSTSCGCFEAITFYIPEVDGFGVVHRDFK.GETPMGVPFSSLAGQCSGGKQVEGFCGMCIEYMRSPKFFQAD.GGWQRVVWLPKELKEKVKDAIP--------..EDLYDKIATEEDVSNTDELMKFLKEKNHPIVERw..aE---veeeeveeee...............................
C0CR68_9FIRM/296-709             ........................nIEIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVQTC.E.MSE....VEDHKITVIGPEAD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAYAAGFR.VRHIGEVLYSQVKNEFDAVVDKCEVVIYTDP.AEC......KRIRhEVAIPVFNKRDDRLAS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQEITKERVIDERIGEYEDVNEAVRKFSQGALEEVSLYSIMEKPMTSCGCFECICGIEPFSNGVCIANREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGVERIVWMPKELKETVAERLNATAKEIYG.iDNFTDMIGDETIATDPEELVTFLTEKGHPALGL....DPMM.........................................
D3RX82_FERPA/11-359              ...............idvkadclem-----------------------------.-..-----SELF.S.GER....VEGKEIRVV--ELV..E.VG....E.GD......GIEvlgelgdvMG..IHVLV-.-.SGI.SDD...AAS....AI..ESLFGEVINRM...KGVS.Y..S..FR..K..ERALIKISKEAEEK-FS.AECVAKVIYEAVKS-I-PAVKSVKVRIVCER.EEF......EKLK.KRAEEIHKKREERLRE..LKEISVDRFYGCKSCQVYLPNHVCVITPERPSPCGT-TYAEARNAEELKVVEYYFPIEKGEVISEKEGEYSGVNEAVKEMTEGKVERVKLHRVLENPPLAGNFAETIVFYIPEKDGFGIVDREYK.KKTPVGLTFEEMEKLIAG-WQVEGFAGVSFAYLKSPSFLKGE.GGWKRVVWVSPKVYEFVKSFLPKEL-----..---------------------------------....----leries...................................
E5EZN5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATNELDPNGPCQIVTKLHCTDERLGAYDDVNEAVSKYSHGALEKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
B1I1F4_DESAP/1-399               ........................m--FPVDVGPQYEGESVRKHDFYVEFGGPRcE..YKGELVTLR.S.VNE....VEHERVEVIGPDIK..D.MA....E.GT......TSP........LF..IGVEVA.G.EQL.EVD...MEP....VF..ERRIHQYCNYI...EGFW.H..M..AQ..R..DHIWLRLHKESHKKGLRsLQEVGQIIIMLFTNEL-PIIEKMQVTFITDP.EKV......KEHV.LKARPVYDARDERLKG..MTEEGVEEFYGCVLCQSFAPTHVCIITPERMSLCGAISWLDGRASSKIDPEGAIFAVPKGELLDPEKHIYSGVNEIVTQRSLGRIAVCCLHSALENPHTACGCFQSICFYIPEVDGFGIVHRDFV.GETVIGSPFSTLAAEVSGGQQREGYVGMAISYLKSPKFLITD.GGLRRVVWMPSAIKEWVKEAIP--------..ADLFDKIASEKEVKNVDELVEFLQEAEHPVMS-....----g........................................
ACDB1_METJA/295-698              ........................eFDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVKV-.-.VNK....AED-KVEIIGKDID..E.ME....E.GS......RNP........FA..IIVEVS.G.SNL.EED...LEG....VL..ERRIHEFLNYI...EGVM.H..L..NQ..R..DQVWIRINKNSFNKGLR.LKHIGEVVKQLFKEHF-PIVEKCNVIIITDP.DKV......KEEL.EKAKEIYKKRDEKTKS..IREEDVDVFYGCVMCQSFAPTHVCIITPDRPSLCGSINYLDARAAAKIDPNGPIFEIPKGECLDEKLGIYTGVNEVVRERSQGSVEEMALHSALTNPCTSCGCFEAIVFYIPEVDGFGVAHRNFR.GETPFGLPFSTLAGQCSGGKQVPGFVGISISYMKSPKFLQGD.GGWERVVWLPKELKERVKDAIP--------..EELYDKIATEEDVKTTDELIKFLKEKGHPIVKK....TEE-evvee....................................
ACDB2_METMA/2-413                .......................ad-EFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAA.D.MDA....IEDDKVTIIGPDLK..D.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EPD...LES....VV..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FEPFGKAVMMLFKTEL-PFIEKMQVTFYTDK.DEV......EKQM.ETAKEIFKARDARTKD..LHDEDVEVFYGCTLCQSFAPTNVCVVSPDRISLCGAINWFDGRAAAKVDPEGPQFEIAKGDLIDAVTGEYTGVNEIAKKLSSGEFDKIKLHSFFDCPHTSCGCFEVVGFYIPEVDGIGWVDREYQ.GMAPNGIGFSTMAGQTGGGKQIVGFLGIGVNYFYSPKFIQAD.GGWNRVVWLPSKLKEKIDEAIP--------..ADLKDKIATENDASDIESLKAFLQEKNHPVVATwaaaE---eeeeeeee.................................
E5EZL7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHELDPNGPCQIVKKDHVIDERVGRIEEVNEAVKKYSQGALEEVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZM4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATHELDPNGPCQIVTKLHCTDERLGAYDDVNGAVSKYSHGALEKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G3CWH0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELNPQGPCQPILKEGCIDERTGRYETVNQMVGEATHGAVENVTLYSILED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZN0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVKKEHVIDERVGRYEEVDEAVHKYSQGALEHVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
C8W5H1_DESAS/320-731             ........................dIDVPIMVGPAFEGESLRKKDMFVEFGGQR.T..PGFELVRM-.A.GDD....IEDGTIELIGPDID..G.LE....P.GT......QLP........IG..IVVDVY.G.RKM.QED...FEP....VL..ERRVHYFTNYG...EGLW.H..V..AQ..R..DLMWVRISKDAYAKGFR.MRHIGDILYAKFKSEFSAIVDRIKITLITDE.AKV......LEMR.DVARGYYAKRDARLKE..LTDEGVDTFYSCLLCQTFAPTHVCVVAPERVGLCGAVSWLDGKAAYEINPHGANQPIPKGAVIDPVKGQWESFNEYTFSNSQRSVEKVNFYTIMEYPMTSCGCFEAIMAMVPECNGFMVVPREHS.GMTPSGMTFSTLAGMMGGGAQMPGFMGIGKSYLLSKKFVPAD.GGMARLVWMPKALKDLLREGLTERAIEEGL.gEDFVDKIADETIGSSGEEILPFLEEKGHPALTM....DS--lf.......................................
G3CWP0_9BACT/1-51                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------------YQLKPTGPNQPIPKEGCTNEKTGAYESVNEAIGEATHGAVNQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
D8F946_9DELT/325-736             ........................eIKIPLAYGPAFEGERVRKDDLYLEMGGSK.T..QCTELCKMA.E.MNQ....IEDGKVEVVGPDVG..D.VK....K.GD......KLP........LG..IFVQVA.G.REM.QPD...FEP....IL..ERQIHHLINYA...QYIM.H..I..GQ..R..DISWVRVSEQAVEKGFT.IKDIGVILHAKLHQDFGAILDKVQVTLYTKE.KDV......DKLT.ETARAEYKARDNRVEN..MTDETTDIFYSCTLCQSFAPSHVCVVSPERTGLCGAYNWMDCKASYEINPTGPNQPVEKGEVIDAKLGQFKGVNEFVFKASRQAIDHYNFYSIVHDPMTTCGCCEAIAAVLPGCNGVMTVHRDYT.GETPCGMKFTTLAGVMGGGQSSPGFVGHGKYNLTQRKFIAGD.GGLLRIVWMPKSLKEELRERLLSRGEELGV..PDLIDRIADETVGTDEESVMAHLKEKDHPALKM....DPI-v........................................
Q6LYK8_METMP/2-409               .......................fg-DIPVEISPMYEGERIRAANMFVELAGPK.S..VGAELVLV-.-.SDD....VEDGKIEVIGPELK..D.ME....E.GK......KYP........FG..ILMEVS.G.EKL.EKD...LEG....VI..ERRIHEICNYV...QGFM.H..L..NQ..R..DKIWCRIGKDSHAKGFE.LKHLGQALSTLFKDEF-PIIEAISITIFTEE.EKV......KEFV.EKAVSEYQARDSKARD..LSEEDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEIPKGDLLDPVSGEYTTLNATVADKSQSTFDKVYLHSIFGHPHTSCGCFEAVAFYIPEVDGIGIVHRDFK.GDTPMGIPFSAMAGQCSGGKQVEGFAGLCVEYMRSPKFLQAD.GGYERIVWLPKEIKEKVLESIP--------..EELRDKIATEEDVSSIHNLKKFLNEKDHPVLKR....----iaeldapfeeq..............................
Q3ZX45_DEHSC/322-733             ........................kVPVPVAYGPAYEGERVRGEQIYLECGGGR.T..QMVELVTTA.K.MDD....VTDGKIELFGQDVS..D.MP....E.GS......RLP........LA..IVVEAA.G.HKM.NED...YEP....IL..ERQIHHLLNYA...QGVM.H..I..GQ..R..DIAWLRIGKSAAAKGFS.LKHIGSILHAKLHQDFGGIVDKIQIKLYTTP.EKV......AEIS.RQSKKIYTKRDERIEG..MTDENTETFYSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNIGPNQPVNKGAVIDAKLGQWSGINQFVEKTSGGVVSHYNLYSIIYDPMTTCGCCECISAILPLCNGVMTVNREHT.GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAE.DSLLRLVWMPKSLKEEIRERFNARAAELGV..PDLLERIADESVGTTEEEILPFLEEKQHPALTL....EPL-i........................................
E1QGA5_DESB2/325-735             ........................kVDIPLSYGAAFEGERVRKDDLFVEFGGKK.-..QATELVEMA.E.MDE....IEDNKIVVIGKEMD..D.VK....K.GD......KLD........LG..IYVQVA.G.RKF.QPD...FEP....IL..ERQIHHLINYA...QGVM.H..I..GQ..R..DISWIRLGQPAVEKGFK.VRHIGQILHDMFHKEFGSILDKVQVTLYTDP.KDV......KAFT.EKARAMYKARDSRVEN..MTDENEEIFYSCTLCQSFAPSHVCVVSPERTGLCGAYNWMDCKASFEINPTGPNQPIEKGECLDPKLGMWKGCNDFVAKASRGKISQYNFYSIVYEPMTTCGCCECIAALLPGCNGVMTVHRDYT.GETPCGMKFTTLAGVMGGGQSSPGFVGHSKYNIIQRKYIAGD.GGIKRMVWMPKSLKEELREGLLRRGEEVGV..PDLIDKICDETIAIDEASVYEYLQKVGHPAVEM....DPI-v........................................
Q64CV0_9ARCH/39-455              ........................fTGISYDISPRQAGQRVRKHDMYCELGGPK.QrySSFFFIEVV.K.GED...kIEDGRVEVIGPEIE..E.I-....E.GQ......SLP........FG..FWIRYY.G.KEL.TED...YLD....LL..TRWTYFALEEG...EGWM.L..L..NT..R..DTIWLRLHKKNADK-HD.FEHLGQAMINLCKIQF-PLVEKADAKILIAT.EDLggsehtKGIIdNVCVPYWEQVDKRARA..FSDDDADTFYGCTICQTFAPSHVCAVAPDRPPYCGIITWIGAKVMCDLDPYGYIFEMPKGECVDPEGGEYTGINEKIYEKSNRTYKRVVMYSSITYPQTNCGCFEAAIFYIPDVDGLGLVDRRYG.GETPLGLTFSKLAGLISGGQQNHGYCGISSRTPRSRKFVRAD.GGWNRIVWIPKEYKQILTEFIP--------..AEMFDKIATEEDCIDPEGLKEFLERVHHPVVTL....----wkngetpdpl...............................
G7WBL8_DESOD/314-726             ........................eLPIPINFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVRMV.G.PED....IVDGQVTVIGPDID..T.VP....E.GS......RLP........LG..IKIDIY.G.RKM.QED...FEG....VF..ERRIHYFANYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHFGDLLIAKLKEEFPAIIDRVEVTIMLDQ.AAV......DEGI.IIARERYRARDDRMRS..LTDESVEDFYSCLLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASHEIAPNGPNQPIPKGPAIDELKGMWQSCNEYLYKASNNTLEEVNLYTLMDRPMTSCGCFEAIMAIIPEANGLMLTTREHS.GMTPCGMTFSTLAGTCGGGMQTPGFMGIGRTYLLSKKFIPAD.GGLARIVWMPKELKEFLREDFIQRSIDEGL.gADFIDKIADESIGTTAEEILPFLEENGHPCFGL....DPL-m........................................
E6XMU9_SHEP2/7-109               ......................kql-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..------------------------------------------------------------------------------------------------------------------------KKQFQ.GSIPAGMTVEELLASAAGGKKSKGLLGAIQNNTSNQFLLGALlGATAAYVLSNDEMREKIVRSAVKLYTDIAGgmEELKEQVADIQA---------------------....----emavqtgd.................................
C9RB70_AMMDK/323-735             ........................kVPVPVAYGPAFEGESVRKGDMHVEFGGQR.T..PAFELVRMR.E.AHE....VEDGKIEVIGPDVD..S.VP....E.GG......RLP........LG..IVVDVY.G.RKM.QED...FEP....VI..ERRFHYFINYA...QGVW.H..M..GQ..R..DIIWVRISKAAFKAGFR.VRHFGDILYAKIKSEFANVIDRVQVTIYTDE.EKV......LALR.EEARQAYARRDARLKE..LSDEAVDTFYSCTLCQTFAPTHVCIVLPERVGLCGAVSWLDAKAAYEINPHGCNQPVPKKGVIDEWKGQWESCNQFIYEHSRGTIERVNFYTIMEYPLTSCGCFEAIMVILPECNGFMIVNREYS.GMTPCGMTFSTLAGSVGGGVQTPGFMGIGKAYLASKKFVRAD.GGLARVVWMPKEFKEQMRPVLEERAEEEGL.gRDFVDKIADETVGVTTEEILPFLEEKGHPALTM....DPL-f........................................
