
Database: Pfam
Entry: DNA_pol_viral_N
LinkDB: DNA_pol_viral_N
Original site: DNA_pol_viral_N 
#=GF ID   DNA_pol_viral_N
#=GF AC   PF00242.13
#=GF DE   DNA polymerase (viral) N-terminal domain
#=GF AU   Finn RD
#=GF SE   Pfam-B_107 (release 1.0)
#=GF GA   29.90 29.90;
#=GF TC   30.70 30.20;
#=GF NC   29.10 28.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR000201;
#=GF SQ   7493
#=GS S5ZLK5_HBV/1-341      AC S5ZLK5.1
#=GS G1E821_HBV/1-341      AC G1E821.1
#=GS G0YVM7_HBV/1-341      AC G0YVM7.1
#=GS X4YHX0_HBV/50-111     AC X4YHX0.1
#=GS S5ZL85_HBV/1-341      AC S5ZL85.1
#=GS W8P7I9_HBV/1-352      AC W8P7I9.1
#=GS K4PYJ3_HBV/1-172      AC K4PYJ3.1
#=GS I0C8P3_HBV/1-341      AC I0C8P3.1
#=GS D6QVX0_HBV/1-352      AC D6QVX0.1
#=GS S5ZFQ7_HBV/1-337      AC S5ZFQ7.1
#=GS B5TXX4_HBV/1-352      AC B5TXX4.1
#=GS D3TJE1_HBV/211-306    AC D3TJE1.1
#=GS S6A6X9_HBV/1-284      AC S6A6X9.1
#=GS K7QGS2_HBV/1-352      AC K7QGS2.1
#=GS L0HC78_HBV/1-252      AC L0HC78.1
#=GS Q00KA8_HBV/1-352      AC Q00KA8.1
#=GS L0HAA9_HBV/1-352      AC L0HAA9.1
#=GS C7DN49_HBV/1-351      AC C7DN49.1
#=GS G1E801_HBV/1-341      AC G1E801.1
#=GS B0YGJ4_HBV/1-341      AC B0YGJ4.1
#=GS S6A032_HBV/1-341      AC S6A032.1
#=GS C1K1Y1_HBV/1-337      AC C1K1Y1.1
#=GS V5JE40_HBV/1-329      AC V5JE40.1
#=GS D2JN10_HBV/1-117      AC D2JN10.1
#=GS B8PTB7_HBV/1-341      AC B8PTB7.1
#=GS O71306_9HEPA/109-391  AC O71306.1
#=GS B3V8W2_HBV/1-337      AC B3V8W2.1
#=GS B0FCQ1_HBV/1-352      AC B0FCQ1.1
#=GS X4ZD45_HBV/1-352      AC X4ZD45.1
#=GS I0DE24_HBV/1-328      AC I0DE24.1
#=GS D4QGJ3_HBV/1-352      AC D4QGJ3.2
#=GS I0DCX8_HBV/1-328      AC I0DCX8.1
#=GS Q4FD45_HBV/1-352      AC Q4FD45.1
#=GS Q70B80_HBV/2-103      AC Q70B80.1
#=GS D0E6G4_HBV/1-352      AC D0E6G4.1
#=GS H9BE04_HBV/1-351      AC H9BE04.1
#=GS F5C1A3_HBV/1-354      AC F5C1A3.1
#=GS R9Q8J5_HBV/1-114      AC R9Q8J5.1
#=GS S6A6U6_HBV/1-340      AC S6A6U6.1
#=GS D3YGJ8_HBV/1-327      AC D3YGJ8.1
#=GS H9XRG9_HBV/1-91       AC H9XRG9.1
#=GS Q6QZQ7_9HEPA/64-220   AC Q6QZQ7.1
#=GS F5C0S4_HBV/1-333      AC F5C0S4.1
#=GS B5BPN7_HBV/1-337      AC B5BPN7.1
#=GS DPOL_HBVB3/1-352      AC Q9QAB8.1
#=GS C7DMF8_HBV/1-351      AC C7DMF8.1
#=GS H9XQZ9_HBV/1-91       AC H9XQZ9.1
#=GS L0HCU7_HBV/1-352      AC L0HCU7.1
#=GS Q81131_HBV/1-352      AC Q81131.1
#=GS I0C8T8_HBV/1-341      AC I0C8T8.1
#=GS I0C941_HBV/1-354      AC I0C941.1
#=GS B9VAY1_HBV/219-283    AC B9VAY1.1
#=GS C7DM38_HBV/1-351      AC C7DM38.1
#=GS Q6Y5I1_HBV/1-352      AC Q6Y5I1.1
#=GS I0C913_HBV/1-354      AC I0C913.1
#=GS D0E588_HBV/1-352      AC D0E588.1
#=GS E5RPR7_HBV/1-343      AC E5RPR7.1
#=GS D0E5R1_HBV/1-352      AC D0E5R1.1
#=GS W8PRM8_HBV/1-352      AC W8PRM8.1
#=GS Q4FDM2_HBV/1-352      AC Q4FDM2.1
#=GS I0DDW1_HBV/190-226    AC I0DDW1.1
#=GS I0C8I7_HBV/1-350      AC I0C8I7.1
#=GS B5M550_HBV/1-341      AC B5M550.1
#=GS Q19SZ4_HBV/1-340      AC Q19SZ4.1
#=GS U3RCE3_HBV/1-218      AC U3RCE3.1
#=GS I0DC78_HBV/1-321      AC I0DC78.1
#=GS G9BNK2_HBV/1-293      AC G9BNK2.1
#=GS A9CM78_HBV/1-352      AC A9CM78.1
#=GS D6QVI3_HBV/1-352      AC D6QVI3.1
#=GS I0DGF4_HBV/1-352      AC I0DGF4.1
#=GS I0DCS0_HBV/1-328      AC I0DCS0.1
#=GS D0UE49_HBV/1-352      AC D0UE49.1
#=GS A9CM53_HBV/1-352      AC A9CM53.1
#=GS R9Q864_HBV/1-114      AC R9Q864.1
#=GS A6MG56_HBV/1-352      AC A6MG56.1
#=GS D0UE67_HBV/1-352      AC D0UE67.1
#=GS I1UYW0_HBV/1-166      AC I1UYW0.1
#=GS S5ZT61_HBV/1-352      AC S5ZT61.1
#=GS Q9IF27_HBV/1-352      AC Q9IF27.1
#=GS H6UG83_HBV/1-341      AC H6UG83.1
#=GS B9VKB4_HBV/1-352      AC B9VKB4.1
#=GS C3W494_HBV/1-232      AC C3W494.1
#=GS B5M5P6_HBV/1-352      AC B5M5P6.1
#=GS I0C9C8_HBV/1-334      AC I0C9C8.1
#=GS F5C149_HBV/1-354      AC F5C149.1
#=GS C3W3Z1_HBV/1-343      AC C3W3Z1.1
#=GS A7L372_HBV/1-30       AC A7L372.1
#=GS S5ZZZ1_HBV/1-341      AC S5ZZZ1.1
