GenomeNet

Database: Pfam
Entry: DNAPolymera_Pol
LinkDB: DNAPolymera_Pol
Original site: DNAPolymera_Pol 
#=GF ID   DNAPolymera_Pol
#=GF AC   PF11590.3
#=GF DE   DNA polymerase catalytic subunit Pol
#=GF AU   Pollington J
#=GF SE   pdb_1dml
#=GF GA   20.00 20.00;
#=GF TC   21.90 34.10;
#=GF NC   19.90 19.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10882068
#=GF RT   The crystal structure of an unusual processivity factor, herpes
#=GF RT   simplex virus UL42, bound to the C terminus of its cognate
#=GF RT   polymerase. 
#=GF RA   Zuccola HJ, Filman DJ, Coen DM, Hogle JM; 
#=GF RL   Mol Cell 2000;5:267-278.
#=GF DR   INTERPRO; IPR021639;
#=GF CC   This family of proteins represents the catalytic subunit, Pol,
#=GF CC   of the Herpes simplex virus DNA polymerase. Pol binds UL42,
#=GF CC   making up the DNA polymerase. UL42 is a processivity subunit
#=GF CC   which binds to the C-terminal of Pol in a similar way that the
#=GF CC   cell cycle regulator p21 binds to PCNA [1].
#=GF SQ   108
#=GS DPOL_HHV1A/1200-1235    AC P07917.1
#=GS DPOL_HHV1A/1200-1235    DR PDB; 1DML H; 1200-1235;
#=GS DPOL_HHV1A/1200-1235    DR PDB; 1DML D; 1200-1235;
#=GS DPOL_HHV1A/1200-1235    DR PDB; 1DML B; 1200-1235;
#=GS DPOL_HHV1A/1200-1235    DR PDB; 1DML F; 1200-1235;
#=GS E1B1Z0_HHV1/1200-1235   AC E1B1Z0.1
#=GS E1B1V8_HHV2/1209-1244   AC E1B1V8.1
#=GS E1B1W8_HHV2/1205-1240   AC E1B1W8.1
#=GS E1B1U4_HHV1/1200-1235   AC E1B1U4.1
#=GS E1B208_HHV2/1205-1240   AC E1B208.1
#=GS E1B1Z1_HHV1/1200-1235   AC E1B1Z1.1
#=GS Q91CQ7_HHV1/1200-1235   AC Q91CQ7.2
#=GS Q4ACM6_HHV1/1200-1235   AC Q4ACM6.1
#=GS G8H986_HHV1/1200-1235   AC G8H986.1
#=GS E1B1T8_HHV1/1200-1235   AC E1B1T8.1
#=GS F8RDC8_HHV1/1200-1235   AC F8RDC8.1
#=GS G8H916_HHV1/1200-1235   AC G8H916.1
#=GS E2IUD9_SHV1/1206-1241   AC E2IUD9.1
#=GS Q5Y0S2_9ALPH/1191-1226  AC Q5Y0S2.1
#=GS G8H8F2_HHV1/1200-1235   AC G8H8F2.1
#=GS E1B1X6_HHV2/1205-1240   AC E1B1X6.1
#=GS F8TC24_9ALPH/1165-1205  AC F8TC24.1
#=GS DPOL_HHV1K/1200-1235    AC P04292.1
#=GS Q782R4_9ALPH/1144-1184  AC Q782R4.1
#=GS D3YP94_HHV1/1200-1235   AC D3YP94.1
#=GS Q91H17_HHV2/1205-1240   AC Q91H17.1
#=GS E1B204_HHV2/1205-1240   AC E1B204.1
#=GS E1B1V9_HHV2/1201-1236   AC E1B1V9.1
#=GS Q91CM2_HHV1/1200-1235   AC Q91CM2.1
#=GS Q9WSY3_9ALPH/1144-1184  AC Q9WSY3.1
#=GS DPOL_HHV2H/1205-1240    AC P89453.1
#=GS G8HBE4_HHV1/1200-1235   AC G8HBE4.1
#=GS E1B1Y8_HHV1/1200-1235   AC E1B1Y8.1
#=GS Q6R5V7_9ALPH/1174-1214  AC Q6R5V7.1
#=GS Q19BB9_9ALPH/1174-1214  AC Q19BB9.1
#=GS DPOL_HHV21/1205-1240    AC P07918.1
#=GS E1B1V6_HHV2/1205-1240   AC E1B1V6.1
#=GS E1B212_HHV2/1205-1240   AC E1B212.1
#=GS E1B1Z2_HHV1/1200-1235   AC E1B1Z2.1
#=GS E1B1X5_HHV2/1199-1234   AC E1B1X5.1
#=GS E1B1U1_HHV1/1200-1235   AC E1B1U1.1
#=GS F8RDK4_HHV1/1200-1235   AC F8RDK4.1
#=GS E1B1V1_HHV1/1200-1235   AC E1B1V1.1
#=GS E1B1Z4_HHV1/1200-1235   AC E1B1Z4.1
#=GS E1B1U0_HHV1/1200-1235   AC E1B1U0.1
#=GS F8RD51_HHV1/1200-1235   AC F8RD51.1
#=GS E1B206_HHV2/1201-1236   AC E1B206.1
#=GS E1B1W4_HHV2/1205-1240   AC E1B1W4.1
#=GS E1B1X4_HHV2/1205-1240   AC E1B1X4.1
#=GS Q9QEL0_9ALPH/1176-1211  AC Q9QEL0.1
#=GS DPOL_GAHVM/1174-1214    AC Q9E6N9.1
#=GS E1B214_HHV1/1200-1235   AC E1B214.1
#=GS E1B1U9_HHV1/1200-1235   AC E1B1U9.1
#=GS E1B211_HHV2/1205-1240   AC E1B211.1
#=GS A8DNQ9_9ALPH/1044-1084  AC A8DNQ9.1