E5EZM7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLNPEGPCQVVSKENPVDEEIGIWPDCDRAVNQYSHGALEHVTLYSILQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5E761_9FIRM/158-558             ........................nIDIPVAFASAFEGEIIRRGDMQVEFDGSR.X..DCAELVQSA.E.ATE....IEDHKITVIGPEAD..E.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QSD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFNAGFR.LKHIGEVLYASVKNEFDAVVDKCEVVIYTDP.AEC......KRIRhEVAIPTFNKRDDRLKS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELXPNGPCQVITKEKCIDERIGEYEDVNEAVRKFSQGALEEVSLYSIMEKPXTSCGCFECICGIEPFSNGVVITNREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKEFVAERLNQTAKELYG.iDNFTDMVGDETIATDPEELVAXL----------....----t........................................
A4YAC3_SHEPC/7-109               ......................kql-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..------------------------------------------------------------------------------------------------------------------------KKQFQ.GSIPAGMTVEELLASAAGGKKSKGLLGAIQNNTSNQFLLGALlGATAAYVLSNDEMREKIVRSAVKLYTDIAGgmEELKEQVADIQA---------------------....----emavqtgd.................................
B0A8V9_9FIRM/303-718             ........................eIPIPVGFAASFEGERIRKAEMAYEFGGNK.T..TAWELVKSY.D.LGE....VEDHKIEVIGPEIDpeA.AK....D.GV.....vRLP........LA..IIVQVA.G.RAM.QDD...FEP....VL..ERRFHYFMNYT...EGLM.H..V..GQ..R..DQAWVRISKDDVAKGFQ.LKHIGEVMYAMMKDEFDAVVDKCAITIITDE.KIV......EERK.HEAIERYNARDDRLEQ..LTDEAVDDFYSCNMCQAFAPAHVCIVTPERLGLCGAVSWLDAKATKELNPTGPCQPIAKGPCLDEKKGIWQSMSDAVNEISQGAVENVTLYSIMEDPMTSCGCFECICGIMPEANGLVIVNREYA.GTTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYTE.GGPERIVWMPKELKDAVGEKLNKTVKEMAG.iENFTDYICDETIAVDSEAVCAFLSEKGHPALEM....DF--im.......................................
E5EZM0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNQLNPTGPCQVVLKDDVIDEEIGIWPDVNRAVKEFSQGALESVTLYSIIQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5E777_9FIRM/158-431             ........................dIPVPITIGPAFEGETIRKKDAHVEFGGGR.S..TSFELVRMC.E.ADE....VEDGKIQVIGPEID..E.MP....E.GS......VFP........LG..VMVDVY.G.RKM.QED...FEG....VL..ERRIHYFVNYG...EGLW.H..V..AQ..R..NMMWVRIGKNAKELGFK.IKDIGEILIAKFKSDYPAIIDRVQVTLVTDK.DVI......EEKI.KLAIAKYSARDARLKG..LTDEAVETWYTCTLCQSFAPNHVCIVTPEHVGLCGAVSWLXAKASNEITPTGPNQPVTKGDCIDPVKGQWQNLNEFFYSGSNRTIEKVNFYTMMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
ACDB_METTH/2-409                 ........................fEDIPVDVSPMHEGERIRSANMFVELAGPK.S..IGAELVQV-.-.KDE....VEDGKVEVKGPEID..E.ME....Q.GQ......VYP........FA..INVEVA.G.SEL.EEE...LES....VI..ERRLHELCNYV...KGFM.H..L..NQ..R..DQIWCRVSTEAKDAGFR.LEHLGKALSVLFREEF-PIIESIAVTLMTDE.AAV......QEFL.ETAREKYETRDSRARE..LSDEDVDVFYGCLMCQSFAPTHVCIVTPDRTALCGAINWFDCRAAYKMDPDGPIFEIEKGEVLDPERGEYANVNAAVEENSQGTTDRVYLHSVFGYPHTSCGCFEAVAFYIPELDGIGIVNRDFR.GETPLGIPFSAMAGQCSGGKQVEGFSGLSLEYMRSPKFLQAD.GGYHRVIWMPRELKESVLEFIP--------..EDVRDKIATEEDATSIKDLRRFLRDNEHPVLER....A---aveetepeee...............................
F3QIZ7_9BURK/62-216              .................psfagmlc-----------------------------.-..---------.-.---....--------------..-.-E....D.AS......SNS........LG..LFLHFY.G.SKL.NDE...LFY....LV..LQNFRSML-RL...PGVM.V..K..GA..G..KDLWIRIGKKAQAQGIG.LKELAAVLSARIQEEF-PEIESVQACFLRGQ.GPI......YKQL.DQVSEVFYQNSEKLKA.kVWEDRGFNFKDCH----------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----vlghcgkcadkklcanv........................
B8FJV8_DESAA/325-735             ........................eIDIPLSYGPAFEGERVRKDDLYCQF-GAK.E..QCTELVKMA.E.MNE....IEDGKVTVVGPDIK..D.CE....E.GK......AYP........LA..IFVQVA.G.REF.QAD...FEP....IL..ERQIHHLTNYI...QGIM.H..I..GQ..R..DIAWVRVSKAAVEKGFS.LEHIGKVLHAKFHQDFTKIADKVEVTLYTKK.EDV......DKLT.ATARAEYKMRDERVEK..MTDESVETYYSCTLCQSFAPNHVCTVSPERTGLCGAYNWMDCKASFEINPTGPNQPIEKGECLDPVLGQWKGVNDFVYKASRGNVTHYNFYSMVYDPMTTCGCCEAIAAMLPMCNGIMTVNRDYM.GETPCGMKFTTLAGVMGGGASSPGFVGHSKYNVTQRKFIAGD.GGIKRLVWMPKIFKEEIKDRLIKRGEEIGI..PNFYDMIADETVGTTEEEVYEFLQKVGHPALEM....DPI-v........................................
E5E774_9FIRM/157-557             ........................kVDIPVSFASSFEGEIIRRGDMQVEFDGSR.M..DCCEPVQTR.E.LSE....VNDHEITIIGKDID..E.MP....V.GS......KNQ........IV..YVLEVA.G.KSM.QED...FEP....VF..ERKFHSYLNCV...EGMM.H..T..GQ..R..DMIRIRISKDTFNAGFR.LKDIGEVLYSQVKNEFDAVVDKCAVKIYADP.EEC......TRLRhEVAIPLFNKRDERLAT..MTDEKVGVYYSCIMCQAFSPSHVCIVTPERLGLCGAVSWFDAKATYELDPNGPCQVVTKEKPIDERIGEYEDVNEVVRKLSQGALEDVSLYSIMEKPMTSCGCFECICGIEPFSNGVCIANREYA.GQTPLGMTFSELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGVARIVWLPKDLKEQVAANLNKTAKELYG.iDNFTDMIADETITTDPEELVAWLT---------....----.........................................
E5E771_9FIRM/159-433             ........................qIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCCELVQTK.E.MDE....IEDHKIELIGPDVD..A.FE....V.GS......KHS........LA..YVVEVA.G.RKM.QSD...FES....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMFRIRISKEAYEAGFR.AKHIGEVLYAQVMNEFEAVVDKCQVKIYTDP.AEC......TRIRhEVAVPTFNKRDARLDS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPNGPCQVITKERPIDENLGAYEDVNEAVQKYSQGALEKVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A6VFR9_METM7/2-410               .......................fg-DIPVEISPMYEGERIRAANMFVELAGPK.S..VGAELVLV-.-.SDN....AEDGKVEVIGPELK..D.ME....E.GK......IYP........FG..LLMEVS.G.EKL.EKD...LEG....VI..ERRIHEICNYI...QGFM.H..L..NQ..R..DKIWCRVSKDSHAKGFE.LKHLGQALSILFKDEF-PIIEAISIKIFTEE.TKV......KEFV.EKAVSEYQKRDSKARD..LSEDDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEVPKGDLLDPVTGEYTTLNSTVADKSQGTFDKVYLHSIFGHPHTSCGCFEAVAFYIPEVDGIGIVHRDFK.GDTPMGIPFSAMAGQCSGGKQVEGFAGLCIEYMRSPKFLQAD.GGYERIVWLPKEIKEKVLESIP--------..EELRNKIATEEDVSSIHNLKKFLTEKDHPVLKR....----iaeleapveeqm.............................
E5EZP6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELNANGPSQPIPKEGCLDERTGRFASVNETVKNATHGAVEEVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A4FY29_METM5/2-409               .......................fg-DIPVEISPMYEGERIRAANMFIELAGPK.S..VGAELVLV-.-.SDN....AEDGKVEVIGPELK..D.ME....E.GK......IYP........FG..LLMEVS.G.EKL.EKD...LEG....VI..ERRIHEICNYV...QGFM.H..L..NQ..R..DKIWCRVSKDSHSKGFE.LKHLGQALSILFKDEF-PIIEAISITIFTEE.EKV......NEFV.EKAVLEYQTRDSKARD..LSEDDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEVPKGDLLDPVTGEYTTLNSTVADKSQGTFDKVYLHSIFGHPHTSCGCFEAVAFYIPELDGIGIVHRDFK.EDTPMGIPFSAMAGQCSGGKQVEGFAGLCIEYMRSPKFLQAD.GGYERIVWLPKEIKEKVLESIP--------..EELRDKIATEKDVSSIHNLKKFLNEKNHPVLKR....----iaeleapveeq..............................
A6UNZ6_METVS/2-410               .......................fg-DIPVEISPMYEGERIRAANMFVELGGPK.S..IGAELVLV-.-.SES....VEDGKITVVGPEIK..D.ME....E.GK......IYP........LG..ILLEVS.G.KQL.EKD...LEG....VI..ERRIHEICNYV...QGFM.H..L..NQ..R..DKIWCRVSKDSHKKGFG.LNHLGKAISIMFKDEF-PIIEEIAVTIMTEE.EKV......KEFV.EKAKLEYEKRDSKARD..LSEEDVDSFYGCVMCQSFAPTHVCVITPDRPALCGGINWFDCRAAAKIDPEGPIFEIPKGELLDSVTGEYTSLNNTVAENSQHTFNKVYLHSIFGHPHTSCGCFEAVAFYMPELDGIGVVHRDFK.GDTPLGIPFSAMAGQCSGGKQVEGFSGLCVEYMRSPKFLKAD.GGYERIVWLPKEIKEKILENIP--------..KELHEKIATEEDVSSIHHLKKFLSEKNHPVIKR....----iselestekepe.............................
D5VTH8_METIM/280-689             .......................ef-KIPVSVGPMNEGERIRKPDMYVELAGPK.S..FGFELVKV-.-.VDN....AED-KVEVIGKELD..E.MK....E.GE......RYP........FA..IIVKVS.G.DNL.EEE...LEG....VL..ERRIHEFFNYI...EGVM.H..L..NQ..R..DQIWIRIGKESFKKGLR.LKHIGEVVKQLFKEEF-PFIKSCEVTIITDP.EKI......KEEL.EKAKEIYKKRDERTRA..LKEEDVDVFYGCIMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKGECLDETLGVYSGVNEVVSERSQGSVESFCLHSALNNPCTSCGCFEAVVFYIPEVDGFGVVHRNFK.GETPLGLPFSSIAGQCSGGKQVPGFVGVSIGYMMSPKFLQGD.GGWKRVVWLPKELKERVKEAIP--------..EELYDKIATEEDVSSVDELIKFLKEKGHPIVES....----lgkeeveevkeeke...........................
D3SIF7_DEHSG/322-733             ........................kVPVPVAYGPAYEGERVRGEQIYLECGGGR.T..QMVELVTTA.K.MDD....VTDGKIELFGQDVS..D.MP....E.GS......RLP........LA..IVVEAA.G.HKM.NED...YEP....IL..ERQIHHLLNYA...QGVM.H..I..GQ..R..DIAWLRIGKSAAAKGFS.LKHIGSILHAKLHQDFGGIVDKIQIKLYTTP.EKV......AEIS.RQSKKIYTKRDERIEG..MTDENTETFYSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNIGPNQPVNKGAVIDAKLGQWSGINQFVEKTSGGVVSHYNLYSIIYDPMTTCGCCECISAILPLCNGVMTVNREHT.GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAE.DSLLRLVWMPKSLKEEIRERFNARAAELGV..PDLLERIADESVGTTEEEILPFLEEKQHPALTL....EPL-i........................................
E5EZT2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPQGPCQIITKERVIDERIGEYEDVNEAVRKFSQGALEDVSLYSIIE------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
Q3Z8K8_DEHE1/322-733             ........................kVPVPVAYGPAYEGERVRGEQIYLECGGGR.T..QMVELVTTA.G.MDD....VTDGKIELFGQDIA..N.VP....E.GS......RLP........LA..IVVEAA.G.HKM.NED...YEP....IL..ERQIHHLLNYA...QGVM.H..I..GQ..R..DIAWLRVSKGAAAKGFS.LKHIGSILHAKLHQDFGGIVDKIQIKLYTTP.EKV......AEIS.GQSKKIYAKRDERIEG..MTDENTETFYSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNLGPNQPVNKGAVIDAKLGQWSGINQFVEKTSGGVVSHYNLYSIIHDPMTTCGCCECIAAILPLCNGVMTVNREYA.GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAE.DGLLRLVWMPKSLKDEIRERFNARAAELGI..PDLLERIADESVGTTEEEILPFLEAKQHPALTL....EPL-i........................................
H1ICH5_9FIRM/314-726             ........................eIPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVSMV.G.PDE....VVDGQVTVIGPEID..T.VP....E.GS......KLP........LG..IKVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGIW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQVTIFTDQ.QAV......EENI.VKARERYRARDARLKS..LTDENVEEFYSCLLCQSFAPNHVCIVTPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGPAIDDFRGMWQSVNDYLRPASNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRTYLTSKKFIPAD.GGVARIVWMPKELKEFLREDFVARSIEEGL.gEDFIDKIADESVGTTVEEIIPFLEENGHPCFNL....DSL-m........................................