#=GS B7TU32_HBV/1-352      AC B7TU32.1
#=GS O42041_HBV/1-352      AC O42041.1
#=GS Q6XGP8_HBV/1-354      AC Q6XGP8.1
#=GS G4XI26_HBV/1-160      AC G4XI26.1
#=GS D6QVG9_HBV/1-352      AC D6QVG9.1
#=GS D0UDT4_HBV/1-352      AC D0UDT4.1
#=GS B5ASU7_HBV/1-352      AC B5ASU7.1
#=GS S5ZEF4_HBV/221-279    AC S5ZEF4.1
#=GS B2CY29_HBV/1-352      AC B2CY29.1
#=GS D3TJC3_HBV/1-219      AC D3TJC3.1
#=GS D7NL90_HBV/1-341      AC D7NL90.1
#=GS L8EC24_HBV/1-272      AC L8EC24.1
#=GS W6HWH8_HBV/1-315      AC W6HWH8.1
#=GS B7TTI7_HBV/1-352      AC B7TTI7.1
#=GS D5LEL7_HBV/1-352      AC D5LEL7.1
#=GS X4YRT2_HBV/1-352      AC X4YRT2.1
#=GS L0H7M1_HBV/1-352      AC L0H7M1.1
#=GS G9G9Q7_HBV/1-341      AC G9G9Q7.1
#=GS X4ZED6_HBV/1-352      AC X4ZED6.1
#=GS B2LWD3_HBV/1-347      AC B2LWD3.1
#=GS C7DMW6_HBV/1-351      AC C7DMW6.1
#=GS F5C1B3_HBV/1-75       AC F5C1B3.1
#=GS I0C9G3_HBV/1-352      AC I0C9G3.1
#=GS D5LC35_HBV/1-352      AC D5LC35.1
#=GS H6UN09_HBV/1-341      AC H6UN09.1
#=GS D3TJB1_HBV/1-352      AC D3TJB1.1
#=GS H6UGB7_HBV/1-341      AC H6UGB7.1
#=GS G9G970_HBV/1-341      AC G9G970.1
#=GS K0F4X6_HBV/1-352      AC K0F4X6.1
#=GS X4ZET7_HBV/236-291    AC X4ZET7.1
#=GS B4YKK2_HBV/1-341      AC B4YKK2.1
#=GS D2JMM3_HBV/1-352      AC D2JMM3.1
#=GS C7AYV9_HBV/1-354      AC C7AYV9.1
#=GS B9VK86_HBV/1-352      AC B9VK86.1
#=GS Q19SW8_HBV/1-341      AC Q19SW8.1
#=GS Q80H42_HBV/1-352      AC Q80H42.1
#=GS D0UE58_HBV/1-345      AC D0UE58.1
#=GS Q68RN1_HBV/1-352      AC Q68RN1.1
#=GS H6WFM8_HBV/1-112      AC H6WFM8.1
#=GS D0UDQ9_HBV/1-352      AC D0UDQ9.1
#=GS I0DD17_HBV/1-326      AC I0DD17.1
#=GS Q6RSF7_9HEPA/65-385   AC Q6RSF7.1
#=GS H6WF62_HBV/1-112      AC H6WF62.1
#=GS I0C8T7_HBV/1-341      AC I0C8T7.1
#=GS C6F562_HBV/1-354      AC C6F562.1
#=GS S5ZZY5_HBV/1-338      AC S5ZZY5.1
#=GS Q2LCF2_HBV/1-341      AC Q2LCF2.1
#=GS A4F517_HBV/1-239      AC A4F517.1
#=GS Q05HA3_HBV/1-340      AC Q05HA3.1
#=GS E9RGW9_HBV/1-341      AC E9RGW9.1
#=GS DPOL_HBVB7/1-352      AC Q9QBF1.1
#=GS S5ZZU3_HBV/1-340      AC S5ZZU3.1
#=GS H6UN05_HBV/1-341      AC H6UN05.1
#=GS B7TV09_HBV/1-352      AC B7TV09.1
#=GS Q20BX1_HBV/1-55       AC Q20BX1.1
#=GS A5JIH1_HBV/1-112      AC A5JIH1.1
#=GS S5ZED0_HBV/1-318      AC S5ZED0.1
#=GS X4ZFB5_HBV/1-352      AC X4ZFB5.1
#=GS B5M5B4_HBV/1-352      AC B5M5B4.1
#=GS F5C199_HBV/1-354      AC F5C199.1
#=GS I0DGI8_HBV/1-352      AC I0DGI8.1
#=GS D8V9Z2_HBV/44-150     AC D8V9Z2.1
#=GS B9VK82_HBV/1-352      AC B9VK82.1
#=GS S5ZZR8_HBV/1-337      AC S5ZZR8.1
#=GS I7JHT9_HBV/1-354      AC I7JHT9.1
#=GS G1C8Q1_HBV/1-341      AC G1C8Q1.1
#=GS I6XQJ8_HBV/1-352      AC I6XQJ8.1
#=GS Q8QMM4_HBV/1-342      AC Q8QMM4.1
#=GS D5LEA7_HBV/1-352      AC D5LEA7.1
#=GS Q1JUR4_HBV/1-340      AC Q1JUR4.1
#=GS W0NTS1_HBV/1-341      AC W0NTS1.1
#=GS E5F0X3_HBV/1-49       AC E5F0X3.1
#=GS R9Q8L8_HBV/1-97       AC R9Q8L8.1
#=GS H9XQM1_HBV/1-91       AC H9XQM1.1
#=GS A0MML8_HBV/1-352      AC A0MML8.1
#=GS B9VKL5_HBV/1-352      AC B9VKL5.1
#=GS B5A2F0_HBV/1-352      AC B5A2F0.1
#=GS E5F0Y0_HBV/1-49       AC E5F0Y0.1
#=GS S5ZFC1_HBV/1-336      AC S5ZFC1.1
#=GS A8IES5_HBV/1-52       AC A8IES5.1
#=GS X4Z0M4_HBV/1-352      AC X4Z0M4.1
#=GS G4XMP7_HBV/1-352      AC G4XMP7.1
#=GS H9XR98_HBV/1-91       AC H9XR98.1
#=GS A5JI87_HBV/1-112      AC A5JI87.1
#=GS L0BEA4_HBV/1-210      AC L0BEA4.1
#=GS C6F4Z4_HBV/1-354      AC C6F4Z4.1
#=GS D3TIJ9_HBV/284-316    AC D3TIJ9.1
#=GS B0FC59_HBV/1-352      AC B0FC59.1
#=GS L0BDI7_HBV/1-210      AC L0BDI7.1
#=GS R4NVI8_HBV/1-352      AC R4NVI8.1
#=GS B7TTT0_HBV/1-352      AC B7TTT0.1
#=GS D0E5C5_HBV/1-352      AC D0E5C5.1
#=GS Q1HHA7_HBV/1-334      AC Q1HHA7.1
#=GS Q6RSG7_9HEPA/65-236   AC Q6RSG7.1
#=GS I0C894_HBV/1-354      AC I0C894.1
#=GS D3TJA4_HBV/1-352      AC D3TJA4.1
#=GS D6QVK8_HBV/1-352      AC D6QVK8.1
