GenomeNet

Database: Pfam
Entry: Chordopox_RPO7
LinkDB: Chordopox_RPO7
Original site: Chordopox_RPO7 
#=GF ID   Chordopox_RPO7
#=GF AC   PF05864.9
#=GF DE   Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_9596 (release 8.0)
#=GF GA   27.50 27.50;
#=GF TC   27.50 124.10;
#=GF NC   27.40 20.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1560534
#=GF RT   Characterization of a 7-kilodalton subunit of vaccinia virus
#=GF RT   DNA-dependent RNA polymerase with structural similarities to the
#=GF RT   smallest subunit of eukaryotic RNA polymerase II. 
#=GF RA   Amegadzie BY, Ahn BY, Moss B; 
#=GF RL   J Virol 1992;66:3003-3010.
#=GF DR   INTERPRO; IPR008448;
#=GF CC   This family consists of several Chordopoxvirus DNA-directed RNA
#=GF CC   polymerase 7 kDa polypeptide sequences. DNA-dependent RNA
#=GF CC   polymerase catalyses the transcription of DNA into RNA.
#=GF SQ   11
#=GS Q08FT8_DPV83/1-63  AC Q08FT8.1
#=GS Q8V3P2_SWPV1/1-63  AC Q8V3P2.1
#=GS RP07_MYXVL/1-63    AC Q9Q8P6.1
#=GS RP07_MCV1/1-63     AC Q98229.1
#=GS RP07_RFVKA/1-63    AC Q9Q921.1
#=GS Q070H4_CPRVZ/1-63  AC Q070H4.1
#=GS RP07_VAR67/1-63    AC Q07047.1
#=GS Q6TUV8_YMTV5/1-63  AC Q6TUV8.1
#=GS RP07_VACCW/1-63    AC P68317.1
#=GS RP07_FOWPN/1-63    AC Q9J5A4.1
#=GS Q6TVS8_ORFSA/1-63  AC Q6TVS8.1
Q08FT8_DPV83/1-63             MVFQLVCSTCGRDLSEERYLLLIKEETLKKVLDNVKNSCCRLKLSTQIESQRNLTVQPLLDIN
Q8V3P2_SWPV1/1-63             MVFQLVCSTCGRDISEERYSLLIKEISLEKVLKRVTNSCCRLKLSTQIEAQRNLTVQPLLDIN
RP07_MYXVL/1-63               MVFQLVCSTCGRDISEERYALLIKKIDLKTVLRGVKNNCCRLKLSTQIEPQRNLTVEPLLDIN
RP07_MCV1/1-63                MVFALVCASCGRDLSEVRYRLLIERQKLSDVLRNLTHMCCRLKLATQIEPYRNLTVQPLLDIN
RP07_RFVKA/1-63               MVFQLICSTCGRDISEERFALLIKKIALKTVLKGVKNSCCRLKLSTQIEPQRNLTVEPLLDIN
Q070H4_CPRVZ/1-63             MVFPMVCSTCGFDLTEARYRLIVQKATLSDVLATFSRPCCRIKLSTQIEPPRNLTILPMLDVN
RP07_VAR67/1-63               MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN
Q6TUV8_YMTV5/1-63             MVFQLICSTCGRDISEERYHLLIKELSLKKVLHGVKNNCCRLKLSTQIEPQRNLTVQPLIDIN
RP07_VACCW/1-63               MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN
RP07_FOWPN/1-63               MVFPLVCSTCGRDLSEARYRLLVEQMELKKVVITYSRKCCRLKLSTQIEPYRNLTVQPSLDIN
Q6TVS8_ORFSA/1-63             MVFPIVCSTCGRDLSHERFLLIVRQRPLKVVLRTVRNVCCRIKLSTQIEPHRNLTVLPMLDIS
#=GC seq_cons                 MVFQLVCSTCGRDlSEERYpLLI+chsLKcVLcsV+NsCCRLKLSTQIEPQRNLTVQPLLDIN
//
DBGET integrated database retrieval system