F4C0K6_METCG/1-408               ........................mADIKLDISPMYEGERIRKDDLWVELGGPK.A..DGFELSLAT.P.MDE....IEDGKVTVIGPDLG..E.TP....E.GT......TMP........FG..MIFRVG.G.EKI.EKD...LES....II..ERRNHALLSYI...SGLM.H..L..NQ..R..YDIWMRIGKGLKKKGVTsWKEVYAPVIDLYKAEM-PFIEKMDITIVTDP.AKV......KEEL.AKAMAVYKTRDERAKG..LHDEDVDVFYGCTLCQAFAPTSACVVTPDRPSLCGAITWFDGRAAAKVDPEGPQFAIEKGSAMDEVSGEYEAINQMAEQRSGGEYSRMLLYTFFDAPHTSCGCFETIGFYMPEVDGIGLADRDFK.GATPNGLPFSTMAGQTGGGKQVVGFLGMGILYYFSPKFLQAD.GGWRRIVWMSKGLKERVKEGID--------..ADMMDKIATEDDAKDIAALKAFLLKVNHPVVD-....----gvtrkvdnk................................
F7UWA6_EEGSY/37-229              .......................le-ELPIPVGPHVGRGIVLRANTAVELGGTT.N..DSCALVLAT.S.DTS...lVRDGYVSLFGPDIA..Q.LR....S.SDsaetavHTP........FA..QIIFVA.G.ENL.APD...DFS....AL..E-QCQRAKDYI...DGYL.V..R..SF..T..GQVHSRVSRQLADRGFT.LAMLASALSHIVKQAC-PAAQSVEVAFATEP.DRV......QRCI.PV--------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----rdawiasshdlrkarwlekgidid.................
F4LVQ2_TEPAE/294-707             ........................eIPIPVGFAPAFEGERVRKDDMFAEFGGGR.T..TAWELVRKR.D.LSE....VEDHKIELIGPDID..T.LG...pD.GG......KLP........LA..IIVDVA.G.KNM.QED...FEP....VM..ERRIHYFTNYT...EGVM.H..I..GQ..R..DIAWIRISKSAYEAGFR.LKHIGEVLYAKMLDEFGSIADRVQVTIITDK.EKV......EELLeEVARPRYEARDARLAG..LTDESVDTFYSCLLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATYELDSTGPCQPIVKGECEDEVKGSWESINKRVAEQSHGATTKVNIYTIMEDPMTSCGCFECICGIMPEANGVIIVNREYH.GMTPLGMTFGELASTTGGGVQTPGFMGHGRQFITSKKFLYAD.GGLARVVWMPKELKEALKEKLIERGKEIGI..ENFYDMIADEEVGVEPDAVVEFLTKVGHPALSM....DPM-f........................................
G3CWI7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATKELDPAGPCQPIPKEGCLDEKLGRYTTVDEAVNKYSHGALEHVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
G3CWQ1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPTGPCQIVTKEHPINENLGAYEDVNEAVREYSHGALEQVTLYSILED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
F6CI77_DESK7/321-733             ........................eIDAPITVGPAFEGESIRKKDMYVEFGGTR.T..PSFELVRMA.G.PDE....VEDGKVEVIGPDID..T.VQ....P.GS......AMP........LG..IIVDVY.G.RKM.QED...FEP....VL..ERRIHYFTNYG...EGLW.H..V..AQ..R..DIMWVRISNGAFAKGFR.LKHLGNILYAKFKSEFAAVVDRVQVTIYTDE.QKV......LEMR.ELARQYYKKRDDRLKE..LKDETVDTFYSCTLCQSFAPTHVCIVPPERTGLCGAVSWLDAKASYEINPHGPNQPIKLEGLIDPVKGQWKSVNEFVHANSQRTIEAVNFYTIMEYPMTSCGCFECILAMVPECNGFMVVNREHG.GMTPSGMTFSTMAGTIGGGAQMPGFMGISKSYLASRKFVPAD.GGLARVVWMPKALKDQLRPQLEEAAEAAGL.gRDFVDKIADETVGTSGEEILPFLEEKGHPALSL....P---pll......................................
F8C3P7_THESO/345-762             ........................kLNIPVSYAPAFEGERVRKEDLYLECGGGR.T..SALELLISS.S.FEE....VKDGEIRVIGPEIS..D.LPkidkK.GPp....yRLP........LA..IVIKVA.G.TNM.QED...FEP....IM..ERQIHYFINYA...QGIM.H..I..GQ..R..NIVWIRISKQAVEKGFL.LKHIGEILYNRIKQEFSSIVDKCEVEIFTDE.EMV......KKLI.EKAKSIYEKRDARLAG..MVDENVEEFYSCTLCQSFAPTHVCVITPERGGPCGAYSWLDGKAYYQINPAGPNQPILKGEIIDLKLGQFKGVNEFVKKASKGKVERVSLYSIMNDPMTVCGCMEAIAAISAPVNGIIIVNREFD.KETPIGLKFSTLAGMIGGGQVTPGFLGISKQYIISKKFISAE.DGFLRIVWMPKILKEELKEKLQKRAEELGV..PDFLEKIADESVVNTEEELFNWVKKVNHPVLKL....P---plt......................................
ACDB1_METMA/1-412                ........................mAEFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAA.D.MDA....IEDDKVTIIGPDLK..D.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EPD...LES....VV..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FEPFGKAVMMLFKTEL-PFIEKMQVTFYTDK.DEV......EKQM.ETAKEIFKARDARTKD..LHDEDVEVFYGCTLCQSFAPTNVCVVSPDRISLCGAINWFDGRAAAKVDPEGPQFEIAKGDLLDAVTGEYTGVNEIAKKLSSGEFDKIKLHSFFDSPHTSCGCFEVVGFYIPEVDGIGWVDREYQ.GMAPNGIGFSTMAGQTGGGKQIVGFLGIGVNYFYSPKFIQAD.GGWNRVVWLPSKLKEKIDEAIP--------..ADLKDKIATENDASDIESLKAFLQEKNHPVVATwaaaE---eeeeeeee.................................
F6BF47_METIK/285-688             ........................eFDIPVSVGPMNEGERVRGPDMHVELAGPK.S..YGCELVLV-.-.KDD....VEE-GIEVIGKELD..E.ME....E.GS......RNP........FA..IVVEVS.G.KGL.EKD...IEG....VL..ERRIHEFLNYI...EGVM.H..L..NQ..R..DQVWIRINKNSFNKGLR.LKHIAEVVKALFKEHF-PIIEKCKVKIITDE.EKV......KEIL.EEARKIYAERDARARE..LSEEDVDVFYGCVMCQSFAPTHVCIITPDRPSLCGSISYFDARAAAKIDPEGPIFEVPKGELLDEKLGIYSGVNEVVESRSQGSVKEIAMHSALTSPCTSCGCFEAIAFYIPEVDGFGVVDRNFK.GETPFGLPFSSLAGQCSGGKQVPGFVGIAIEYMRSPKFLQGD.GGWQRVVWLPKDLKEKVKDAIP--------..EDLYDKIATEEDVSNTEELAKFLEEKGHPVMKK....AE--eteeek...................................
F7XLS4_METZD/16-428              ........................tEEFPFEISPMFEGERVRKDDMYVELAGPK.S..KGFELVRAV.P.PDEsinpVEDGKFTLIGPDIS..E.ME....E.GG......RYP........LA..MIYRIS.G.ELV.EPD...IES....IV..ERRNHDFQNYL...QGVM.H..L..NQ..R..YDIWLRVSKEAVNKGLDsFEHIARATMMLFKSEL-PFIEDIEAIYITDM.GEV......EKEL.EDAFKVYEARDERTRD..LHDEDVDVFYGCTLCQSFAPTNVCVITPDRVSLCGAINWFDGRAAAKVDPEGPQFAIEKGEAIDDFSGEYTGVNERAKSLSSGEYDRIKLHSFFEYPHTSCGCFEVVGFYIPEVDGIGWIDRDYS.GNAPNGLPFSTMAGQTGGGKQVVGFLGIGINYFRSPKFIQAD.GGWDRVVWMPKHLKDKVYDSIP--------..EEIADKVATEEDASDIQSLEAFLKGQDHPITER....----wveeseeea................................
H1L0V7_9EURY/285-689             ........................eFDIPVSVGPMNEGERVRGPDMQVELAGPK.S..YGCELVVV-.-.KDD....VEDG-IEVIGKELD..E.ID....E.GS......RNP........FA..IVVEVN.G.KGL.EKD...IEG....VL..ERRVHEFLNYI...EGVM.H..L..NQ..R..DQVWVRINKNSFNKGLR.LKHIAEVVKALFKEHF-PIIEKCKVKIITDE.EKV......KEIL.EEARKIYADRDARARE..LSEEDVDVFYGCVMCQSFAPTHVCIITPDRPSLCGSISYFDARAAAKIDPEGPIFEVPKGELLDEKLGIYSGVNEVVESRSQGSVKEVAMHSALTSPCTSCGCFEAIAFYIPEVDGFGVVDRNFK.GETPFGLPFSSLAGQCSGGKQVPGFVGIAIEYMRSPKFLQGD.GGWQRVVWLPKELKEKVKDAIP--------..EDLYDKIATEEDVSNTEELAKFLEEKGHPVMKK...vE---eteeeki..................................
G6I3Q9_9FIRM/320-731             ........................dIDVPITVGPAFEGESIRKKDMYVEFGGSK.T..PSFELVRM-.G.DDT....IEDGKIELIGPDCD..T.AA....E.GG......RMP........IG..IVVDVY.G.RKM.QED...FEP....VL..ERRIHYFSNYG...EGLW.H..V..AQ..R..DINWMRISKDAYAKGFR.IKHIGEILYAKFKSEFSAIVDRIAVTIYTDE.QKV......LEMR.EVAREYYKKRDDRLKE..LRDEKVDTFYSCTLCQSFAPTHVCVIAPERVGLCGAVSWLDAKAAYEINPHGANQPVPKEGVIDEVKGQWKSFNEFTFNNSQRTIEAVNFYTIMEYPMTSCGCFECILAMVPECNGFMVVNREHG.GMTPSGMTFSTLAGTIGGGAQMPGFMGMGKSYLASPKFVPAD.GGLGRMVWMPKALKEELRAALEEAAENAGL.gKDFVDKIADETVGTSGEEIMSFLEEKGHPALTM....DPLM.........................................
D4J1C9_BUTFI/26-218              ............vnadwedvgdhnl---------------ILRADMAYELGGGT.F..PAVSGMAVT.C.NDE...fVNTDEVLLIGPDLD..E.IK....A.DA......PYA........RI..AIVKVA.E.DSL.GDGntlYNA....IR..KIEYVRYHINP...EGYM.T..RvsAS..N..NREPVRVGKAALDKGLN.FAKVGKLFLDTYHENR--NIEAVKLIFITAP.D--......----.----------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----fdykslsdqakhleditgtidhifknvmmdcgscsl.....
Q46G06_METBF/1-411               ........................mAEFPFEISPMFEGERVRKDGMFVELGGPK.S..MGLELVRAK.D.LDE....IEDDKVTIVGPDLK..E.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EAD...LES....VV..ERRVHDFVNYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FDSFGKAVMMLFKTEL-PFIEKMQVTFYTDE.AEV......EKQL.EEAKEIFKIRDARTKD..LHDEDVDVFYGCTLCQAFAPTNVCVVSPDRISLCGAINWFDGRAAAKVDPEGPQFAIEKGELINADTGEYSGVNEIAKKLSSGEYDKINLHSFFEYPHTSCGCFEVVGFYIPEVDGIGWVNREYQ.GMAPNGLGFSTMAGQTGGGKQVVGFLGIGVNYFYSPKFIQSD.GGWNRVVWLPAMLKEKIAETIP--------..EDIKDKIATENDATDIESLKAFLQEKNHPVVANw.asE---eeeeeeee.................................
H6LKY7_ACEWD/294-711             ........................kIDVPVAVASAFEGERVRKDAMFAEFGGNK.T..ECWELVTSG.D.PAE....MEDHKITLIGPDID..DpMF....A.GKd...vvRLP........LG..IVVTVG.G.KAM.QKD...FET....VL..ERRIHYFTNYI...DGAM.H..V..GQ..R..NIAWIRLTKEAFEKGFR.LKHIGEVLYAKMRSDFEKVVDKCEITIYTNA.EDV......KRLGeELVKPIYAERDERMGA..LTDESVDTFYTCLLCQSFAPSHVCIVTPERLGLCGAVSWLDAKATKELDPEGPNQPVIKGQAIDAQTGRWEAVDKAVASASQGAVEKVTLYSILEDPMTSCGCFECICGIMPEANGVIIVNREFS.DISPVGMTFGELASMTGGGVQTPGFMGHGRFLIGSKKFMSAE.GGLSRIVWMPKELKDDVAERLNKAVFEMTG.iENFADMVCDETIATDSEAVLEFLESKNHPALAM....DPIM.........................................
A5ZYD8_9FIRM/295-708             ........................dIDIPVAFASAFEGEIIRRKDMQVEFDGSR.V..DCAELVQTK.N.MDE....VEDHKITVVGPEVD..T.FE....E.GS......KHS........LA..YVVEVA.G.KKM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMFRIRISKDAFNAGFR.AKHFGEVLYAQVKNEFEAVVDKCAVTIYTDP.AEC......TRIRhEVAIPTFDRRDERLDT..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHELDPNGPCQVITKERPIDENLGSYEDVDEAVQKFSQGALEHVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFISSKKFMKAE.GGIERIVWMPKELKDTVAERLNKTAQELYG.iENFTDMIGDETVATDPEALVEFLTEKGHPALSM....DPMM.........................................
E5E778_9FIRM/1-125               .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..--------------------NHVCIVSPERVGLCGAVSWLDAKASNEITPTGPNQPIAKGECLDEEKGMWHNLNDFLHTASNRTLEEVNLYTLMDKPMTSCGCFEAIMAILPLTNGVMITTREHA.GDTPCGMTFSTLAGTCGGG-----------------------.------------------------------..---------------------------------....----v........................................