#=GS L7PDC4_HBV/1-352      AC L7PDC4.1
#=GS A0FDU8_HBV/187-317    AC A0FDU8.1
#=GS C3W3W6_HBV/1-341      AC C3W3W6.1
#=GS G4XHW7_HBV/1-160      AC G4XHW7.1
#=GS H9XR90_HBV/1-91       AC H9XR90.1
#=GS Q9IF49_HBV/1-172      AC Q9IF49.1
#=GS B3GED9_HBV/1-33       AC B3GED9.1
#=GS H1ACV2_HBV/1-352      AC H1ACV2.1
#=GS E5RD97_HBV/1-341      AC E5RD97.1
#=GS D0EDS2_HBV/1-330      AC D0EDS2.1
#=GS A0A023NLD3_HBV/1-341  AC A0A023NLD3.1
#=GS DPOL_HBVE4/1-351      AC Q80IU4.1
#=GS G9BNK2_HBV/292-323    AC G9BNK2.1
#=GS Q91C56_HBV/1-343      AC Q91C56.1
#=GS C5WJY2_HBV/1-352      AC C5WJY2.1
#=GS B9VKJ2_HBV/1-274      AC B9VKJ2.1
#=GS Q5UFT1_HBV/1-341      AC Q5UFT1.1
#=GS B9VK19_HBV/1-352      AC B9VK19.1
#=GS B2Y6Y1_HBV/1-341      AC B2Y6Y1.1
#=GS E5F0Y3_HBV/1-46       AC E5F0Y3.1
#=GS F1AEV3_HBV/1-351      AC F1AEV3.1
#=GS C9WDE3_HBV/1-341      AC C9WDE3.1
#=GS G9G9T1_HBV/1-274      AC G9G9T1.1
#=GS S5ZSJ0_HBV/1-340      AC S5ZSJ0.1
#=GS B7TU51_HBV/1-352      AC B7TU51.1
#=GS C7AYU1_HBV/1-354      AC C7AYU1.1
#=GS E0D2T3_HBV/1-354      AC E0D2T3.1
#=GS H1ACY0_HBV/1-352      AC H1ACY0.1
#=GS L0BC82_HBV/1-210      AC L0BC82.1
#=GS Q5R2Q3_HBV/1-341      AC Q5R2Q3.1
#=GS R4NTV7_HBV/1-352      AC R4NTV7.1
#=GS Q91EI0_HBV/1-354      AC Q91EI0.1
#=GS B2LSL6_HBV/1-352      AC B2LSL6.1
#=GS B7TUL7_HBV/1-352      AC B7TUL7.1
#=GS M1G264_9HEPA/77-381   AC M1G264.1
#=GS A9QPW2_HBV/1-351      AC A9QPW2.1
#=GS Q3ZKJ4_HBV/1-351      AC Q3ZKJ4.1
#=GS I0C985_HBV/1-351      AC I0C985.1
#=GS G4XMF5_HBV/1-352      AC G4XMF5.1
#=GS I0C8V9_HBV/1-354      AC I0C8V9.1
#=GS I0DCP2_HBV/1-328      AC I0DCP2.1
#=GS F1AET9_HBV/1-354      AC F1AET9.1
#=GS S5ZDW4_HBV/1-340      AC S5ZDW4.1
#=GS S6A029_HBV/1-336      AC S6A029.1
#=GS M9PN08_HBV/1-22       AC M9PN08.1
#=GS S5ZLP4_HBV/1-337      AC S5ZLP4.1
#=GS H6WFD0_HBV/1-112      AC H6WFD0.1
#=GS B2CSC6_HBV/1-352      AC B2CSC6.1
#=GS S6A716_HBV/1-340      AC S6A716.1
#=GS K0FGW6_HBV/1-352      AC K0FGW6.1
#=GS G4XI63_HBV/1-160      AC G4XI63.1
#=GS Q20BV7_HBV/1-57       AC Q20BV7.1
#=GS F5C0M5_HBV/1-354      AC F5C0M5.1
#=GS G1E7E7_HBV/1-252      AC G1E7E7.1
#=GS C1K205_HBV/1-342      AC C1K205.1
#=GS B5M5J0_HBV/1-352      AC B5M5J0.1
#=GS V5JE52_HBV/1-342      AC V5JE52.1
#=GS DPOL_HBVD5/1-341      AC P0C679.1
#=GS Q00K60_HBV/1-352      AC Q00K60.1
#=GS G1E8Q2_HBV/1-341      AC G1E8Q2.1
#=GS I0C8S3_HBV/1-341      AC I0C8S3.1
#=GS L7R7I2_HBV/1-341      AC L7R7I2.1
#=GS A5LG34_HBV/1-352      AC A5LG34.1
#=GS B0FC31_HBV/1-352      AC B0FC31.1
#=GS I0DE20_HBV/1-328      AC I0DE20.1
#=GS M9PMV2_HBV/1-49       AC M9PMV2.1
#=GS B5M560_HBV/1-352      AC B5M560.1
#=GS D5MSI1_HBV/1-343      AC D5MSI1.1
#=GS B5BPT8_HBV/1-352      AC B5BPT8.1
#=GS I0C8F2_HBV/1-354      AC I0C8F2.1
#=GS E5RD93_HBV/1-352      AC E5RD93.1
#=GS Q75TL6_HBV/1-341      AC Q75TL6.1
#=GS G1E842_HBV/1-341      AC G1E842.1
#=GS B9VKT9_HBV/1-352      AC B9VKT9.1
#=GS G4XHZ6_HBV/1-160      AC G4XHZ6.1
#=GS G4XI80_HBV/1-54       AC G4XI80.1
#=GS I0C8F5_HBV/1-354      AC I0C8F5.1
#=GS F5C1A6_HBV/1-354      AC F5C1A6.1
#=GS B5TFG5_HBV/1-112      AC B5TFG5.1
#=GS I0C9G1_HBV/1-352      AC I0C9G1.1
#=GS S5ZEK4_HBV/1-342      AC S5ZEK4.1
#=GS I0DD97_HBV/1-328      AC I0DD97.1
#=GS Q1PCY0_HBV/1-352      AC Q1PCY0.1
#=GS C5WK02_HBV/1-352      AC C5WK02.1
#=GS B7TV41_HBV/1-352      AC B7TV41.1
#=GS D0E698_HBV/1-352      AC D0E698.1
#=GS I1UYR5_HBV/1-166      AC I1UYR5.1
#=GS Q8V1J2_HBV/1-352      AC Q8V1J2.1
#=GS D0U3Y5_HBV/1-354      AC D0U3Y5.1
#=GS G1E8A7_HBV/1-341      AC G1E8A7.1
#=GS B9VL41_HBV/1-242      AC B9VL41.1
#=GS Q6XGT3_HBV/1-354      AC Q6XGT3.1
#=GS M1G266_9HEPA/70-376   AC M1G266.1
#=GS Q81110_HBV/267-401    AC Q81110.1
#=GS B7TUK6_HBV/1-352      AC B7TUK6.1
#=GS B5M5W6_HBV/1-352      AC B5M5W6.1
#=GS F5C178_HBV/1-354      AC F5C178.1
#=GS A5JIK3_HBV/1-112      AC A5JIK3.1
