GenomeNet

Database: Pfam
Entry: Chordopox_RPO7
LinkDB: Chordopox_RPO7
Original site: Chordopox_RPO7 
#=GF ID   Chordopox_RPO7
#=GF AC   PF05864.7
#=GF DE   Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_9596 (release 8.0)
#=GF GA   25.60 25.60;
#=GF TC   25.70 107.00;
#=GF NC   25.50 25.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1560534
#=GF RT   Characterization of a 7-kilodalton subunit of vaccinia virus
#=GF RT   DNA-dependent RNA polymerase with structural similarities to the
#=GF RT   smallest subunit of eukaryotic RNA polymerase II. 
#=GF RA   Amegadzie BY, Ahn BY, Moss B; 
#=GF RL   J Virol 1992;66:3003-3010.
#=GF DR   INTERPRO; IPR008448;
#=GF CC   This family consists of several Chordopoxvirus DNA-directed RNA
#=GF CC   polymerase 7 kDa polypeptide sequences. DNA-dependent RNA
#=GF CC   polymerase catalyses the transcription of DNA into RNA.
#=GF SQ   45
#=GS Q2F8D3_ORFV/1-63   AC Q2F8D3.1
#=GS RP07_RFVKA/1-63    AC Q9Q921.1
#=GS Q70H38_FOWPV/1-63  AC Q70H38.1
#=GS Q0NLY5_VAR66/1-63  AC Q0NLY5.1
#=GS H6TA47_9POXV/1-63  AC H6TA47.1
#=GS B2CWF7_9POXV/1-63  AC B2CWF7.1
#=GS Q49QI2_9POXV/1-63  AC Q49QI2.1
#=GS RP07_FOWPN/1-63    AC Q9J5A4.1
#=GS A7XCH6_9POXV/1-63  AC A7XCH6.1
#=GS Q08FT8_DPV83/1-63  AC Q08FT8.1
#=GS Q0N578_VARV/1-63   AC Q0N578.1
#=GS Q6VZK1_CNPV/1-61   AC Q6VZK1.1
#=GS B9U1G3_9POXV/1-63  AC B9U1G3.1
#=GS RP07_MCV1/1-63     AC Q98229.1
#=GS RP07_VACCA/1-63    AC P68314.1
#=GS Q775W1_CAMPS/1-63  AC Q775W1.1
#=GS RP07_VAR67/1-63    AC Q07047.1
#=GS Q0NG70_VAR46/1-63  AC Q0NG70.1
#=GS D3IZI9_9POXV/1-63  AC D3IZI9.1
#=GS Q77ZC8_9POXV/1-63  AC Q77ZC8.1
#=GS Q0NPC5_9POXV/1-63  AC Q0NPC5.1
#=GS Q08FB8_DPV84/1-63  AC Q08FB8.1
#=GS Q77FQ4_CAMPM/1-63  AC Q77FQ4.1
#=GS Q0NCQ3_VAR65/1-63  AC Q0NCQ3.1
#=GS Q0GP01_HSPV/1-63   AC Q0GP01.1
#=GS D3IZ58_9POXV/1-63  AC D3IZ58.1
#=GS RP07_VACCC/1-63    AC P68315.1
#=GS Q91MV2_LSDV/1-63   AC Q91MV2.1
#=GS Q6TUV8_YMTV5/1-63  AC Q6TUV8.1
#=GS Q6TVE6_9POXV/1-63  AC Q6TVE6.1
#=GS RP07_VACCW/1-63    AC P68317.1
#=GS Q5IXV0_MONPV/1-63  AC Q5IXV0.1
#=GS Q77HN4_MONPV/1-63  AC Q77HN4.1
#=GS Q6TVS8_ORFSA/1-63  AC Q6TVS8.1
#=GS Q77DT5_COWPX/1-63  AC Q77DT5.1
#=GS A9J1N8_VACCA/1-63  AC A9J1N8.1
#=GS Q8V3P2_SWPV1/1-63  AC Q8V3P2.1
#=GS RP07_MYXVL/1-63    AC Q9Q8P6.1
#=GS Q77GM9_LSDV/1-63   AC Q77GM9.1
#=GS Q6RZL9_9POXV/1-63  AC Q6RZL9.1
#=GS RP07_YLDV/1-63     AC Q9DHQ8.1
#=GS Q070H4_CPRV/1-63   AC Q070H4.1
#=GS Q77GD6_LSDV/1-63   AC Q77GD6.1
#=GS RP07_VACCT/1-63    AC P68316.1
#=GS G3EIE0_9POXV/1-63  AC G3EIE0.1
Q2F8D3_ORFV/1-63              MVFPIVCSTCGRDLSHERFLLIVRQRPLKVVLRTVRNVCCRIKLSTQIEPHRNLTVLPMLDIS...
RP07_RFVKA/1-63               MVFQLICSTCGRDISEERFALLIKKIALKTVLKGVKNSCCRLKLSTQIEPQRNLTVEPLLDIN...
Q70H38_FOWPV/1-63             MVFPLVCSTCGRDLSEARYRLLVEQMELKKVVITYSRKCCRLKLSTQIEPYRNLTVQPSLDIN...
Q0NLY5_VAR66/1-63             MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN...