G9XMF9_DESHA/314-726             ........................eIPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVSMV.G.PDE....VVDGQVTVIGPEID..T.VP....E.GS......RLP........LG..IKVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQVTIYTDQ.QAV......EENL.VKARERYRARDARLKS..LTDENVEEFYSCLLCQSFAPNHVCIVSPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGLAIDEVKGMWQSVNDYLRPSSNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRSYIISRKFIPAD.GGISRIVWMPKELKEFLKEDLVARSIDEGL.gEDFIDKIADESVGTTVEEIIPFLEENGHPCFSL....DPLM.........................................
Q1PYY9_9BACT/316-727             ........................kVDIPVAYGPAFEGERIRKDDMQIEIGGPG.V..PAFEFVCTK.E.ADE....VEDGKIQVIGPDLD..D.MP....Q.GP......GVS........IG..IVAEVT.G.RKM.QPD...FEP....IF..ERQMHRFLGEA...QGIF.H..M..GQ..R..DIIRHRISKDAFKAGLR.LKHIGKIIHAKFHGEFGAIIDKVQVTLYTKK.EDV......EGKL.KEVRAAFAERDARLGD..MTDDSVNLFYSCTLCQSFAPSHVCIVTPERSGLCGSVSWLDGKAGYEINPTGPNQPIEKRKVIDDRLGQWDGTNEFLYSSSNRALEKVSLYSIMTDPMTSCGCFECISAMLPMANGIMVVDRDFT.EMTPSGMKFSTMAGTVGGGLQTPGFMGHSKFYLGSKKFISAD.GGLARVVWMPKALKEELSEQLEKASKEMDL..ENFLDKIADETVAQTEEEVVEYMQKINHPALSM....DPM-f........................................
D8WWT8_9FIRM/320-732             ........................eIDIPINHGPAFEGETVRKADMFVEFGGQR.T..PAFELVEM-.V.GDD....IEDGKITLIGPDID..S.LP...pE.GG......RLP........LG..MHLKIY.G.RKM.QSD...FEP....VL..ERRVHYFTNYG...EGLW.H..T..AQ..R..DICWLRFTKEAVAKGLK.MEHLGRLLYAKFKSEFPAIVDRVEIELITDE.AEC......LKRR.EYAREKYNSRDARLRE..LTDEGVEEFYSCTLCQSFAPTHVCVVAPERVGLCGAVSWLDAKAAYEINPLGANVPILKGECLDEVKGQWKSFNEFIYNGSQRNVETVNFYTLMDAPMTSCGCFEVIMTMVPEANGVMVVNREHS.GMTPCGMNFSTLAGSCGGGAQMPGFMGMGKAYFGSRKFIKAD.GGLARLVWMPKSLKEALRSILEERAEEEGL.gKDFVDKIADETVGTAGDEILPFLEEKGHPALTM....DSM-f........................................
C4Z342_EUBE2/27-223              ...............rvwemtdken--------------LILKSEMVYELGGGS.N..AAVSAIAFT.Q.DEE...lVPEDAVYLVGDDLC..D.IK....N.DI......SYA........RI..TVIRLD.G.EYI.KNH...DDN....ALyaSMRATDYVRYHafpKGYM.M.rI.sAV..R..EREPVRVSKEAVSHGIN.FAAVGQGLINAYRKRP--EVEAVSIYFVTEQ.D-I......D---.----------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----yiflkseahrceqitdslnnifngltmdcstcssrelc...
G3CWN5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYQLDPSGPSQPIVKGEAIDARVGSWESVNEAVHKYSQGALEKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A0B5W3_METTP/2-410               ........................aEEIQLDISPMYEGERIRKDDLWVEMGGPK.A..DGFELTLAA.S.MDE....VEDGKVTIIGPDLK..D.VK....E.GS......TIP........FG..MIFKVA.G.EKI.EKD...LES....II..ERRNHALLSYI...SGLM.H..L..NQ..R..YDIWMRLGKSLQKKGVTsWEQIFKPVINLYKAEM-PFIEKMEVTIVTDP.AKV......KEEL.EKAMQVYRARDERAKG..LHDEDVDVFYGCTLCQAFAPTSACVVTPDRPSLCGAITWFDGRAAAKVDPEGPQFPIPKEGLKDPITGEYESINQMAAKRSGGEYTVMKLYTFFDAPHTSCGCFETIGFYMPEVDGIGICDREYK.GNAPNGLPFSTMAGQTGGGKQVVGFLGMGVLYYFSPKFLQAD.GGWRRIVWMSKRLKERVKEGIP--------..AEMYDKIATEDDATDLESLKRFLLKVDHPVVT-....----gvvrpvdnkk...............................
C0GF47_9FIRM/314-726             ........................eIPVPITIGPAFEGETIRKGDMFVEMGGGR.T..TAFELVSMV.G.EDE....IEDGKITVTGPDFD..E.IE....E.GA......KLP........LG..IKVKIY.G.RKM.QED...FES....VL..ERRIHYFINYG...EGLW.H..V..AQ..R..DLCWLRVSKDAVAKGFR.VKDYGEILIAKFKDEFPAIVDRVEVELFTDA.DAV......EEQI.KEARERYAVRDARLRG..LTDEAVDELYSCILCQSFAPNHVCVVSPERVGLCGAVSWLDAKASYEIDPNGPNRPIAKEGVLDEEKGMWESVNEYVYTTSNRSVEEVNLYTLMDRPMTSCGCFEAILAIVPEANGLMVTTREHS.GDTPSGMTFSSLAGSVGGGVQAPGFMGIGRSYMLSRKFLKAD.GGLGRIVWMPKELKDFLGDDLRERAEEDGL.gADFVDKIADETVGTTAEEILPFLEEKGHPALTM....DPLM.........................................
D5EBX2_METMS/2-410               ........................aEDFPFEISPMFEGERIRKNDMYVELSGPK.S..IGFELVKAA.E.MDD....VVDGKFNMIGPDVQ..D.ME....E.GG......RYP........FA..MIYKIA.G.ELV.EED...LES....IV..ERRNHDFQNYI...QGLM.H..L..NQ..R..YDVWVRLSKEAVEKGVTsFESIAQAIMMLFKNEL-PFIEKVEATYITDK.DEI......EKLM.DEAKAKYKARDDRTRN..LHDEDVDTFYGCTLCQSFAPSNVCVITPDRISLCGAINWFDGRAAAKVDPEGPQFAIPKGDVIDDESGEYTGVNETAKSLSSGEYDRIKLHSFFDYPHTSCGCFEVVGFYIPEVDGIGWVDRDFT.GAAPNGLPFSTMAGQTGGGKQISGFLGIGINYFRSPKFIQSD.GGWERVVWMPKHLKDRVADDIP--------..DDIADKIATEEDVSDLETLRNFLKEKKHPIVNRw..eK---eeeeea...................................
E5EZV7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELDPTGACQIVTKNKPTDIELGAYEDVNEAVYKYSRGALERVTLYSIMV------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
C6LCL0_9FIRM/305-718             ........................hIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCFELVQTK.D.ASE....VEDHKIEVIGPDID..E.MP....E.GS......KQS........IA..YVVEVA.G.KTM.QAD...FES....VF..ERKFHSYLNCV...EGMM.H..T..GQ..R..DMIRIRISKDTYNAGFR.LKHIGEVLYAKVKSEFAAVVDKCQVKICTDA.AEC......TKLRhELATPVYDKRDERLTT..LTDEGVDVYYSCIMCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPQGPCQVITKERPIDERIGEYEDVNEAVRKFSQGALEDVSLYSIIEKPMTSCGCFECICGIEPLSNGVCIANREYA.GMTPIGMTFSELASMTGGGVQTPGFMGHGKHFIASKKFMKAE.GGIERIVWMPKELKEQVKDRLNATAKELYG.iDNFTDMIGDETVAEDPETLLAFLEEKGHPALTM....EPMM.........................................
G7WQP3_METH6/1-398               .........................------MSPMYEGERIRKDEIWVEMGGPK.A..KAFELSVAG.T.MDE....IQDGKVTVIGPDIS..E.LE....V.GK......TID........FG..MIFKVA.G.ELI.EKD...LES....II..ERRNHALLSYI...HGWM.H..L..NQ..R..DAIWMRAGLDLKKAGVTsFEQIFKNVMTLYKAEM-PFIEKMEVTILTDP.AAV......AKGL.EQAHTAYHARDERAKG..LHDEEVDVFYGCTLCQAFAPTSACCVTPDRPSLCGAITWFDGRAAAKVDPEGPQFAIPKTGVIDEIAGEYESVNEMAGSRSGGEYSRMALYTFFDAPHTSCGCFETIGFYMPEVDGIGVVDRDFR.NPTPNGLPFSTMAGQAGGGKQVVGFLGMGILYYFSPKFLQAD.GGWRRIVWMPKQLKERVKDGID--------..PEMYPKIATEEDAPDLAALKAFLLKVDHPVVD-....----gverkv...................................
E5EZR8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELSPTGPSQPIPKEGLIDEKLGAYESVNKMVANATHGAVEKVTLYSLVQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5EZM2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLNLEGPCQVVSKENPVDEEIGIWPDCDRAVNQYSHGALGHVTLYSILQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
Q2FQF9_METHJ/2-412               ........................fEDIPVEVGLVHEGERIRKEDMRVELGGPKvS..EKFELVLVK.K.SDE....ITDGKISILGPDLA..D.LE....E.GK......SYP........FG..ILVEVT.G.EKL.EED...LEG....VF..ERRIHEYLNYI...QGVM.H..L..NQ..R..YDLWMRVGKKAFAKGLNsFHQIGSALISLYRSEL-PIIEKIQITFFTGG.EEF......QSTY.NLARERYETRDARARG..LLDEEVDTFYGCALCQSFAPSHICVITPQRYANCGAISWFDGRAAARMDPDGPIFPIAKGEYLDSEHGEYSGVNEHAIKRSMGAVNRVWLYSAFGYPHTSCGCFEAIAFYIPEIEGFGIVHRRFA.GPTVNGLAFSTLADSTAGGRQVEGFHGISLEYMRSVKFLQAD.GGWNAIVWMPAEIKEMLSGIIP--------..EDVAGAIATEQDALDINALKSFLTSHHHPVVSK....----wivpedteee...............................
B8FZT4_DESHD/44-241              ................gqgrktgss--------------IVLKNDVLVELGSPE.A.gSCSMTLYTN.S.PHQ....ITDGWITLMGSDIT..E.Y-....T.PK......KLP........FG..QVIMVG.G.EHLtEED...YYY....LL..Q--NLNVSEMI...EGYM.I..R..ST..A..ESIWCRISKDAAKNGFN.FHVLGSVLNWHIKQIL-PKVKAVEIVFVTTTkEDI......EEL-.NQISKEVGEIGRRIKEriWREKGVDI---------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----ykcvpgghcgacedktvc.......................
E5EZP0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELNANGPSQPIPKEGCIDERTGRFASVNETVKNATHGAVEEVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
F8AM34_METOI/4-411               ........................nIEIPVSVGPMNEGERVRGPDMQVELAGPK.S..YGFELVKV-.-.VDG....ASD-KIEVIGKDID..E.ME....E.GS......RTP........FA..VIINVS.G.DSL.EED...LEG....VL..ERRVHEIFNYI...EGVM.H..L..NQ..R..DSVWIRINKDAYNKGLR.LKHIGKVIQDIYKAEF-PFIKHVDVRLITEP.DVV......KEEL.EKAREIYNKRDEKTKN..LHEEDVDTFYGCIMCQSFAPTHVCVITPDKPALCGGINYFDARAAAKIDPEGPIFEIPKGNCLDEIKGIYDNVNEVVYEKSGGAIKEITLHSVMDRPSTSCGCFEAITFYIPEVDGFGIVDRSYK.GETPIGVPFSALAGQCSGGRQVEGFCGISVAYMKSPKFFQAD.GGWKRVVWLPRELKEKVKDGIL--------..EEMVDKIATEEDVSNIGELQEFLKNKNHPVVEN....----wgaveeeivmdk.............................
F8TEQ9_9CLOT/294-708             ........................eIPIPVSFAAAFEGERIRKNDMLAEFGGNK.T..KAWELVMCA.D.QGE....VEDHKIEVIGPDID..T.ID...kA.PG......RMP........LG..MLIKVS.G.TNM.QKD...FEP....VL..ERRLHYFLNYI...EGVM.H..V..GQ..R..NLTWVRIGKEAFEKGFR.LKHFGEVIYAKMLDEFGSVVDKCEVTIITDP.GKA......EELEgKYAVPRYKERDARLES..LVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFG.ATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGE.GGLGRIVWMPKELKDFVAEKLNKTAKELYN.iDNFADMICDETIATESEEVVKFLEEKGHPALKM....DPIM.........................................
G3CWN8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIPKEGCTNEKTGAYESVNKAIGEATHGAVNQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZM5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVKKDHVIDEKIGRYEEVDEAVHKYSQGALEHVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
DCMA_MOOTH/317-729               ........................kLDLPINFGPAFEGESIRKGDMYVEMGGNR.T..PAFELVRTV.S.ESE....ITDGKIEVIGPDID..Q.IP....E.GS......KLP........LG..ILVDIY.G.RKM.QAD...FEG....VL..ERRIHDFINYG...EGLW.H..T..GQ..R..NINWLRVSKDAVAKGFR.FKNYGEILVAKMKEEFPAIVDRVQVTIFTDE.AKV......KEYM.EVAREKYKERDDRMRG..LTDETVDTFYSCVLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASYEINHAGPNQPIPKEGEIDPIKGIWKSVNDYLYTASNRNLEQVCLYTLMENPMTSCGCFEAIMAILPECNGIMITTRDHA.GMTPSGMTFSTLAGMIGGGTQTPGFMGIGRTYIVSKKFISAD.GGIARIVWMPKSLKDFLHDEFVRRSVEEGL.gEDFIDKIADETIGTTVDEILPYLEEKGHPALTM....DPIM.........................................