#=GS Q461A0_HBV/1-351      AC Q461A0.1
#=GS A5JI17_HBV/1-112      AC A5JI17.1
#=GS S5ZSM9_HBV/1-342      AC S5ZSM9.1
#=GS Q7TDS4_HBV/1-340      AC Q7TDS4.1
#=GS I0C978_HBV/1-354      AC I0C978.1
#=GS I0C8T2_HBV/1-341      AC I0C8T2.1
#=GS D6QVH6_HBV/1-352      AC D6QVH6.1
#=GS A6MFW8_HBV/1-352      AC A6MFW8.1
#=GS K7QG44_HBV/1-352      AC K7QG44.1
#=GS A9QPV5_HBV/1-351      AC A9QPV5.1
#=GS D2U650_HBV/1-351      AC D2U650.1
#=GS I0C927_HBV/1-354      AC I0C927.1
#=GS D2X5F1_HBV/4-171      AC D2X5F1.1
#=GS D5LF64_HBV/1-352      AC D5LF64.1
#=GS I0C8B1_HBV/1-354      AC I0C8B1.1
#=GS Q765Y0_HBV/1-337      AC Q765Y0.1
#=GS H9XQL1_HBV/1-91       AC H9XQL1.1
#=GS C7DM31_HBV/1-342      AC C7DM31.1
#=GS B3IWX1_HBV/1-351      AC B3IWX1.1
#=GS Q6XGQ5_HBV/1-354      AC Q6XGQ5.1
#=GS G9G8U2_HBV/1-341      AC G9G8U2.1
#=GS B2Y6W0_HBV/1-341      AC B2Y6W0.1
#=GS S5ZZR0_HBV/1-352      AC S5ZZR0.1
#=GS F5C0Y3_HBV/1-354      AC F5C0Y3.1
#=GS Q0PMK6_HBV/1-352      AC Q0PMK6.1
#=GS I0DE16_HBV/1-317      AC I0DE16.1
#=GS K4PXS0_HBV/1-81       AC K4PXS0.1
#=GS B6CJ06_HBV/1-354      AC B6CJ06.1
#=GS E5RD17_HBV/1-352      AC E5RD17.1
#=GS Q8B4D1_HBV/1-325      AC Q8B4D1.1
#=GS S5ZZX9_HBV/1-339      AC S5ZZX9.1
#=GS D0E5V2_HBV/1-352      AC D0E5V2.1
#=GS F5C0T7_HBV/1-351      AC F5C0T7.1
#=GS A7L9Y6_HBV/1-352      AC A7L9Y6.1
#=GS I0C9D6_HBV/1-334      AC I0C9D6.1
#=GS H6UGH3_HBV/1-341      AC H6UGH3.1
#=GS B9VL60_HBV/194-323    AC B9VL60.1
#=GS D2JMK5_HBV/1-352      AC D2JMK5.1
#=GS X4YHP4_HBV/1-341      AC X4YHP4.1
#=GS C9WDK0_HBV/1-351      AC C9WDK0.1
#=GS X4Y467_HBV/1-341      AC X4Y467.1
#=GS C3W4D0_HBV/1-345      AC C3W4D0.2
#=GS Q4W611_HBV/1-352      AC Q4W611.1
#=GS A7L371_HBV/1-30       AC A7L371.1
#=GS S6A726_HBV/1-336      AC S6A726.1
#=GS S5ZT91_HBV/1-341      AC S5ZT91.1
#=GS L0BE63_HBV/1-210      AC L0BE63.1
#=GS D3YFZ1_HBV/1-341      AC D3YFZ1.1
#=GS A7YEX4_HBV/1-352      AC A7YEX4.1
#=GS G1E7G5_HBV/1-341      AC G1E7G5.1
#=GS C3W4A6_HBV/1-341      AC C3W4A6.1
#=GS C7AYS4_HBV/1-354      AC C7AYS4.1
#=GS I1UYT6_HBV/1-166      AC I1UYT6.1
#=GS Q8B3N9_9HEPA/70-376   AC Q8B3N9.1
#=GS G4XI49_HBV/1-160      AC G4XI49.1
#=GS X4ZEZ7_HBV/1-352      AC X4ZEZ7.1
#=GS C3W4C4_HBV/1-341      AC C3W4C4.1
#=GS I0DGG9_HBV/1-352      AC I0DGG9.1
#=GS L8B2J8_HBV/1-325      AC L8B2J8.1
#=GS B5TF22_HBV/1-112      AC B5TF22.1
#=GS Q4KRF5_HBV/1-354      AC Q4KRF5.1
#=GS H9XQD4_HBV/1-91       AC H9XQD4.1
#=GS Q7T4V1_HBV/1-341      AC Q7T4V1.1
#=GS Q67859_HBV/1-305      AC Q67859.1
#=GS W6HVY3_HBV/1-315      AC W6HVY3.1
#=GS D2U602_HBV/1-351      AC D2U602.1
#=GS Q2F4Y2_HBV/1-346      AC Q2F4Y2.1
#=GS G1E8G5_HBV/1-341      AC G1E8G5.1
#=GS G1E7V1_HBV/1-341      AC G1E7V1.1
#=GS I3XMP6_HBV/1-354      AC I3XMP6.1
#=GS I0DCV9_HBV/1-328      AC I0DCV9.1
#=GS B5TF93_HBV/1-112      AC B5TF93.1
#=GS L7R882_HBV/1-352      AC L7R882.1
#=GS F2WS92_HBV/1-352      AC F2WS92.1
#=GS D0EEB3_HBV/1-354      AC D0EEB3.1
#=GS B5M5Z4_HBV/1-352      AC B5M5Z4.1
#=GS I0DE12_HBV/1-328      AC I0DE12.1
#=GS Q8BC37_HBV/1-31       AC Q8BC37.1
#=GS Q1HHA3_HBV/1-341      AC Q1HHA3.1
#=GS E3Q0N4_HBV/1-352      AC E3Q0N4.1
#=GS G9G8R0_HBV/1-341      AC G9G8R0.1
#=GS I1UYS7_HBV/1-166      AC I1UYS7.1
#=GS B5M583_HBV/1-352      AC B5M583.1
#=GS I0C8V6_HBV/1-354      AC I0C8V6.1
#=GS Q20BR3_HBV/1-56       AC Q20BR3.1
#=GS O09504_HBV/1-214      AC O09504.1
#=GS E0D2U5_HBV/1-354      AC E0D2U5.1
#=GS I0DCU0_HBV/1-328      AC I0DCU0.1
#=GS Q2AC10_HBV/1-352      AC Q2AC10.1
#=GS B5TZH6_HBV/1-66       AC B5TZH6.1
#=GS H3K3H9_HBV/1-347      AC H3K3H9.1
#=GS M4QBL0_HBV/1-171      AC M4QBL0.1
#=GS D0EYX8_HBV/1-341      AC D0EYX8.1
#=GS I0DDL7_HBV/1-312      AC I0DDL7.1
#=GS I0DD21_HBV/1-328      AC I0DD21.1
#=GS F5C0X3_HBV/1-354      AC F5C0X3.1
#=GS C7AYN8_HBV/1-354      AC C7AYN8.1
#=GS L7R7U2_HBV/1-341      AC L7R7U2.1