#=GS E1B1Y9_HHV1/1200-1235   AC E1B1Y9.1
#=GS E1B1W2_HHV2/1205-1240   AC E1B1W2.1
#=GS E1B210_HHV2/1205-1240   AC E1B210.1
#=GS F8RCF8_HHV1/1200-1235   AC F8RCF8.1
#=GS E1B1X1_HHV2/1205-1240   AC E1B1X1.1
#=GS E1B1X2_HHV2/1209-1244   AC E1B1X2.1
#=GS D3YPI8_HHV1/1200-1235   AC D3YPI8.1
#=GS G8H882_HHV1/1200-1235   AC G8H882.1
#=GS Q9E1G2_MEHV1/1159-1199  AC Q9E1G2.1
#=GS G8H8M1_HHV1/1200-1235   AC G8H8M1.1
#=GS H9E937_HHV1/1200-1235   AC H9E937.1
#=GS G9CUD9_9ALPH/1174-1214  AC G9CUD9.1
#=GS Q91H18_HHV2/1205-1240   AC Q91H18.1
#=GS Q697J3_9ALPH/1175-1213  AC Q697J3.1
#=GS DPOL_HHV11/1200-1235    AC P04293.2
#=GS F8RF38_HHV1/1200-1235   AC F8RF38.1
#=GS F8REW4_HHV1/1200-1235   AC F8REW4.1
#=GS Q5GFN4_CHV1/1169-1204   AC Q5GFN4.1
#=GS F8RCP7_HHV1/1200-1235   AC F8RCP7.1
#=GS E1B1Y5_HHV1/1200-1235   AC E1B1Y5.1
#=GS Q4ACM5_HHV1/1200-1235   AC Q4ACM5.1
#=GS E1B1V0_HHV1/1200-1235   AC E1B1V0.1
#=GS E1B201_HHV2/1205-1240   AC E1B201.1
#=GS E1B1U3_HHV1/1200-1235   AC E1B1U3.1
#=GS E1B1U2_HHV1/1200-1235   AC E1B1U2.1
#=GS Q9DPQ7_MEHV1/1159-1199  AC Q9DPQ7.1
#=GS E1B1W9_HHV2/1203-1238   AC E1B1W9.1
#=GS Q2QBE6_CHV16/1207-1242  AC Q2QBE6.1
#=GS E1B1V2_HHV1/1200-1235   AC E1B1V2.1
#=GS E1B1X9_HHV2/1205-1240   AC E1B1X9.1
#=GS E1B1W1_HHV2/1205-1240   AC E1B1W1.1
#=GS DPOL_HHV1S/1200-1235    AC P09854.1
#=GS Q4ACM7_HHV1/1200-1235   AC Q4ACM7.1
#=GS E1B202_HHV2/1205-1240   AC E1B202.1
#=GS E1B1V7_HHV2/1201-1236   AC E1B1V7.1
#=GS Q805Z8_CHV1/1212-1247   AC Q805Z8.1
#=GS G8H8U3_HHV1/1200-1235   AC G8H8U3.1
#=GS E1B1X0_HHV2/1205-1240   AC E1B1X0.1
#=GS Q4ACM2_HHV1/1200-1235   AC Q4ACM2.1
#=GS E1B1V5_HHV2/1205-1240   AC E1B1V5.1
#=GS Q9QMA5_9ALPH/108-148    AC Q9QMA5.1
#=GS A7Y7F8_9ALPH/99-139     AC A7Y7F8.1
#=GS F8RE08_HHV1/1200-1235   AC F8RE08.1
#=GS E1B1U5_HHV1/1200-1235   AC E1B1U5.1
#=GS E1B205_HHV2/1203-1238   AC E1B205.1
#=GS B2ZUN5_HHV1/1200-1235   AC B2ZUN5.1
#=GS E1B1W3_HHV2/1205-1240   AC E1B1W3.1
#=GS E1B1T9_HHV1/1200-1235   AC E1B1T9.1
#=GS G8H5G6_HHV1/1200-1235   AC G8H5G6.1
#=GS E1B1X7_HHV2/1202-1237   AC E1B1X7.1
#=GS E1B1U8_HHV1/1200-1235   AC E1B1U8.1
#=GS E1B1Y7_HHV1/1200-1235   AC E1B1Y7.1
#=GS A2TIW3_9ALPH/1160-1200  AC A2TIW3.1
#=GS Q9IBU5_9ALPH/1172-1212  AC Q9IBU5.1
#=GS E1B209_HHV2/1205-1240   AC E1B209.1
#=GS Q4ACM4_HHV1/1200-1235   AC Q4ACM4.1
#=GS Q91CQ6_HHV1/1200-1235   AC Q91CQ6.2
DPOL_HHV1A/1200-1235               .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
#=GR DPOL_HHV1A/1200-1235    SS    .-HHHHHHHHTT-EEECTTS------HHHHHHHHHHHHHHH-
E1B1Z0_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHIAFDTLA
E1B1V8_HHV2/1209-1244              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1W8_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1U4_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B208_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1Z1_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q91CQ7_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q4ACM6_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
G8H986_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1T8_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
F8RDC8_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
G8H916_HHV1/1200-1235              .DDVTARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E2IUD9_SHV1/1206-1241              a-ELAARMRAAGFAQIGAGS-----TGVDTHRRLRTAFDILA