#=GR DCMA_MOOTH/317-729    SS    ........................----SS-BSGGGTT----GGGEEEEEETTT.S..-EEEEEEE-.-.GGG....--TTEEEEES--GG..G.S-....T.TE......EE-........EE..EEEEEE.S.TT-.-GG...GHH....HH..HHHHHHHHHTB...TTEE.E..E..EE..T..TEEEEEEEHHHHHHT--.THHHHHHHHHHHHHHSBTTBSEEEEEEEESH.HHH......HHHH.HHHHHHHHHHHHHHHT..--TTT-SEEEEE-GGGGTSTT--EEEBTTB--TTSS--HHHHHHHHHHSTTSSEEEEES-SEEETTTTEEHHHHHHHHHHTTTS-S---TT-SSSS-----S--SEEEEEEGGGTEEEEEETT--.SB-TTSSBHHHHHHHHTTT--BTTEEEE-GGGGGSTTTTGGG.TGGGGEEE--HHHHHHHHHHHHHHHHHTTS.-TTHHHHSB-TTT-SSHHHHHHHHHHTT-GGGGS....STGG.........................................
F8AM35_METOI/210-615             ........................eIDIPVSVGPMNEGERVRGPDMQVELAGPK.S..YGCEIVLV-.-.-NE....NAKNGVEIIGNDID..G.IE....E.GS......RIP........FA..IVIEIS.G.KGL.ESD...IEG....VL..ERRVHEFLNYI...EGVM.H..L..NQ..R..DQVWIRINKDAYNKGLR.LRHIGEVLINLFKESF-PIIENCNVKLITEP.EKV......KEAI.EMAQSRYKERDARARA..LSEDDVDTFYGCVMCQSFAPTHVCIITPDRPSLCGSISYFDARAAAKIDPEGPIFEVPKGECLDEKLGIYDGVNKVVQEKSGGAVEEFALHSAMIKPCTSCGCFEAIVFYIPEVDGFGVVHRHFK.GETPYGLPFSAIAGQCSGGKQVEGFVGISVEYMRSPRFLKGD.GGWNKIVWLPEELKEKVKDAIP--------..KKLRDKIATEKDISNTEELKKYLMDKKHPVIEK....----leehdkiedk...............................
G3CWP6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATNELDPTGPCQVVTKEKPIDERIGEYEDVNEAVRKFSQGALEDVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
P83789_CARHY/320-732             ........................dIDLPINFGPAFEGESIRKGDMHVEFGGGK.T..PSFELVRMV.G.PDE....IEDGKVEVIGPDID..S.VE....P.GG......RLP........IG..IVVDIY.G.RKM.QED...FEP....VL..ERRIHYFTNYG...EGFW.H..T..AQ..R..DLTWVRISKEAFAKGAR.LKHLGQLLYAKFKQEFPSIVDRVQVTIYTDE.QKV......LELR.EIARKKYAERDARLRE..LSDEAVDTYYSCLLCQSFAPTHVCIVSPERVGLCGAISWLDAKAAYEINPNGPNQPIPKEGLIDPVKGQWESFNEYIYKNSQRTIERMNLYTIMEYPMTSCGCFEAIMAYLPELNGFMIVNREHS.GMTPIGMTFSTLAGMVGGGTQTPGFMGIGKSYIGSRKFVKAD.GGLARVVWMPKDLKEQLRSIIEERAEEEGL.gRDFIDKIADETVGTTVDEVLPFLEEKGHPALSM....EPL-l........................................
#=GR P83789_CARHY/320-732  SS    ........................----SS-BSGGGTT----TTTEEEEEETTT.S..---EEEEE-.-.STT....--TT-----S--SS..S.S-....T.TE......E--........--..EEEEEE.-.TT-.-GG...GHH....HH..HTHHHHHHTTB...TTEE.E..E..SS..S..TT-EEEEEHHHHHTT--.GGGHHHHHHHHHHHS-TTT--EEEEE----H.HHH......HHTT.TTTHHHHHHHHHHHHH..--STT-SEEEEE-GGGGT-TT--EEEBTTB--TTS---HHHHHHHHHH-TTSS--EEE--SEEETTTTEEHHHHHHHHHHTTT------TT-SSSS-----S--SEEEEEETTTTEEEEEETT--.S--TTS--HHHHHHHH-SS---TTEEEE-GGGGGSTTTTGGG.TGGGGEEE--HHHHHHTHHHHHHHHHHTTS.-TTGGGGSB-TTT-SSHHHHHHHHHHTT-GGGGS....-----........................................
E5EZV6_9BACT/1-53                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATKELDPNGPCQIVPKTGCTDERLGAYDSVNEAVSTYSHGALEKVTLYS---------------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
D5VUE1_METIM/1-407               ........................m-NIPVSVGPMNEGERIRKPDMYVELAGPK.S..FGFELVKV-.-.VDN....AED-KVEVIGKELD..E.MK....E.GE......RHP........FA..IIVKVS.G.DNL.EEE...LEG....VL..ERRIHEFFNYI...EGVM.H..L..NQ..R..DQIWIRIGKESFKKGLR.LKHIGEVVKQLFKEEF-PFIKSCEVTIITDP.EKI......KEEL.EKAKEIYKKRDERTRA..LKEEDVDVFYGCIMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKGECLDETLGVYSGVNEVVSERSQGSVESFCLHSALNNPCTSCGCFEAVVFYIPEVDGFGVVHRNFK.GETPLGLPFSSIAGQCSGGKQVPGFVGVSIGYMMSPKFLQGD.GGWKRVVWLPKELKERIKEAIP--------..EELYDKIATEEDVSSVDELIKFLKEKGHPIVES....----lgkeeveevkee.............................
E5E772_9FIRM/159-559             ........................nIDIPVAFASAFEGEIIRRKDMQVEFDGSR.V..DCAELVQTC.E.MTE....IEDHKITVVGPDVD..A.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISIDAFNAGFR.LKHIGEVLYAQVKNEFEAVVDKCEVVIYTDP.AEC......SKIRhEVAIPIFNKRDDRLAT..LTDESVSVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQEITKERPIDENLGAYEDVDEAVQKYSQGALEHVTLYSIMQDPMTSCGCFECICGIEPFSNGVVIANREYA.GMTPLGMTFPEMASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKEFVADRLNATAKELYG.iDNFTDMIGDESVAEDPETLVAFLT---------....----.........................................
E5EZS6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATKELDPNGPCQIVPKTGCTDERLGAYDSVNEAVSTYSHGALEKVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
A6TPS2_ALKMQ/294-708             ........................eIDIPVGFAAAFEGERVRKDNLYAEFGGSK.T..ECWELVRSK.E.LSE....IEDHKINVIGPNID..D.FE...gE.PK......RIP........LA..IIVEVA.G.KNM.QLD...FEP....VL..ERRIHYFMNYT...EGVM.H..V..GQ..R..DTTWIRISKDTYASGFR.LEHIGEVLYAKMMDEFSSVVDKCQVTIITDA.AKI......AEMKkTDAEAIYMARDERLAS..LTDESVDTFYSCLLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATKELDPAGPCQPIAKEGVEDEVKGIWSAVNEHVDEKSQGAVSRVTLYSLLEDPMTSCGCFECIAGIMPEANGVVIVNREFP.STTPVGMTFGELASMTGGGVQTPGFMGHGRYFISSKKFISAE.GGPGRIVWMPKELKDHVKDRLDQTAKEMYG.iDNFTDMICDETIATDSEEVLNFLTQKGHPALTM....EAL-m........................................
F5YMN8_TREPZ/302-714             ........................kVDIPVAFSTAFEGEIIRRADMHVDIDGSK.G..DCFEWVDTK.E.ANE....IEDHKIELFGPDLD..S.VA....E.GS......RWA........LG..IVVEVA.G.KNM.QKD...FEP....VF..ERRLHHYLNYA...EGVM.H..T..GQ..R..DLIRIRVSKASYAAGFR.AKHLGEILYAKLKGDFDAIIDKVQVKIYTKP.EDL......KRLK.ADVNKVYAVRDDRLKS..LTDENVEVFYNCILCQSFSPAHVCVVTPERLGLCGAVSWLDAKATNEIDPNGSCQIVTKERVVDEKLGIWEDVNEAVQTASHGSLQAVTLYSIMQDPMTSCGCFECICGIEPATNGVVIVNREHS.GMTPLGMSFSEMASMTGGGVQTPGFMGHGKQFISSKKFMAAE.GGPARIVWMPKALKEFVAAKLNATAKDLYG.iDNFVDRIADETVTEDAEKLVEYLTEKEHPVLQL....EPLM.........................................
E5EZM6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELDPSGPSQPIVKGEALDEKVGSWQSVNEAVNKYSQGALDKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
D5Q0W1_CLODI/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
E5E779_MOOTH/1-125               .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..--------------------NHVCIVTPERVGLCGAVSWLDAKASYEINHAGPNQPIPKEGEIDPIKGIWKSVNDYLYTASNRNLEQVCLYTLMENPMTSCGCFEAIMAILPECNGIMITTRDHA.GMTPSGMTFSTLAGMIGGGT----------------------.------------------------------..---------------------------------....----.........................................
F6D6C0_METSW/2-408               ........................fEDIPVDVSPMYEGERIRAANMFVELAGPK.S..IGAELVQV-.-.KED....VEDGKIEVVGPNID..E.MK....E.GK......IYP........FG..ILVEIK.G.EKL.EKE...LEG....VI..ERKMHELCNYV...KGFM.H..L..NQ..R..DQIWCRISKETKEAGFK.LEDLGKALSALYKEEF-PIIESMSIRILTEK.SEV......ESFI.ETARSQYEQRDARSRE..LSEEDVDVFYGCVMCQSFAPTHVCVVTPDRTALCGAINWFDCRAAAKMDPDGPIFEIEKGAVIDDVKGEYENVNAAVAEKSQGTFDRVYLHSVFGHPHTSCGCFEAVAFYIPELDGIGIVDRDFK.GETPLGIPFSAMAGQCSGGKQIEGFAGLSLEYMRSPKFLQAD.GGYERIIWLPKDIKSSLEGFIP--------..EDLMDKIPTDEDANSIKEIRKFLQDAEHPIMER....----lketesdkae...............................
ACDB2_METJA/2-417                ........................fDDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVKV-.-.VNK....AED-KVEIIGKDID..E.ME....E.GS......RNP........FA..IIVEVS.G.SNL.EED...LEG....VL..ERRIHEFLNYI...EGVM.H..L..NQ..R..DQVWIRINKDSFNKGLR.LKHIGKVVQRLFKAEF-PFIEKCDVTIITDP.EKV......KEEL.EKAREIYNKRDEKTKA..LHEEDVDVFYGCVMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKGECLDEKLGIYSGVNEVVRERSQGTVEEVTLHSALEKPCTSCGCFEAIVFYIPEVDGFGIAHRGYK.GETPMGIPFSTLAGQCSGGKQVPGFVGISISYMKSPKFLQGD.GGWERVVWLPKELKERVKDAIP--------..EELYDKIATEEDVKTTDELIKFLKEKGHPCAER....----igaeveeeaieeeeveeeme.....................
G3CWJ2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPAGPCQVITKERPINEELGSYEDVDEAVQKLSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZT6_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELNPNGPSQPIMKEGCIDERTGRYETVNQAISDATHGAVESVTLYSLLED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
B8FXA2_DESHD/314-726             ........................eIPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVSMV.G.PDE....VVDGQVTVIGPEID..T.VP....E.GS......RLP........LG..IKVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQVTIYTDQ.QAV......EENL.VKARERYRARDARLKS..LTDENVEEFYSCLLCQSFAPNHVCIVSPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGLAIDEVKGMWQSVNDYLRPSSNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRSYIISRKFIPAD.GGISRIVWMPKELKEFLKEDLVARSIDEGL.gEDFIDKIADESVGTTVEEIIPFLEENGHPCFSL....DPLM.........................................
B8FGK7_DESAA/62-244              .............efgfsakgkgkp-------------EVILTEDVRVELGHPS.M.gSLAAVLTTY.D.QSL....VQHGRISLVGPELR..Q.MK....P.GG......RQT........FA..QIIFLAlD.RSA.MPD...PFD....-L..E-NAQYLMHRL...PGYM.V..R..SV..P..GKLWVRVGKDRFNQGLD.LHTVGSALVKAYTDDFPGVLKAEIVFVTTGK.EDV......LALE.----------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----piateakvlsgrhkklvlgvdgs..................
F6CR43_DESK7/320-732             ........................eIDAPITVGPAFEGESIRKKDMYVEFGGTR.T..PSFELVRMA.G.PDE....VEDGKVEVIGPDID..T.VQ....P.GS......AMP........LG..IIVDVY.G.RKM.QED...FEP....VL..ERRIHYFTNYG...EGLW.H..V..AQ..R..DIMWVRISNGAFAKGFR.LKHLGNILYAKFKSEFAAVVDRVQVTIYTDE.QKV......LEMR.ELARQYYKKRDDRLKE..LKDETVDTFYSCTLCQSFAPTHVCIVPPERTGLCGAVSWLDAKASYEINPHGPNQPIKLEGLIDPVKGQWKSVNEFVHANSQRTIEAVNFYTIMEYPMTSCGCFECILAMVPECNGFMVVNREHG.GMTPSGMTFSTMAGTIGGGAQMPGFMGISKSYLASRKFVPAD.GGLARVVWMPKALKDQLRPQLEEAAEAAGL.gKDFVDKIADETVGTSGEEILPFLEEKGHPALSL....P---pll......................................
E5E763_9FIRM/157-561             ........................eIDCPVSVSSAFEGERVRKDNMKAEFGGNR.T..KAWELVHTV.E.LGD....IEDHKITVVGPDID..D.PQ...fD.GVd...vvRIP........FG..LEIKVA.G.KAM.QSD...FES....VL..ERRLHYFLNYI...EGSM.H..V..GQ..R..NICWVRLTKEAFDAGFR.LRHFGEVVYAKMLDEFGKVVDKVEVTIYTKE.EDV......VRLEeELVRPIYNVRDDRLNS..LTDESVDVFYTCTLCQSFAPSHVCVVTPERLGLCGAVSWLDSKATKELDPTGPAQPIEKNGVIDERLGAWEEVNDVVAKCSQGAVEKVTLYSILEDPMTSCGCFECICGIMPEANGVVIVNREFG.GMTPTGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFMAAE.GGIERIVWMPKELKDDVAERLNXSVQELYG.iENFTDMVCDETIAVDSEAVLEFLT---------....----.........................................