#=GS C3W457_HBV/1-341      AC C3W457.1
#=GS D0QP41_HBV/1-352      AC D0QP41.2
#=GS Q9WP59_HBV/269-322    AC Q9WP59.1
#=GS L0BC61_HBV/1-210      AC L0BC61.1
#=GS R9Q7Y4_HBV/1-114      AC R9Q7Y4.1
#=GS I0DDQ3_HBV/1-317      AC I0DDQ3.1
#=GS G1C8L7_HBV/1-341      AC G1C8L7.1
#=GS H6V5I8_HBV/1-352      AC H6V5I8.1
#=GS H6V5R4_HBV/1-349      AC H6V5R4.1
#=GS C6F5B1_HBV/1-352      AC C6F5B1.1
#=GS I0C8B2_HBV/1-354      AC I0C8B2.1
#=GS U3KUG5_HBV/1-171      AC U3KUG5.1
#=GS B5A2I4_HBV/1-352      AC B5A2I4.1
#=GS S5ZTC5_HBV/1-335      AC S5ZTC5.1
#=GS S6A725_HBV/1-340      AC S6A725.1
#=GS L7R9J2_HBV/1-352      AC L7R9J2.1
#=GS A1ILJ8_HBV/1-352      AC A1ILJ8.1
#=GS Q404F8_HBV/1-341      AC Q404F8.1
#=GS Q91S93_HBV/1-352      AC Q91S93.1
#=GS Q8B466_HBV/2-119      AC Q8B466.1
#=GS L0HAA8_HBV/1-352      AC L0HAA8.1
#=GS G4XMG7_HBV/1-352      AC G4XMG7.1
#=GS E9L2L9_HBV/1-354      AC E9L2L9.1
#=GS B5BPI1_HBV/1-352      AC B5BPI1.1
#=GS I0DGJ4_HBV/1-352      AC I0DGJ4.1
#=GS I0DG95_HBV/1-352      AC I0DG95.1
#=GS C5WJZ4_HBV/1-352      AC C5WJZ4.1
#=GS G9G990_HBV/1-341      AC G9G990.1
#=GS Q2MLQ4_HBV/1-341      AC Q2MLQ4.1
#=GS F5C0U1_HBV/1-351      AC F5C0U1.1
#=GS I7LR95_HBV/1-354      AC I7LR95.1
#=GS S6A025_HBV/1-341      AC S6A025.1
#=GS H6WF86_HBV/1-112      AC H6WF86.1
#=GS C7AYP4_HBV/1-354      AC C7AYP4.1
#=GS H9XQI6_HBV/1-91       AC H9XQI6.1
#=GS S5ZZW6_HBV/1-340      AC S5ZZW6.1
#=GS B5M5A5_HBV/1-352      AC B5M5A5.1
#=GS D3TIN7_HBV/1-349      AC D3TIN7.1
#=GS I0C8A9_HBV/1-354      AC I0C8A9.1
#=GS H6WFM1_HBV/1-112      AC H6WFM1.1
#=GS B5MEW9_HBV/1-352      AC B5MEW9.1
#=GS E5RPT5_HBV/1-343      AC E5RPT5.1
#=GS S5ZL06_HBV/1-352      AC S5ZL06.1
#=GS X4Z0Q5_HBV/1-352      AC X4Z0Q5.1
#=GS I0DCM2_HBV/1-328      AC I0DCM2.1
#=GS F4ZCA9_HBV/1-49       AC F4ZCA9.1
#=GS D0EDY8_HBV/1-354      AC D0EDY8.1
#=GS X4YYI4_HBV/1-352      AC X4YYI4.1
#=GS T1YUR3_HBV/1-352      AC T1YUR3.1
#=GS F1AES6_HBV/1-354      AC F1AES6.1
#=GS G3XGU4_HBV/1-352      AC G3XGU4.1
#=GS G1E8N2_HBV/1-341      AC G1E8N2.1
#=GS I0C9A2_HBV/1-341      AC I0C9A2.1
#=GS B7TUD1_HBV/1-352      AC B7TUD1.1
#=GS U3KUD5_HBV/1-171      AC U3KUD5.1
#=GS Q9DH92_HBV/1-352      AC Q9DH92.1
#=GS M1G284_9HEPA/72-244   AC M1G284.1
#=GS DPOL_HBVA2/1-347      AC P03158.2
#=GS O39671_HBV/1-352      AC O39671.1
#=GS K7QG46_HBV/1-352      AC K7QG46.1
#=GS F5C197_HBV/1-354      AC F5C197.1
#=GS Q19SY2_HBV/1-341      AC Q19SY2.1
#=GS G3EQX6_HBV/1-48       AC G3EQX6.1
#=GS D3TK11_HBV/3-37       AC D3TK11.1
#=GS Q68RP0_HBV/1-352      AC Q68RP0.1
#=GS G1E7S1_HBV/1-341      AC G1E7S1.1
#=GS X4YHV9_HBV/1-352      AC X4YHV9.1
#=GS B5TFJ7_HBV/1-112      AC B5TFJ7.1
#=GS G3XGW4_HBV/1-343      AC G3XGW4.1
#=GS Q6QJC7_9HEPA/60-215   AC Q6QJC7.1
#=GS I0DE32_HBV/1-328      AC I0DE32.1
#=GS M4Q7R8_HBV/1-171      AC M4Q7R8.1
#=GS L0H7Y8_HBV/1-352      AC L0H7Y8.1
#=GS I0C8B4_HBV/1-354      AC I0C8B4.1
#=GS S5ZS72_HBV/1-341      AC S5ZS72.1
#=GS E5RPP3_HBV/1-352      AC E5RPP3.1
#=GS B3VLJ0_HBV/1-176      AC B3VLJ0.1
#=GS I0DDT7_HBV/1-328      AC I0DDT7.1
#=GS A6MG13_HBV/1-352      AC A6MG13.1
#=GS S6A6Y8_HBV/1-337      AC S6A6Y8.1
#=GS L0H892_HBV/1-352      AC L0H892.1
#=GS B6CIZ9_HBV/1-354      AC B6CIZ9.1
#=GS L0HCD4_HBV/1-352      AC L0HCD4.1
#=GS D3TKD6_HBV/1-352      AC D3TKD6.1
#=GS I0C960_HBV/1-354      AC I0C960.1
#=GS Q6R264_HBV/1-352      AC Q6R264.1
#=GS F5C0Y0_HBV/1-354      AC F5C0Y0.1
#=GS D3YGJ1_HBV/1-341      AC D3YGJ1.1
#=GS F5C189_HBV/1-354      AC F5C189.1
#=GS A9CM66_HBV/183-276    AC A9CM66.1
#=GS B7TV28_HBV/1-338      AC B7TV28.1
#=GS C7DMJ9_HBV/1-351      AC C7DMJ9.1
#=GS I0DE92_HBV/1-328      AC I0DE92.1
#=GS G4XHZ9_HBV/1-160      AC G4XHZ9.1
#=GS D0UDZ7_HBV/1-352      AC D0UDZ7.1
#=GS D0E5Q3_HBV/1-352      AC D0E5Q3.1
#=GS Q4FD49_HBV/1-352      AC Q4FD49.1
#=GS G1C8F5_HBV/1-341      AC G1C8F5.1