Q5Y0S2_9ALPH/1191-1226             .EETAVRLRSAGFRAAGAGV-----TEAETRQRLRTAFDTLA
G8H8F2_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X6_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
F8TC24_9ALPH/1165-1205             r-AYATRVARAVFAEIRSGAGLSSSEEEETLQRLNRAFRILT
DPOL_HHV1K/1200-1235               .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q782R4_9ALPH/1144-1184             r-AYATRVARAVFAEIRSGAGLSSSEEEETLQRLNRAFRILT
D3YP94_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q91H17_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B204_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1V9_HHV2/1201-1236              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q91CM2_HHV1/1200-1235              .DDVTARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q9WSY3_9ALPH/1144-1184             r-AYATRVARAVFAEIRSGAGLSSSEEEETLQRLNRAFRILT
DPOL_HHV2H/1205-1240               .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
G8HBE4_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1Y8_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q6R5V7_9ALPH/1174-1214             .CSYTERVSSEMFTTIRSGIGLQVNEEEETRRKLNIAFRILT
Q19BB9_9ALPH/1174-1214             .CSYTERVSSEMFTTIRSGIGLQVNEEEETRRKLNIAFRILT
DPOL_HHV21/1205-1240               .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1V6_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B212_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1Z2_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X5_HHV2/1199-1234              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1U1_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
F8RDK4_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1V1_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1Z4_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1U0_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
F8RD51_HHV1/1200-1235              .DDVATRLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B206_HHV2/1201-1236              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1W4_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1X4_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q9QEL0_9ALPH/1176-1211             p-VTAARLSRAGFAVVGAGA-----TEEETRQRLRTAFDTLA
DPOL_GAHVM/1174-1214               .CSYTERVSSEMFTTIRSGIGLQVNEEEETRRKLNIAFRILT
E1B214_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1U9_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B211_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
A8DNQ9_9ALPH/1044-1084             .DETAALLSSAGFAEVRLYPGMPLSEEEENRQKLRRAFDILA
E1B1Y9_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1W2_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B210_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
F8RCF8_HHV1/1200-1235              .DDVATRLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X1_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1X2_HHV2/1209-1244              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
D3YPI8_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
G8H882_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q9E1G2_MEHV1/1159-1199             .MDCAERLPSAIFTTIKSGAGVPVNEEEENHRKLRKAFRILT
G8H8M1_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
H9E937_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