H1P323_9BACT/320-732             ........................eIDVPITIGPAFEGETIRRADAYVEFGGSK.A..PGFELVKMV.G.QDE....IEDGKITVIGPELD..E.VQ....E.GS......VLP........IG..IYIKIY.G.RKM.QSD...FES....VL..ERRVHYFVNYG...EGLW.H..V..AQ..R..DLCWLRISKDAAAKGFK.FKNYGDILIAKYKSEFPAIVDRVEVTIYTEK.AAV......EEKL.LEARAAYSQRDERLRG..LKDDTVDEFFSCTLCQSFAPNHSCVVTPERVGLCGAVSWLDAKASFEINPTGPNQPILKEGTIDEKKGIWKSVNDFIYNSTNKTLEEVALYTLMELPMTSCGCFEAIMAIVPEANGIMITTREHT.GMTPSGMTFSTLAGSVGGGVQSPGFMGIGKRYITSRKFISAD.GGMGRIVWMPKALKEQIREDFVKRSVEEGL.gEDFIDKIADESIGTATEEILPFLEEKGHPAFAM....ES--lf.......................................
E5EZP1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELNATGPSQPVPKEGLIDERTGRYEAVNKAVAEATHGAVENVTLYSLIE------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
E5EZP4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNERTGAYETVNEAIGEATHGAVSQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A7I828_METB6/1-406               .........................--MPVDVGLVHVGERIRKNDMHVELGGPSvE..KKFELVKVR.K.PGE....IRDGAITVVGPDLS..A.ME....E.GG......KFP........LG..ILVEIA.G.PQL.EED...IEG....VI..ERRIHEYTNYV...EGFM.H..L..NQ..R..YDIWVRVSKKAYAKGLTsLTHVGKVLIDLLKNEL-PIIEKIQVTFFTDK.EAI......SARY.AEAMASYEARDARARG..LTDDDVDVFYGCALCQSFAPSHVCVITPQRYANCGAISWFDGRAAARIDPKGPIFPISKGECVDPVKGEYTGINESARKRSLGTVSRIFLYSAFACPHTSCGCFEGIAFYIPEVEGFGIVMRGYG.DVTVNGLPFSTMADSTAGGRQVDGFHGISLEYLRSPRFLAAD.GGYARVVWMPAELKEQMRAFIP--------..TDLFSRIATEKDVQTVSELRDFLSGKSHPVTER....----wkaeelvp.................................
G3CWQ4_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELNPNGPSQPIPKEGCTDERTGRYDAVNQIVNEATHGAVDNVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G3CWL8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDSKATKELDPTGPAQPIEKNGVIDERLGAWEEVNDVVAKCSQGAVEKVTLYSILED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G6I8V9_9FIRM/320-731             ........................dIDVPITVGPAFEGESIRKKDMYVEFGGTK.T..PGFELVRM-.A.DDT....IEDGKIELIGPDVD..T.VP....E.GS......RMP........IG..IVVDVY.G.RKM.EED...FEP....VL..ERRIHYFSNYG...EGLW.H..T..AQ..R..DINWMRISKDAYAKGFR.IKHIGEILYAKFKSEFSAIVDRIAVTIYTDE.QKV......LEMR.EVAREYYKKRDDRLKE..LRDEKVDTFYSCTLCQSFAPTHVCVIAPERVGLCGAVSWLDAKAAYEINPHGANQPVPKEGVIDEVKGQWKSFNEFTFNNSQRSVEAVNFYTIMEYPMTSCGCFECILAMVPECNGFMVVNREHS.GMTPSGMTFSTLAGTIGGGAQMPGFMGMGKSYLASPKFVPAD.GGLGRMVWMPKALKEELRAALEEAAENAGL.gKDFVDKIADETVGTSGEEIMSFLDEKGHPALTM....DPLM.........................................
E5EZW3_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATHNLDPAGPCQVVTKEKLIDERIGEYEDVNEAVRKFSQGALEDVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
F6BF43_METIK/2-408               ........................fDDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVRV-.-.-GE....ASD-KVEVIGKDIN..E.ME....E.GT......RTP........FA..IIVRVS.G.DNL.EED...LEG....VL..ERRIHEFFNYI...EGIM.H..L..NQ..R..DSVWIRINKSSASKGLT.LEHIGKVIQRLYKAEF-PFIKSVDVTLITDP.DKV......KEEL.EKAREVYAKRDARARE..LSEEDVDVFYGCIMCQSFAPTHVCIITPDKPALCGGITYFDARAAAKIDPEGPIFEVPKGELLDEKLGIYSGVNKVVSEKSQGSIEEIALHSVMYKPSTSCGCFEAITFYIPEVDGFGIVHRDFK.GETPMGVPFSSLAGQCSGGKQVEGFCGMCIEYMRSPKFFQAD.GGWQRVVWLPKDLKEKVKDAIP--------..EDLYDKIATEEDVSNTEELAKFLKEKNHPVVER....----wgkveeeeieee.............................
Q12XL5_METBU/2-411               .......................ad-EYPFEISPMFEGERIRKDGMHVELSGPK.S..KGYELVRAT.S.MDE....IEDGKFTLIGPDIS..E.ME....E.GS......RHP........FA..MIYKIA.G.ELV.EED...LES....IV..ERRNHDFQNYI...QGLM.H..L..NQ..R..YDVWIRVSKDAVAKGLTsFEPIAQAVMMLFKNEL-PFIEKVEAVYITDL.AEI......EKEM.DNVKAIYKSRDDRTRD..LHDEDVDTFYGCTLCQSFAPSNVCVITPDRISLCGAINWFDGRAAAKVDPEGPQFAIPKGDTINAVAGEYSGVNDLAKSLSSGEYDRINLHSFFEYPHTSCGCFEVVGFYIPEVDGIGWVDRDFT.GVAPNGLPFSTMAGQTGGGKQVVGFLGIGINYFRSPKFIQAD.GGWDRVVWMPKHLKDRVLADIP--------..ANIADKVATEEDASDLDSLKNFLTEKDHPIVQR...wE---eeaeeepe.................................
G3CWH1_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPNGPCQVITKERPINEELGSYEDVDEAVQKLSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
F8TES6_9CLOT/294-660             ........................eIPIPVAFAAAFEGERIRKNDMLAEFGGNK.T..KAWELVMCA.D.QGE....VEDHKIEVIGPDID..T.ID...kA.PG......RMP........LG..MLIKVS.G.TNM.QKD...FEP....VL..ERRLHYFLNYI...EGVM.H..V..GQ..R..NLTWVRIGKEAFEKGFR.LKHFGEVIYAKMLDEFGSVVDKCEVTIITDP.DKA......EELEgKYAVPRYSERDARLES..LVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVKSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFG.ATTPLGMTFGELASMTGGGVHTPGFMGHGRQFIASKKFMKGE.GGLGRIVWMPKELKDFVAE-----------..---------------------------------....----n........................................
D5RWL3_CLODI/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
E5EZL9_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------FDAKATHELDPNGPCQIVTKLHCTDERLGAYDDVNEAVSKYSHGALEKVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
C7P657_METFA/2-411               ........................fSDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVKVV.D.--K....-ADDKVEIVGKDID..E.ME....E.GS......RTP........FA..IIVKVS.G.EKL.EED...LEG....VL..ERRVHEFFNYM...EGVM.H..L..NQ..R..DQVWIRINKDSFNKGLR.LEHIGKVIQRLFKAEF-PFIEKCDVILITDP.DKV......KEEL.EKAREIYNKRDERTKA..LHEEDVDVFYGCIMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIPKGECLDEKLGVYSGVNEVVKERSQGTVEEVALHSALEKPCTSCGCFEAVVFYIPEIDGFGIAHRGFK.GETPMGIPFSTLAGQCSGGKQVPGFLGVSIAYMKSSKFLQGD.GGWERVVWLPKELKERVKEAIP--------..EELYDKIATEEDVKTTDELAKFLKEKGHPCAER....----igaaeveeiteeve...........................
E5EZP2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHELDPNGPCQIVKRDHVIDERAGRIEEVNEAVKKYSQGALEEVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A6P2L5_9FIRM/31-217              areggknqlilgseaayelgalscd-----------------------------.-..SVSCLLLTE.D.AEQ....VPRDEVVLYGPDLP..E.IK....-.G-......DCS........FA..RITVLR.T.EDI.TKD...GEQaafaII.kGIETKKYGVYP...AGYM.I..R..AAafS..NREQARVSRKALDKGLT.FEQVGNLFIRQYRRSR--FVQAVKVIFITLP.---......----.----------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----qapyrdldglatrtnkitgalnhilddvdmdckac......
D9Y4G2_9BURK/62-216              .................psfagmlc-----------------------------.-..---------.-.---....--------------..-.-E....D.AS......SNS........LG..LFLYFY.G.PKL.NDE...LFY....LV..LQNFRSML-RL...PGVM.V..K..GA..G..KDLWIRIGKKAQAQGIG.LKELAAVLSARIQEEF-PEIESVQACFLRGQ.GPI......YKQL.DQVSEVFYQNSEKLKA.kVWEDRGFNFKDCH----------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----vlghcgkcadkklcanv........................
H5Y4Z0_9FIRM/314-726             ........................eLPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVQMV.G.PEN....IVDGQVTVIGNDID..T.VP....E.GT......KLP........LG..IKIDIY.G.RKM.QAD...FEG....VF..ERRIHYFANYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHFGELLIAKLKEEFPAIIDRVEVTIMLDQ.AAV......EEGL.VQARERYRARDDRMRS..LTDESVEDFYSCLLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASHEIAPNGPNQPIPKGPAIDELRGMWQSCNEYLYKASNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMLTTREHS.GMTPCGMTFSSLAGTCGGGMQTPGFMGIGRTYLLSKKFIPAD.GGIARIVWMPKELKEFIREDFIQRSIDEGL.gADFIDKVADESVGSTVEEILPFLEENGHPCFAL....DPLM.........................................
F3AAB2_9FIRM/295-708             ........................nIDIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVQTV.D.ASE....IEDHKITVVGPEAD..E.ME....L.GS......KNN........IA..YVVKVA.G.KNM.QSD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAFNAGFR.IKHIGEVLYASVKNEFDAVVDKCEVVIYTDP.AEC......TRIRhEVAIPTFDKRDDRLKS..LTDESVDVYYSCILCQAFSPSHVCVVTPERLGLCGAVSWLDAKATNELDPNGPCQVITKERPIDERIGEYEDVNEAVQKFSQGALQDVSLYSIMEKPMTSCGCFECICGIEPFSNGVVITNREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGIERIVWMPKELKETVAERVNQTAKELYG.iDNFIDMVGDETIATDPEELVAFLTEKNHPALSM....DPMM.........................................
G3CWN0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQVITKERPIDENLGSYEDIDEAVKKFSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5EZQ8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATYELSPAGPSQPIPKEGLIDEKLGAYESVNKMVASATHGAVEKVTLYSLVQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
G0H0D2_METMI/2-409               .......................fg-DIPVEISPMYEGERIRAANMFVELGGPK.S..VGAELVLV-.-.SDN....VEDGKVEVMGPELK..D.MD....E.GK......IYP........FG..LLMEVS.G.EKL.EKD...LEG....VI..ERRIHEICNYV...QGFM.H..L..NQ..R..DKIWCRIGKDSHSKGFE.LKHLGQALSTLFKDEF-PIIEAISITIFTEE.EKV......KEFV.EKALVEYQARDSKARD..LSEEDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEIPKGDLLDSVTGEYTSLNNTVAENSQHTFNKVYLHSIFGHPHTSCGCFEAVAFYMPELDGIGVVHRDFK.GDTPLGIPFSAMAGQCSGGKQVEGFAGLCIEYMRSPKFLQAD.GGYERIVWLPKEIKEKVLESIP--------..EELRDKIATEEDVSSIHNLKKFLNEKDHPVLKR....----iaeleapaeeq..............................
ACDB_ARCFU/22-429                ........................eAEFPFDISPMYEGERIRKGDMYVELGGPT.Q..PGFELVMAL.P.MDQ....VEDMKVTLIGPDLD..E.ME....E.GQ......AYP........YA..MIYYIA.G.EMV.ETD...LEP....VI..ERRNHDFQNYI...EGYM.H..L..NQ..R..YDIWIRIGKNAIKKGLKsLIQIAKATMMLYKNEL-PFIEKIEAVYITDK.DLV......EKLLnELAMPIFEERDARVEA..LSDEDVDEFYSCTLCQSFAPTNVCIVSPDRPSLCGAITWFDGRAAAKVDPEGPNRAVPKGELLDPIGGEYSGVNEFAKQESGGEYERIKLHSFFEYPHTSCGCFEVIGFYMPEVDGIGWVHRGYA.EPAPNGLTFSTMAGQTGGGKQVVGFLGIGIAYFRSKKFIQAD.GGWYRTVWMPKELKERVAKYIP--------..DDIRDKIATEEDAKTLDELREFLKKVDHPVVK-....----gvvrpvdg.................................
E5EZU8_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHELQPNGPSRIVRKDHCIDEVVGRYEEVDEAVKKYSQGALEHVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G6I834_9FIRM/320-731             ........................dIDVPITVGPAFEGESIRKKDMYVEFGGTK.T..PGFELVRM-.A.DDT....IEDGKIELIGPDVD..T.VP....E.GS......RMP........IG..IVVDVY.G.RKM.EED...FEP....VL..ERRIHYFSNYG...EGLW.H..T..AQ..R..DINWMRISKEAYAKGFR.LKHIGDILYAKFKSEFSAIVDRIAVTIYTDE.QKV......LEMR.EMARDYYKKRDDRLKE..LRDENVDTFYSCTLCQSFAPTHVCVIAPERVGLCGAVSWLDAKAAYEINPHGANQPVPKEGLLDDFKGQWQSFNDFCFNNSQRNIEFINFYTIMEYPMTSCGCFECILAMVPECNGFMVVNREHS.GMTPSGMTFSTLAGTIGGGAQMPGFMGMGKSYLSSPKFVPAD.GGLGRLVWMPKSLKEELRPALEEAAENAGL.gKDFIDKIADETVGTSGEEIMSFLEEKGHPALTM....DPL-l........................................