H6TA47_9POXV/1-63             MVYQLVCSTCGKDISEERYLLVIKEMLLKDVLKKVNNTCCRLKLATQIEPQRNLTVQPLLDIN...
B2CWF7_9POXV/1-63             MVFQLVCSTCGRDISEERYALLIKKIDLKTVLRGVKNNCCRLKLSTQIEPQRNLTVEPLLDIN...
Q49QI2_9POXV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
RP07_FOWPN/1-63               MVFPLVCSTCGRDLSEARYRLLVEQMELKKVVITYSRKCCRLKLSTQIEPYRNLTVQPSLDIN...
A7XCH6_9POXV/1-63             MVFQLICSTCGRDISEERYYLLIKELSLKKVLEGVKNNCCRLKLSTQIEPQRNLTVQPLIDIN...
Q08FT8_DPV83/1-63             MVFQLVCSTCGRDLSEERYLLLIKEETLKKVLDNVKNSCCRLKLSTQIESQRNLTVQPLLDIN...
Q0N578_VARV/1-63              MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN...
Q6VZK1_CNPV/1-61              MVLQLVCSTCGRDLSEARYRLLVDRMKLEKIIRTFSLKCCRLKLATQIEPYRNLTVKA-----sed
B9U1G3_9POXV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
RP07_MCV1/1-63                MVFALVCASCGRDLSEVRYRLLIERQKLSDVLRNLTHMCCRLKLATQIEPYRNLTVQPLLDIN...
RP07_VACCA/1-63               MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q775W1_CAMPS/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
RP07_VAR67/1-63               MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN...
Q0NG70_VAR46/1-63             MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN...
D3IZI9_9POXV/1-63             MVFPIVCSTCGRDLSHERFLLIIRQKPLRVVLRTVRNVCCRIKLATQIEPHRNLTVLPMLDIS...
Q77ZC8_9POXV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q0NPC5_9POXV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q08FB8_DPV84/1-63             MVFQLVCSTCGRDLSEERYLLLIKEETLKKVLDNVKNNCCRLKLSTQIESQRNLTVQPLLDIN...
Q77FQ4_CAMPM/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q0NCQ3_VAR65/1-63             MVFQVVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNKCCRLKLSTQIEPQRNLTVQPLLDIN...
Q0GP01_HSPV/1-63              MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
D3IZ58_9POXV/1-63             MVFPIVCSTCGRDLSYERFLLIIKQKPLRVVLRTVRNVCCRIKLATQIEPHRNLTVLPMLDIS...
RP07_VACCC/1-63               MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q91MV2_LSDV/1-63              MVFQLVCSTCGRDISEERYALLIKEVNIKKVLSRVKNSCCRLKLSTQIEPQRNLTVQPLLDIN...
Q6TUV8_YMTV5/1-63             MVFQLICSTCGRDISEERYHLLIKELSLKKVLHGVKNNCCRLKLSTQIEPQRNLTVQPLIDIN...
Q6TVE6_9POXV/1-63             MVFPVVCSTCGRDLSNERFRLIIRQERLKVVLRDVRNICCRIKLATQIEPHRNLTVTPMLDIS...
RP07_VACCW/1-63               MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q5IXV0_MONPV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q77HN4_MONPV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q6TVS8_ORFSA/1-63             MVFPIVCSTCGRDLSHERFLLIVRQRPLKVVLRTVRNVCCRIKLSTQIEPHRNLTVLPMLDIS...
Q77DT5_COWPX/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
A9J1N8_VACCA/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
Q8V3P2_SWPV1/1-63             MVFQLVCSTCGRDISEERYSLLIKEISLEKVLKRVTNSCCRLKLSTQIEAQRNLTVQPLLDIN...
RP07_MYXVL/1-63               MVFQLVCSTCGRDISEERYALLIKKIDLKTVLRGVKNNCCRLKLSTQIEPQRNLTVEPLLDIN...
Q77GM9_LSDV/1-63              MVFQLVCSTCGRDISEERYALLIKEVNIKKVLSRVKNSCCRLKLSTQIEPQRNLTVQPLLDIN...
Q6RZL9_9POXV/1-63             MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
RP07_YLDV/1-63                MVFQLICSTCGRDISEERYYLLIKELSLKKVLEGVKNNCCRLKLSTQIEPQRNLTVQPLIDIN...
Q070H4_CPRV/1-63              MVFPMVCSTCGFDLTEARYRLIVQKATLSDVLATFSRPCCRIKLSTQIEPPRNLTILPMLDVN...
Q77GD6_LSDV/1-63              MVFQLVCSTCGRDISEERYALLIKEVNIKKVLSRVKNSCCRLKLSTQIEPQRNLTVQPLLDIN...
RP07_VACCT/1-63               MVFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDIN...
G3EIE0_9POXV/1-63             MVFQLICSTCGRDISHERYKLIIEKKPLNNVLKSVKNNCCRLKLSTQIEPQRNLTVQPLLDI-t..
#=GC seq_cons                 MVFQLVCSTCG+DIScERY+LII++coLKcVLsoVKNpCCRLKLSTQIEPQRNLTVQPLLDIN...
//
DBGET integrated database retrieval system