#=GS O91587_HBV/1-336      AC O91587.1
#=GS I1UYS4_HBV/1-166      AC I1UYS4.1
#=GS L8B1Z1_HBV/1-336      AC L8B1Z1.1
#=GS T2AZA8_HBV/1-345      AC T2AZA8.1
#=GS E5F0V9_HBV/1-49       AC E5F0V9.1
#=GS M9PNG5_HBV/1-247      AC M9PNG5.1
#=GS G4XI98_HBV/1-54       AC G4XI98.1
#=GS E9RGX5_HBV/1-341      AC E9RGX5.1
#=GS C6F576_HBV/1-354      AC C6F576.1
#=GS S5ZF89_HBV/1-350      AC S5ZF89.1
#=GS S5ZFS3_HBV/1-340      AC S5ZFS3.1
#=GS B5M5X6_HBV/1-352      AC B5M5X6.1
#=GS B0YPS7_HBV/1-354      AC B0YPS7.1
#=GS Q4FDE7_HBV/1-352      AC Q4FDE7.1
#=GS D2U678_HBV/1-351      AC D2U678.1
#=GS D5LBQ8_HBV/1-352      AC D5LBQ8.1
#=GS G3XGU8_HBV/1-352      AC G3XGU8.1
#=GS L8B2J2_HBV/1-341      AC L8B2J2.1
#=GS H9XRK4_HBV/1-91       AC H9XRK4.1
#=GS B5M525_HBV/1-346      AC B5M525.1
#=GS X4YRP6_HBV/1-352      AC X4YRP6.1
#=GS B4Y7D2_HBV/1-352      AC B4Y7D2.2
#=GS B2WSN8_HBV/1-352      AC B2WSN8.1
#=GS Q4KRA7_HBV/1-354      AC Q4KRA7.1
#=GS I0DGA5_HBV/1-352      AC I0DGA5.1
#=GS C1K1P4_HBV/1-352      AC C1K1P4.1
#=GS T1YUT4_HBV/1-352      AC T1YUT4.1
#=GS I0DGI3_HBV/1-352      AC I0DGI3.1
#=GS B5TF81_HBV/1-112      AC B5TF81.1
#=GS G3XGX4_HBV/1-343      AC G3XGX4.1
#=GS C1K1K9_HBV/1-73       AC C1K1K9.1
#=GS H6V5T4_HBV/1-352      AC H6V5T4.1
#=GS Q765V6_HBV/1-352      AC Q765V6.1
#=GS G3XLA4_HBV/1-352      AC G3XLA4.1
#=GS B2LWD9_HBV/285-317    AC B2LWD9.1
#=GS B9W3Z1_HBV/1-354      AC B9W3Z1.1
#=GS Q7THR0_HBV/1-352      AC Q7THR0.1
#=GS Q8B6N6_HBV/1-352      AC Q8B6N6.1
#=GS K4PWA6_HBV/1-172      AC K4PWA6.1
#=GS I0DDV3_HBV/1-308      AC I0DDV3.1
#=GS I0C8I8_HBV/1-335      AC I0C8I8.1
#=GS S5ZZL7_HBV/1-336      AC S5ZZL7.1
#=GS B0FD83_HBV/1-346      AC B0FD83.1
#=GS I0C8I5_HBV/1-350      AC I0C8I5.1
#=GS Q1PCY8_HBV/1-352      AC Q1PCY8.1
#=GS Q80J74_HBV/282-314    AC Q80J74.1
#=GS Q7TDR8_HBV/1-352      AC Q7TDR8.1
#=GS Q67892_HBV/1-341      AC Q67892.1
#=GS I0C8H7_HBV/1-354      AC I0C8H7.1
#=GS S5ZDX0_HBV/1-326      AC S5ZDX0.1
#=GS B5M666_HBV/1-352      AC B5M666.1
#=GS O91518_HBV/1-352      AC O91518.1
#=GS X4ZDU0_HBV/1-352      AC X4ZDU0.1
#=GS Q8JXA3_HBV/78-153     AC Q8JXA3.1
#=GS D5LFG0_HBV/1-352      AC D5LFG0.1
#=GS A7YEV5_HBV/1-352      AC A7YEV5.1
#=GS K9MDL1_HBV/1-24       AC K9MDL1.1
#=GS D0E5S5_HBV/1-352      AC D0E5S5.1
#=GS H9XQM9_HBV/1-91       AC H9XQM9.1
#=GS C7G2Z7_HBV/1-348      AC C7G2Z7.1
#=GS D0E5D7_HBV/1-352      AC D0E5D7.1
#=GS B0FD10_HBV/1-352      AC B0FD10.1
#=GS Q769H7_HBV/1-352      AC Q769H7.1
#=GS I4CJU5_HBV/1-30       AC I4CJU5.1
#=GS S5ZFQ3_HBV/1-341      AC S5ZFQ3.1
#=GS B1ABR0_HBV/1-236      AC B1ABR0.1
#=GS D0EEI3_HBV/1-354      AC D0EEI3.1
#=GS Q1JUS2_HBV/1-354      AC Q1JUS2.1
#=GS Q7T7X3_HBV/1-341      AC Q7T7X3.1
#=GS E9L5E9_HBV/1-352      AC E9L5E9.1
#=GS U3KUD0_HBV/1-171      AC U3KUD0.1
#=GS Q00K68_HBV/1-352      AC Q00K68.1
#=GS B2NI12_HBV/1-352      AC B2NI12.1
#=GS C1K185_HBV/1-352      AC C1K185.1
#=GS G1E7P0_HBV/1-341      AC G1E7P0.1
#=GS S6A6W6_HBV/1-352      AC S6A6W6.1
#=GS D3TK89_HBV/1-347      AC D3TK89.1
#=GS Q1PCX6_HBV/1-352      AC Q1PCX6.1
#=GS A5JI79_HBV/1-112      AC A5JI79.1
#=GS Q7TDR0_HBV/1-352      AC Q7TDR0.1
#=GS B5TXI1_HBV/1-352      AC B5TXI1.1
#=GS F5C0W4_HBV/1-354      AC F5C0W4.1
#=GS G4XHY6_HBV/1-160      AC G4XHY6.1
#=GS D9U5K7_HBV/1-352      AC D9U5K7.1
#=GS A0A023NJU9_HBV/1-340  AC A0A023NJU9.1
#=GS U3KUF1_HBV/1-170      AC U3KUF1.1
#=GS D0E585_HBV/1-352      AC D0E585.1
#=GS E5RPT9_HBV/1-343      AC E5RPT9.1
#=GS A6YM46_HBV/1-351      AC A6YM46.1
#=GS M9PN21_HBV/1-46       AC M9PN21.1
#=GS D2JMB6_HBV/1-352      AC D2JMB6.1
#=GS I4CJV4_HBV/1-183      AC I4CJV4.1
#=GS B5M518_HBV/1-352      AC B5M518.1
#=GS Q598R5_HBV/1-351      AC Q598R5.1
#=GS L7R8B4_HBV/1-352      AC L7R8B4.1
#=GS DPOL_HBVF3/1-352      AC Q99HS4.1
#=GS M4QBQ3_HBV/1-171      AC M4QBQ3.1