E5E770_9FIRM/159-559             ........................nIEIPVAFASAFEGEIIRRGDMQVEFDGSR.V..DCAELVQTC.E.MSE....VEDHKITVIGPEAD..D.ME....L.GS......KNS........IA..YVVKVA.G.KNM.QPD...FEP....VI..ERKFHNYINCI...EGVY.H..T..GQ..R..DMQRIRISKDAYAAGFR.VRHIGEVLYSQVKNEFDAVVDKCEVVIYTDP.AEC......KRIRhEVAIPVFNKRDDRLAS..LTDESVDVYYSCFLCQAFSPSHVCVVTPERLGLCGAVSWLDAKATHQLDPNGPCQEITKERVIDERIGEYEDVNEAVRKFSQGALEEVSLYSXMEKPMTSCGCFECICGIEPFSNGVCIANREYA.GMTPLGMTFPELASMTGGGVQTPGFMGHGKHFIGSKKFMKAE.GGVERIVWMPKELKETVAERLNATAKEIYG.iDNFTDMIGDETIATDPEELVTFLT---------....----.........................................
F0T9G8_METSL/2-409               ........................fEDIPVDVSPMYEGERIRAANMFVELAGPK.S..IGAELVQV-.-.EED....VEDGKIEVIGPDLN..G.MT....E.GE......IYP........FG..LLIQIK.G.EKL.EKE...LEG....VI..ERRTHELCNYI...KGFM.H..L..NQ..R..DQIWCRVSKEAVESGFG.FEHLGKAISILFKEEF-PIIEAISIKVLTDR.EEV......ETFL.DNASKQYEERDAKARE..LSDEDVDVFYGCVMCQSFAPTHTCVVTPDRTALCGAINWFDCRAAAKMDPDGPIFEIEKGEVLDDVKGEYVNVNTVMADKSQGTVDRVYLHSVFGYPHTSCGCFEAVAFYIPELDGIGIVDRDYK.GETPLGIPFSAMAGQCSGGKQVEGFAGLSLEYMRSPKFLQAD.GGYERIIWLPKAIKDSLIEFIP--------..EDLADKIPTEEEANSIKEIRKFLREHEHPVVER....----lkeskksaaqd..............................
H1J8G3_9FIRM/314-726             ........................eIPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVSMV.G.ADE....VVDGQVTVIGPEID..T.VP....E.GS......RLP........LG..IKVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQVTIYTDQ.QAV......EENL.VKARERYRARDARLKS..LTDENVEEFYSCLLCQSFAPNHVCIVSPERVGLCGAVSWLDAKAAFEITPTGPNQPIPKGLAIDEVKGMWQSVNDYLRPSSNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRSYLISRKFIPAD.GGIARIVWMPKELKDFLREDFVARSVEEGL.gEDFIDKIADETVGTTVDEIIPFLEENGHPCFSL....DPLM.........................................
ACDB2_METTE/1-410                .......................ms-EFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAK.P.MDE....IEDGKVTIVGPDLK..D.ME....E.GK......TYP........WA..MIFHVG.G.ELV.EPD...LES....VI..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRISKDTAAKMDS.FEPFGKAVMMLFKTEL-PFIEKMQVTFYTDQ.AEV......EKQM.AEAMEIFKARDARTKD..LHDEDVDVFYGCTLCQSFAPTNVCVVSPDRVSLCGAINWFDGRAAAKVDPEGPQFAIEKGELLDAKTGEYSGVNEVAKKLSSGEFDKIKLHSFFDAPHTSCGCFEDVGFYIPEVDGIGWVNREYQ.GMAPNGLGFSTMAGQTGGGKQIVGFLGIGINYFYSPKFIQAD.GGWNRVVWLPSMLKEKIDEAIP--------..DDMKDKIATEKDVTDIESLKTFLKEKNHPVVAN....----waaeaeeeeee..............................
D3S711_METSF/302-712             ........................eFDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVKVV.D.--K....-ADDKVEIIGKDID..E.ME....E.GS......RNP........FA..IIVEVS.G.KNL.EED...LEG....VL..ERRIHEFFNYI...EGVM.H..L..NQ..R..DQVWIRINKDSFKKGLR.LEHVGKVVQRLFKAEF-PFIEKCDVIIITDP.EKV......KEEL.EKARKIYNKRDERTKA..LHEEDVDVFYGCVMCQSFAPTHVCVITPDRPSLCGSINYLDARAAAKIDPNGPIFEIPKGECLDEKLGIYTGVNEVVRERSQGSVEEMALHSALINPCTSCGCFEAIVFYIPEVDGFGVAHRNFR.GETPFGLPFSTLAGQCSGGKQVPGFVGISIAYMKSPKFLQGD.GGWERVVWLPKELKERVKDAIP--------..PELYDKIATEEDVKTTDELIKFLKEKGHPIVKK....TE--dvveeveekeeke............................
H7DX01_9FIRM/314-726             ........................eLPIPVNFGPAFEGETIRKGDTYVEFGGGR.T..TAFELVQMV.G.PEN....IQDGRVTVIGPDID..T.VP....E.GS......KLP........LG..IKIDIY.G.RKM.QAD...FEG....VF..ERRIHYFANYG...EGVW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHFGELLIAKLKEEFPAIIDRVEVTIMLDQ.AAV......DEGI.VLARERYRARDDRMRS..LTDESVEDFYSCLLCQSFAPNHVCIVTPERVGLCGAVSWLDAKASHEIAPNGPNQPIPKGPAIDELRGMWQSCNDYLYKASNNTLEEVNLYTLMDRPMTSCGCFEAIMAIVPEANGLMITTREHS.GMTPSGMTFSTLAGTCGGGMQTPGFMGIGRSYILSKKFIPAD.GGIARIIWMPKELKEFLREDFVQRSIDEGL.gADFIDKIADESIGTTAEEIVPFLEENGHPCFTL....DPLM.........................................
ACDB1_METAC/1-411                ........................mVEFPFEISPMFEGERVRKEGMFVELGGPK.S..LGLELVRAK.P.MDE....IEDDKVTIVGPDLK..E.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EPD...LES....VV..ERRVHDFINYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FEPFGQAVMMLFKTEL-PFIEKMQVTFYTEQ.AEV......EKQM.ETAKEIFKARDERTKD..LHDEDVDVFYGCTLCQSFAPTNVCVVSPDRVSLCGAINWFDGRAAAKVDPEGPQFEIAKGDLLDANTGEYTGVNDIAKKLSAGEFDKIKLHSFFDSPHTSCGCFEVVGFYIPEVDGIGWVNREYQ.GMAPNGIGFSTMAGQTGGGKQIVGFLGIGINYFYSPKFIQAD.GGWNRVVWLPSMLKDKIIDTIP--------..EDLKDKIATENDSTDIESLKAFLQEKGHPVVATw.aaE---eeeeeeee.................................
Q0W881_UNCMA/2-412               ........................fKEIPVDVSIAHAGERIRKNDLHVELGGPDvE..EKFELVKVR.Q.GDQ....VKDSAITVIGPDVA..D.ME....P.GK......SYP........LG..ILIEVA.G.PEL.EPD...FEG....VI..ERRIHEYANYI...EGLM.H..L..NQ..R..YDTWIRLSKKAYGKGFTtLRFVGEVLEQLLRNEF-PIIGQMQITFYTDA.AKI......SSAY.AEAMNSYEARDARARG..LTDDEVDVFYGCALCQSFAPGHVCVITPQRYANCGAISWFDGRAAARIDPKGLIFPIEKGSCLDPEKGEYTGINESAGKRSLGEVSRVYLYSAFTYPHTSCGCFEGIAFYIPEVEGFGIVTRGYK.EATVNGLPFSAMADSTGGGRQIDGFHGLSLEYMRSQKFLAAD.GGYARVAWMPAGLKEQMKPFIP--------..PEIFGKIATEREVKNVGELRQFLVERSHPVIQR...wE---aeeenpee.................................
E5E775_9FIRM/157-431             ........................kIDIPVSFASAYEGEIIRRGDMQVEFDGSR.V..DCCELVHMK.E.PGE....IEDHKIEVIGPDLD..E.FE....V.GS......KHS........IA..YVVEVA.G.KSM.QED...FEP....VF..ERKFHSYINCI...EGVM.H..T..GQ..R..DMIRIRISKDTFNAGFR.LKHIGEVLYANVKNEFAAVVDKCQVKVITDP.ELV......TKIRhEIAVPMFNKRDERLAT..MTDEAVDVYYSCIMCQAFSPSHVCIVTPERLGLCGAVSWFDAKATNELDPTGPCQVVTKEKPIDERIGEYEDVNEAVRKFSHGALDDVSLYSIME------------------------------.------------------------------------------.------------------------------..---------------------------------....----k........................................
A7B6C7_RUMGN/31-217              ..................wnllken-------------EFLLQKEVAFELGIRS.Q..PSTCYQAVT.S.SKE...lLPEDKILLYGPDLP..E.IK....K.NV......PFT........RI..TWIQID.PiEDQ.DKA...YQR....IK..KLEFAKFKIIP...EGYM.M..L..SS..SmdQKEQVRVSKKAMKKALD.FATVGNLMIQKYKEEF--QAKHVQILFITRE.LPV......MDQL.---IAQGKKVDE----..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----itnafdhilkniildcdlcpl....................
E5EZP3_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQVVKKEHVIDENIGRYEEVDEAVHKYSQGALEHVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5E768_CLODI/157-558             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLE---------....----.........................................
Q189S5_CLOD6/294-708             ........................eIPIPVSFAAAFEGERIRKSDMFAEFGGNR.T..EAWELVVKK.E.ATE....VEDHKIEIIGPNID..E.VD...aD.GV.....lRLP........LA..VIVKIA.G.KNM.QED...FEP....VL..ERRFHYFLNYI...EGVM.H..V..GQ..R..DMAWVRISKDAFDKGFR.LEHIGEVLYAKMLDEFESVVDKCEITIITDA.EKV......SELK.GEAIAKYNARDERLAS..LVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKATKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGCFECICGIMPEANGFVVVNREFA.SVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKKFAYAE.GGPERIVWMPKELKDYVADKLNATVKEMTG.iENFCDMVCDETIADDSEGVLAFLEEKGHPALAM....ESV-m........................................
G3CWR7_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNERTGAYETVNEAIGEATHGAVTQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
E5E765_9CLOT/1-183               .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKASFEINPTGPNSPIKKEGTIDENKGMWQSVNEFVYNHSNRNLDTVALYTFMDTPXTSCGCFEAILAILPEANGLMITTREHS.GMTPCGMSFSTLAGTVGGGTQSPGFMGVGRRYILSKKFIKAD.GGLGRIVWMPKELKEYLKDEFVKRSVEEGL.gEDFIDKIADETVGTETESILPFLE---------....----.........................................
D2BHF3_DEHSV/322-733             ........................kVPVPVAYGPAYEGERVRGEQIYLECGGGR.T..QMVELVTTA.G.MDD....VTDGKIELFGQDVS..D.VP....E.GS......RLP........LA..IVVEAA.G.HKM.NED...YEP....IL..ERQIHHLLNYA...QGVM.H..I..GQ..R..DIAWLRVSKGAAAKGFS.LKHIGSILHAKLHQDFGGIVDKIQIKLYTTP.EKV......AEIS.GQSKKIYAKRDERIEG..MTDENTETFYSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNLGPNQPVNKGAVIDAKLGQWSGINQFVEKTSGGVVSHYNLYSIIHDPMTTCGCCECISAILPLCNGVMTVNREYA.GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAE.NGLLRLVWMPKSLKDEIRERFNSRAAELGI..PDLLERIADESVGTTEEEILPFLEEKQHPALTL....EPL-i........................................
E5E776_ACEWO/157-574             ........................kIDVPVAVASAFEGERVRKDAMFAEFGGNK.T..ECWELVTSG.D.PAE....MEDHKITLIGPDID..DpMF....A.GKd...vvRLP........LG..IVVTVG.G.KAM.QKD...FET....VL..ERRIHYFTNYI...DGAM.H..V..GQ..R..NIAWIRLTKEAFEKGFR.LKHIGEVLYAKMRSDFEKVVDKCEITIYTNA.EDV......KRLGeELVKPIYAERDERMGA..LTDESVDTFYTCLLCQSFAPSHVCIVTPERLGLCGAVSWLDAKATKELDPEGPNQPVIKGQAIDAQTGRWEAVDKAVASASQGAVEKVTLYSILEDPMTSCGCFECICGIMPEANGVIIVNREFS.DISPVGMTFGELASMTGGGVQTPGXXGHGRFLIGSKKFMSAE.GGLSRIVWMPKELKDDVAERLNKAVFEMTG.iENFADMVCDETIATDSEAVLEFLESKNHPALAM....DPIM.........................................
G3CWH2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATHQLDPNGPCQVITKERPIDENLGSYEDVDEAVQKFSQGALEHVTLYSIMQD-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
G3CWS2_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKAGYQLKPTGPNQPIKKERCTNERTGAYETVNEAIGEATHGAVNQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A0LLE1_SYNFM/325-736             ........................eIPVPVAYGPAFEGERVRRDDVYLECGGGK.T..PCCELVQIA.D.MNT....IEDGRVEVIGPDIK..D.VK....P.GS......RLP........LA..VTVQIG.G.RKM.QED...YEP....IL..ERQIHHLVNYA...QGLM.H..I..GQ..R..DIAWYRISKQAVDKGFT.LEHIGKILHAKFHQDFGAIFDKCQVKIYTDE.AKV......NEII.PKAQAAYRVRDERIEG..MTDEGTETYYSCTLCQSFAPTHVCVISPERTGLCGAYNWLDCKASFEINPTGPNQPVQKGETLDETLGNWKGVNDFVYKASRQSISSYNFYSLVFDPMTTCGCCECIAAVLPLCNGIMTVNRDYT.GMTPTGMKFTTLAGVIGGGNVTPGFVGHSKFNVTQRKFVSGD.GGIHRLVWMPKILKEEIRDRLEKRGQDIGI..PNFVDMIATEENGVTEEEILAFLEKMGHPAVTM....DPI-l........................................