G9CUD9_9ALPH/1174-1214             .CSYTERVSSEMFTTIRSGIGLQVNEEEETRRKLNIAFRILT
Q91H18_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q697J3_9ALPH/1175-1213             .EEVRERLVRAGFDVLTFPE--TSVMEEENLQKLSTAFCILA
DPOL_HHV11/1200-1235               .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
F8RF38_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
F8REW4_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q5GFN4_CHV1/1169-1204              .EETAIRLRGAGFRAAGAGA-----TEEETRQRLRRAFDTLA
F8RCP7_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1Y5_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q4ACM5_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1V0_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B201_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1U3_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1U2_HHV1/1200-1235              .DDVTARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q9DPQ7_MEHV1/1159-1199             .MDCAERLPSAIFTTIKSGAGVPVNEEEENHRKLRKAFRILT
E1B1W9_HHV2/1203-1238              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q2QBE6_CHV16/1207-1242             .EETAVRLRAAGFRAAGAGA-----TEAETRRRLRTAFDTLA
E1B1V2_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X9_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1W1_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
DPOL_HHV1S/1200-1235               .DDVTARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q4ACM7_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B202_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1V7_HHV2/1201-1236              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q805Z8_CHV1/1212-1247              .EETAIRLRGAGFRAAGAGA-----TEEETRQRLRRAFDTLA
G8H8U3_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X0_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q4ACM2_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1V5_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q9QMA5_9ALPH/108-148               .DETAALLSSAGFAEVRLYPGMPLSEEEENRQKLRRAFDILA
A7Y7F8_9ALPH/99-139                .DETAALLSSAGFAEVRLYPGMPLSEEEENRQKLRRAFDILA
F8RE08_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1U5_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B205_HHV2/1203-1238              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
B2ZUN5_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1W3_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1T9_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
G8H5G6_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1X7_HHV2/1202-1237              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
E1B1U8_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
E1B1Y7_HHV1/1200-1235              .DDVAARLRTAGFGAVGAGA-----TAEETRRMLHRAFDTLA
A2TIW3_9ALPH/1160-1200             .DETAALLSSAGFAEVRLYPGMPLSEEEENRQKLRRAFDILA
Q9IBU5_9ALPH/1172-1212             d-VVTRNVSSEMFTTIRNGIGLQVNEEEETRRKLNIAFRILT
E1B209_HHV2/1205-1240              .DDVAARLRAAGFGPAGAGA-----TAEETRRMLHRAFDTLA
Q4ACM4_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
Q91CQ6_HHV1/1200-1235              .DDVAARLRAAGFGAVGAGA-----TAEETRRMLHRAFDTLA
#=GC SS_cons                       .-HHHHHHHHTT-EEECTTS------HHHHHHHHHHHHHHH-
#=GC seq_cons                      .DDVAARLRAAGFGslGAGA.....TAEETRRMLHRAFDTLA
//
DBGET integrated database retrieval system