#=GS G4XIB0_HBV/1-130      AC G4XIB0.1
#=GS B1ABL4_HBV/1-238      AC B1ABL4.1
#=GS DPOL_HBVC3/1-352      AC P12933.2
#=GS H9N875_HBV/1-341      AC H9N875.1
#=GS S5ZLF7_HBV/1-337      AC S5ZLF7.1
#=GS Q00K80_HBV/1-352      AC Q00K80.1
#=GS S5ZFF6_HBV/1-350      AC S5ZFF6.1
#=GS L7R886_HBV/1-352      AC L7R886.1
#=GS Q9IR30_HBV/1-174      AC Q9IR30.1
#=GS I0C9A6_HBV/1-341      AC I0C9A6.1
#=GS H6UG53_HBV/1-341      AC H6UG53.1
#=GS E9L2R8_HBV/1-171      AC E9L2R8.1
#=GS G4XI65_HBV/1-160      AC G4XI65.1
#=GS D0E5X2_HBV/1-352      AC D0E5X2.1
#=GS DPOL_HBVH1/1-352      AC Q8JMY7.1
#=GS S5ZLI6_HBV/1-341      AC S5ZLI6.1
#=GS I0DGC2_HBV/1-352      AC I0DGC2.1
#=GS I0C879_HBV/1-354      AC I0C879.1
#=GS K4PX18_HBV/1-84       AC K4PX18.1
#=GS A0A023NKA1_HBV/1-341  AC A0A023NKA1.1
#=GS G4XIC1_HBV/1-114      AC G4XIC1.1
#=GS D3TK82_HBV/1-352      AC D3TK82.1
#=GS Q8QY53_HBV/1-352      AC Q8QY53.1
#=GS L0BE71_HBV/1-210      AC L0BE71.1
#=GS F5C113_HBV/281-320    AC F5C113.1
#=GS I7KJG9_HBV/1-352      AC I7KJG9.1
#=GS D3XGC0_HBV/1-351      AC D3XGC0.1
#=GS S6A6X4_HBV/1-329      AC S6A6X4.1
#=GS I0C8G5_HBV/1-354      AC I0C8G5.1
#=GS Q7T7V9_HBV/1-341      AC Q7T7V9.1
#=GS Q9YPU5_HBV/1-341      AC Q9YPU5.1
#=GS X4ZCZ6_HBV/1-352      AC X4ZCZ6.1
#=GS B2LWA6_HBV/1-337      AC B2LWA6.1
#=GS B0FCJ8_HBV/1-352      AC B0FCJ8.1
#=GS H6WFD4_HBV/1-112      AC H6WFD4.1
#=GS Q20C04_HBV/1-57       AC Q20C04.1
#=GS Q5KR43_HBV/1-352      AC Q5KR43.1
#=GS X4YRZ0_HBV/1-352      AC X4YRZ0.1
#=GS F5C104_HBV/1-354      AC F5C104.1
#=GS G1E8S8_HBV/1-341      AC G1E8S8.1
#=GS X4Z053_HBV/1-352      AC X4Z053.1
#=GS B4YLE4_HBV/1-341      AC B4YLE4.1
#=GS B0FCN1_HBV/1-352      AC B0FCN1.1
#=GS A5JI63_HBV/1-112      AC A5JI63.1
#=GS W6IBF8_HBV/1-315      AC W6IBF8.1
#=GS G3E5G4_HBV/1-341      AC G3E5G4.1
#=GS D9U581_HBV/1-352      AC D9U581.1
#=GS F5C106_HBV/1-354      AC F5C106.1
#=GS A8CEJ0_HBV/1-352      AC A8CEJ0.1
#=GS B5BPY6_HBV/1-352      AC B5BPY6.1
#=GS Q8QQX2_9HEPA/59-341   AC Q8QQX2.1
#=GS E0ZRS3_HBV/1-351      AC E0ZRS3.1
#=GS Q6XGW8_HBV/1-354      AC Q6XGW8.1
#=GS DPOL_HBVA3/1-354      AC P03159.1
#=GS L7R827_HBV/1-341      AC L7R827.1
#=GS D2JMZ0_HBV/1-352      AC D2JMZ0.1
#=GS E5RPP7_HBV/1-343      AC E5RPP7.1
#=GS I1UYS1_HBV/1-166      AC I1UYS1.1
#=GS X4YRV0_HBV/1-352      AC X4YRV0.1
#=GS I0C9I2_HBV/1-344      AC I0C9I2.1
#=GS Q9E9B2_HBV/1-352      AC Q9E9B2.1
#=GS B0YGK2_HBV/1-341      AC B0YGK2.1
#=GS G1E8B3_HBV/1-341      AC G1E8B3.1
#=GS M4Q861_HBV/1-171      AC M4Q861.1
#=GS K7QH03_HBV/1-352      AC K7QH03.1
#=GS S5ZSK2_HBV/1-341      AC S5ZSK2.1
#=GS H1ACV6_HBV/1-352      AC H1ACV6.1
#=GS S5ZF27_HBV/1-336      AC S5ZF27.1
#=GS G3E5F0_HBV/1-341      AC G3E5F0.1
#=GS Q918N3_9HEPA/5-228    AC Q918N3.1
#=GS B4YLF6_HBV/1-341      AC B4YLF6.1
#=GS S6A6V4_HBV/1-341      AC S6A6V4.1
#=GS B0FCA2_HBV/281-321    AC B0FCA2.1
#=GS C7DNA8_HBV/1-351      AC C7DNA8.1
#=GS Q05H96_HBV/1-340      AC Q05H96.1
#=GS G1E849_HBV/1-341      AC G1E849.1
#=GS B9VKG8_HBV/291-322    AC B9VKG8.1
#=GS C9WDM8_HBV/1-341      AC C9WDM8.1
#=GS B1PI53_9HEPA/113-390  AC B1PI53.1
#=GS A5HKP4_HBV/1-352      AC A5HKP4.1
#=GS D0E5H6_HBV/1-352      AC D0E5H6.1
#=GS L7R9D3_HBV/1-341      AC L7R9D3.1
#=GS D3YG03_HBV/1-341      AC D3YG03.1
#=GS G3XH16_HBV/1-332      AC G3XH16.1
#=GS D2U5Y6_HBV/1-351      AC D2U5Y6.1
#=GS L7PDA6_HBV/1-352      AC L7PDA6.1
#=GS X4YY19_HBV/1-352      AC X4YY19.1
#=GS E9L2S0_HBV/1-171      AC E9L2S0.1
#=GS I0DGH9_HBV/1-253      AC I0DGH9.1
#=GS E0ZR68_HBV/1-351      AC E0ZR68.1
#=GS F5C136_HBV/1-354      AC F5C136.1
#=GS D5MSF1_HBV/1-352      AC D5MSF1.1
#=GS C6F4S4_HBV/1-354      AC C6F4S4.1
#=GS Q20BT9_HBV/1-57       AC Q20BT9.1
#=GS D0E6K0_HBV/1-352      AC D0E6K0.1
#=GS D0E614_HBV/1-352      AC D0E614.1
#=GS M4Q812_HBV/1-171      AC M4Q812.1
#=GS I0C987_HBV/1-351      AC I0C987.1