A9AAW4_METM6/2-409               .......................fg-DIPVEISPMYEGERIRAANMFIELAGPK.S..VGAELVLV-.-.SDN....VEDGKVEVIGPELK..D.MD....E.GK......IYP........FG..LLMEVS.G.EKL.EKD...LEG....VI..ERRIHEICNYV...QGFM.H..L..NQ..R..DKIWCRVSKDSHAKGFE.LKHLGQALSTLFKDEF-PIIEAISITIFTEE.EKV......KEFV.EKAVLEYQTRDSKARD..LSEDDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAAKIDPEGPIFEVPKGDLLDPVTGEYTTLNSTVADKSQGTFDKVYLHSIFGHPHTSCGCFEAVAFYIPEVDGIGIVHRDFK.EDTPMGIPFSAMAGQCSGGKQVEGFAGLCIEYMRSPKFLQAD.GGYERIVWLPKEIKEKVLESIP--------..EELRDKIATEEDVSSIHNLKKFLNEKDHPVLKR....----iaeleapveeq..............................
G6GFC9_9FIRM/314-726             ........................eVPIPVNFGPAFEGETIRKGDTYVEFGGGK.T..TGFELVRMV.A.QDE....VEDGKITVIGPEID..S.VP....E.GT......RLP........LG..IMVDIY.G.RKM.QED...FEG....VL..ERRIHYFTNYG...EGIW.H..V..AQ..R..DLCWVRISKDARAKGFL.MKHIGELLLAKFKQEFPAIVDRVQITILTDQ.AAV......NENI.VKARERYRIRDARLKS..LTDESVDTFYSCLLCQSFAPNHVCITTPERVGLCGAVSWLDARAAYEITPTGPNQPIPKGPAIDEVKGMWQSCNDYLRPASNNTLDEVNLYTLMDKPMTSCGCFEAIMAIVPEVNGLMITTREHS.GMTPCGMTFSTLAGTVGGGLQTPGFMGIGRSYVVSRKFIPAD.GGIARIVWMPKELKEFLREDFVQRSIDEGL.gEDFIDKIADETIGTTVEEIMPFLEENGHPCYSL....EPL-m........................................
Q649S5_9ARCH/53-469              ........................fTGISYDISPRQAGQRVRKHDMYCELGGPK.QrySSYFFIDVV.KgEDK....IEDGRVEVIGPEIK..E.I-....E.GQ......SLP........FG..FWIRYY.G.KEL.TED...YLD....LL..TRWTYFALEEG...EGWM.L..L..NT..R..DTIWLRLHKKNADK-HD.FEHLGQAMINLCKIQF-PLVEKADAKILIAT.EDLggskrtKGIIdNVCTPYWERVDKRARA..FSDDDADTFYGCTICQTFAPSHVCAVAPDRPPYCGIITWIGAKVMCDLDPYGYIFEMPKGECVDPEGGEYTGINEKIYEKSNRTYKRVVMYSSITYPQTNCGCFEAAIFYIPDVDGLGLVDRRYG.GETPLGVTFSKLAGLISGGQQNHGYCGISSRTPRSRKFVRAD.GGWNRIVWIPKEYKQILTESIP--------..AEMFDKIATEEDCIDPGEVKEFLKRVHHPVVTL....----wkdgetpdpl...............................
C9RHJ0_METVM/2-410               ........................fEEIPVSVGPMNEGERIRGPDMYVELAGPK.S..YGFELVRVV.-.-DN....-ADDEVKIIGKDID..E.ME....E.GS......RNP........FA..VIVRVS.G.ENL.EED...LEG....VL..ERRVHEFFNYI...EGVM.H..L..NQ..R..DQVWIRISKDAYQKGLR.LKHIGEVIKQLFKAEF-PFIEKCDILLITDP.DKV......KEEL.EKAREIYNKRDERTKS..LHEEDVDVFYGCIMCQSFAPTHVCVITPDRPALCGGINYLDARAAAKIDPNGPIFEIKKGECLDEKLGVYSGVNEVVREKSQGSVEEVTLHSALEKPCTSCGCFEAIVFYIPEVDGFGIAHRGFK.GETPMGIPFSTLAGQCSGGKQVPGFVGISISYMKSPKFLQGD.GGWERIVWLPKELKERVKDAIP--------..EGLFDKIATEEEVKTTDELIKFLKEKGHPCAER....----igaeteevveeie............................
Q64BH1_9ARCH/7-415               .......................ve-KFPFDINPMYEGERVRKAGLYAELGGQS.K..PGFELVLFEpE.PEN....IKDGEVSLIGPDLA..D.ME....E.GG......KYA........YG..MIYRVY.G.EQI.EKD...LEA....VI..ERRNHEYQSYI...QGYM.H..L..NQ..R..GGIWVRISKDAVKKGLKsLKQIGRATIMLFKAEL-SFIERMEATFITDE.EEV......KKRL.EEANQIYEARDMRSRG..LHDEDVDEFYQCTLCQSFAPTNVCVVTPDRIALCGAMSWFDSRAAARVDPEGPNAPIPKGDCIDPIGGEYTGVNEAAVRLSSGEYDSIKIHSFLEKPHTSCGCFEVAGFYIPEVEGIGWVHRGSKvSETPIGLPFSTIAGSVGGGKQVQGFLGIGIQYFYSSKFIQLD.GGWRRVVWMASDLKERVVDAIS--------..DEMKDKIATEKDVKDIEELREFLQRVDHPVVK-....----gvirevdg.................................
A8ZXU9_DESOH/37-228              .................mgdsrslv----------------LSSDTAVELGSPK.T.aSTAFLVWTD.D.TEA....VSHGRVTRIGPDIP..K.-E....T.RD......LVP........FGkiVLVNVS.G.FDE.ANT...YDR....FR..EMEMAKYDIHP...AGYM.MraV..SQ..Y..QREWSRISKKAKTDGFS.LSFLGKALIEKLSA-L-PYVHGAEVIFVTSS.ADD......----.----------------..-----------------------------------------------------------------------------------------------------------------------------.------------------------------------------.------------------------------..---------------------------------....----vtalkavgesvgkitgamnkmgeemdldcdaceyspvcdsv
A6UW76_META3/293-698             ........................dVNIPVSVGPMNEGERVRGPDMFVELAGPK.Q..YGFELVKV-.-.VDD....ASD-KIEIIGKDIG..E.ME....A.GT......KTP........FA..VIINVS.G.KTL.EDD...LEG....VL..ERRVHEIFNYI...EGVM.H..L..NQ..R..DSVWIRINKESAEKGLN.LIHIGKIIQDIYKSEF-PFIENIDVKLITDA.DIV......KEEL.EKVKEIYKFRDEKTKN..LHEEDVDVFYGCIMCQSFAPSHVCIITPDKPALCGGINYLDARAAAKIDPDGPIFAIEKGECLDEEKGIYDSVNEVVQDKSQGAIESITLHSVLDRPSTSCGCFEAITFYIPEVDGFGIVDRSFK.GETPMGVPFSALAGQCSGGNQVEGFCGISVSYMKSSKFFKAD.GGWERVVWLPSELKNKVIDGIP--------..EEMIPKIATEEDVSSIEELIDFLKKNNHPVAEN....----igldmdaedi...............................
E5EZL5_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAKATNELDPNGPCQIVPKTRLIDERVGRYEDVNEAVNKYSHGALEQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
A5FRE9_DEHSB/322-733             ........................kVPVPVAYGPAYEGERVRGEQIYLECGGGR.T..QMVELVTTA.K.MDD....VTDGKIELFGQDVS..D.MP....E.GS......RLP........LA..IVVEAA.G.HKM.NED...YEP....IL..ERQIHHLLNYA...QGVM.H..I..GQ..R..DIAWLRIGKSAAAKGFS.LKHIGAILHAKLHQDFGGIVDKIQIKLYTTP.EKV......AEIS.RQSKKIYTKRDERIEG..MTDENTETFYSCTLCQSFAPSHVCIVSPERTGLCGAYNWMDCRASNEINNIGPNQPVNKGAVIDAKLGQWSGINQFVEKTSGGVVSHYNLYSIIYDPMTTCGCCECISAILPLCNGVMTVNREHT.GMTPCGMKFTTLAGTIGGGITTPGFLGHSKYNITQRKFISAE.DGLLRLVWMPKSLKEEIRERFNARAAELGV..PDLLERIADESVGTTEEEILPFLEEKQHPALTL....EPL-i........................................
D3S707_METSF/2-412               ........................fDDIPVSVGPMNEGERVRGPDMYVELAGPK.S..YGFELVKVV.D.--K....-ADDKVEIIGKDID..E.ME....E.GS......RNP........FA..IIVEVS.G.KNL.EED...LEG....VL..ERRIHEFFNYI...EGVM.H..L..NQ..R..DQVWIRINKDSFKKGLR.LEHVGKVVQRLFKAEF-PFIEKCDVIIITDP.EKV......KEEL.EKARKIYNKRDERTKA..LHEEDVDVFYGCVMCQSFAPTHVCVITPDRPSLCGSINYLDARAAAKIDPNGPIFEIPKGECLDEKLGIYTGVNEVVRERSQGTVEEVTLHSALEKPCTSCGCFEAVAFYIPEVDGFGIAHRGFK.GETPMGIPFSTLAGQCSGGKQVPGFVGISIAYMKSPKFLQGD.GGWERVVWLPKELKERVKDAIP--------..PELYDKIATEEDVKTTDELIKFLKEKGHPCAER....----igaevveevveeeee..........................
Q1NJW3_9DELT/1-180               .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..------------------------------------------------------QPIDKGECLDSKLGIFQGINDFINQASRGAVTDLSCYSLMVDPMTACGCFEAIAAMLPQCNGIMVVNRDFM.GMTPSGMKFTTLAGMAGGGAQTPGFMGVSKHYLTSPKLFLAE.GGLPRLVWLPKMLKDELQDKLQERCQAIGM..PELFDKIATEENGTSEEEILEFLKKVGHPALEM....ESV-v........................................
E5EZU3_9BACT/1-56                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..----------------------------------------DARATKELDPNGPCQIVPKTGCTDERLGAYDSVNEAVSTYSHGALEKVTLYSLFQ------------------------------.------------------------------------------.------------------------------..---------------------------------....----d........................................
Q46FC7_METBF/1-411               ........................mAEFPFEISPMFEGERVRKDGMFVELGGPK.S..MGLELVRAK.D.LDE....IEDDKVTIVGPDLK..E.ME....E.GK......TYP........WA..MIFNIG.G.ELV.EAD...LES....VV..ERRVHDFVNYC...QGIM.H..L..NQ..R..YDVWMRVSKDTAAKMDS.FDSFGKAVMMLFKTEL-PFIEKMQVTFYTDE.AEV......EKQL.EEAKEIFKIRDARTKD..LHDEDVDVFYGCTLCQAFAPTNVCVVSPDRISLCGAINWFDGRAAAKVDPEGPQFAIEKGELINADTGEYSGVNEIAKKLSSGEYDKINLHSFFEYPHTSCGCFEVVGFYIPEVDGIGWVNREYQ.GMAPNGLGFSTMAGQTGGGKQVVGFLGIGVNYFYSPKFIQAD.GGWNRVVWLPAMLKEKIAETIP--------..EDIKDKIATENDATDIESLKAFLQEKNHPVVANw.asE---eeeeeeee.................................
E5EZQ0_9BACT/1-57                .........................-----------------------------.-..---------.-.---....--------------..-.--....-.--......---........--..------.-.---.---...---....--..-----------...----.-..-..--..-..-----------------.-------------------------------.---......----.----------------..---------------------------------------LDAEAGYQLKPTGPNQPIKKERCTNEKTGAYETVNEAIGEATHGAVTQVTLYSIMED-----------------------------.------------------------------------------.------------------------------..---------------------------------....----.........................................
#=GC SS_cons                     ........................----SS-BSGGGTT----CCCEEEEEETTT.S..-EEEEEEE-.-.CCC....--TTEEEEES--CC..C.S-....T.TE......EE-........EE..EEEEEE.S.TT-.-GG...GHH....HH..HCHHHHHHCTB...TTEE.E..E..CC..T..TCEEEEEEHHHHHCT--.CHHHHHHHHHHHHHCSCTTBSEEEEEEEESH.HHH......HHCC.CCCHHHHHHHHHHHHC..--TTT-SEEEEE-GGGGTSTT--EEEBTTB--TTSS--HHHHHHHHHHSTTSSEEEEES-SEEETTTTEEHHHHHHHHHHTTTS-S---TT-SSSS-----S--SEEEEEECCCTEEEEEETT--.SB-TTSSBHHHHHHHHTTT--BTTEEEE-GGGGGSTTTTGGG.TGGGGEEE--HHHHHHCHHHHHHHHHHTTS.-TTHHHHSB-TTT-SSHHHHHHHHHHTT-GGGGS....STGG-........................................
#=GC seq_cons                    ...........................h.h.hush.tGE.lRt.ph.hEhsG.p.....shEhl.h.....tp....htDtplplhG.-lt..p.h.......u.........s........hu..hhhpl..G.cth.p.D...hEs....lh..ERphH.hhshh...pGhh.+..h..sQ..R.....hhRlsKtshttGht.hpphuphl..hhhtch.shl-phplhhhTp..tth.......p.h...s...at.RDt+htt..h.--ts-.aYsC.hCQsFuPsplChlsP-R.uhCGuhsaLDAKAstclcPsGPsQslsKtpslDEphGtapsVNEhVpchSpGslEcVsLYSlhcpP.TsCGChEslhhh.P..sGhhhspRta..s.sP.Gh.FsthAu.huGG.p..GahGhsh..h.p.+hh.u-.GG..RhlWhst.hKp.l...h............phhthlssEp.s.t.ttl..al...........................................................
//
DBGET integrated database retrieval system