#=GS B4ZYW8_HBV/1-227      AC B4ZYW8.1
#=GS DPOL_HBVA4/1-354      AC P17100.1
#=GS D0E5R8_HBV/1-352      AC D0E5R8.1
#=GS D5MSG9_HBV/1-343      AC D5MSG9.1
#=GS D0EEA6_HBV/1-354      AC D0EEA6.1
#=GS Q14U80_HBV/1-342      AC Q14U80.1
#=GS A5JIT6_HBV/1-112      AC A5JIT6.1
#=GS C9WDS4_HBV/1-351      AC C9WDS4.1
#=GS B4ZZ18_HBV/1-341      AC B4ZZ18.1
#=GS I0C858_HBV/1-354      AC I0C858.1
#=GS Q6XGU7_HBV/1-354      AC Q6XGU7.1
#=GS C3W3T0_HBV/1-345      AC C3W3T0.1
#=GS B1ABP1_HBV/1-352      AC B1ABP1.1
#=GS F5C0V6_HBV/1-354      AC F5C0V6.1
#=GS X4YZS0_HBV/1-342      AC X4YZS0.1
#=GS D5LD65_HBV/1-352      AC D5LD65.1
#=GS D7NKP9_HBV/1-341      AC D7NKP9.1
#=GS A5GZN8_HBV/1-352      AC A5GZN8.1
#=GS F5C0M4_HBV/1-354      AC F5C0M4.1
#=GS I1UYX2_HBV/1-166      AC I1UYX2.1
#=GS A5JHZ2_HBV/1-112      AC A5JHZ2.1
#=GS F2WS88_HBV/1-352      AC F2WS88.1
#=GS Q58W01_HBV/1-352      AC Q58W01.1
#=GS A5GZN0_HBV/1-352      AC A5GZN0.1
#=GS M4QAN1_HBV/1-171      AC M4QAN1.1
#=GS K7QGR3_HBV/1-192      AC K7QGR3.1
#=GS H9XRW5_HBV/1-91       AC H9XRW5.1
#=GS L0CLB0_HBV/1-341      AC L0CLB0.1
#=GS I0C999_HBV/1-341      AC I0C999.1
#=GS D0UDU4_HBV/1-352      AC D0UDU4.1
#=GS K7QGA2_HBV/1-352      AC K7QGA2.1
#=GS H6UGA5_HBV/1-341      AC H6UGA5.1
#=GS I0DCF9_HBV/1-328      AC I0DCF9.1
#=GS D7NL75_HBV/1-341      AC D7NL75.1
#=GS G4XME3_HBV/1-341      AC G4XME3.1
#=GS G3E5A1_HBV/1-341      AC G3E5A1.1
#=GS S6A6Y6_HBV/1-340      AC S6A6Y6.1
#=GS Q6IT53_9HEPA/5-388    AC Q6IT53.1
#=GS D7NKT5_HBV/1-341      AC D7NKT5.1
#=GS H6UGD0_HBV/1-341      AC H6UGD0.1
#=GS G1C893_HBV/1-341      AC G1C893.1
#=GS I0DC97_HBV/1-328      AC I0DC97.1
#=GS D0UE17_HBV/1-334      AC D0UE17.1
#=GS R9Q827_HBV/1-114      AC R9Q827.1
#=GS B9VKQ9_HBV/1-352      AC B9VKQ9.1
#=GS E5RD21_HBV/1-352      AC E5RD21.1
#=GS Q8QZP7_HBV/1-351      AC Q8QZP7.1
#=GS B4X9N8_HBV/1-352      AC B4X9N8.2
#=GS I0C865_HBV/1-354      AC I0C865.1
#=GS B5BPH3_HBV/1-352      AC B5BPH3.1
#=GS Q9YZU6_HBV/1-352      AC Q9YZU6.2
#=GS L7PD23_HBV/1-352      AC L7PD23.1
#=GS X4XUX0_HBV/1-341      AC X4XUX0.1
#=GS Q8B4P0_HBV/1-354      AC Q8B4P0.1
#=GS D0EEH7_HBV/1-354      AC D0EEH7.1
#=GS M9PN02_HBV/1-248      AC M9PN02.1
#=GS B0YJR7_HBV/1-351      AC B0YJR7.1
#=GS R4P3K6_HBV/1-352      AC R4P3K6.1
#=GS Q91C47_HBV/1-347      AC Q91C47.1
#=GS I1UYW9_HBV/1-166      AC I1UYW9.1
#=GS G3XGY8_HBV/1-343      AC G3XGY8.1
#=GS S5ZTE0_HBV/1-340      AC S5ZTE0.1
#=GS Q9WP64_HBV/260-310    AC Q9WP64.1
#=GS Q1T7C3_HBV/1-341      AC Q1T7C3.1
#=GS T1WMR6_HBV/1-341      AC T1WMR6.1
#=GS K7QGE4_HBV/1-352      AC K7QGE4.1
#=GS G1C8X1_HBV/1-341      AC G1C8X1.1
#=GS F5C0V9_HBV/1-354      AC F5C0V9.1
#=GS C6F541_HBV/1-354      AC C6F541.1
#=GS W6HZQ3_HBV/1-315      AC W6HZQ3.1
#=GS H9XQY7_HBV/1-91       AC H9XQY7.1
#=GS E5CYY8_HBV/1-352      AC E5CYY8.1
#=GS E5CZ75_HBV/1-341      AC E5CZ75.1
#=GS Q1PD08_HBV/1-352      AC Q1PD08.1
#=GS DPOL_HBVB5/1-352      AC Q9PX62.1
#=GS B3VLH5_HBV/1-165      AC B3VLH5.1
#=GS F5C0L5_HBV/1-354      AC F5C0L5.1
#=GS H6WFI6_HBV/1-112      AC H6WFI6.1
#=GS E3WCQ3_HBV/1-352      AC E3WCQ3.1
#=GS D3YG71_HBV/1-341      AC D3YG71.1
#=GS D8VCL9_HBV/301-332    AC D8VCL9.1
#=GS Q20BW3_HBV/1-57       AC Q20BW3.1
#=GS S5ZLH9_HBV/1-350      AC S5ZLH9.1
#=GS Q67908_HBV/1-49       AC Q67908.1
#=GS S6A6S4_HBV/1-352      AC S6A6S4.1
#=GS F5C193_HBV/1-354      AC F5C193.1
#=GS D3K2E6_HBV/1-352      AC D3K2E6.1
#=GS H6UMY9_HBV/1-341      AC H6UMY9.1
#=GS I0C859_HBV/1-354      AC I0C859.1
#=GS V5LF86_HBV/1-352      AC V5LF86.1
#=GS D2U674_HBV/1-351      AC D2U674.1
#=GS B5M624_HBV/1-352      AC B5M624.1
#=GS Q6XGH1_HBV/1-341      AC Q6XGH1.1
#=GS B5BPU2_HBV/1-352      AC B5BPU2.1
#=GS I0DGA7_HBV/1-352      AC I0DGA7.1
#=GS S5NT30_HBV/1-351      AC S5NT30.1
#=GS I0DDH7_HBV/1-328      AC I0DDH7.1
#=GS A4UBL5_HBV/1-63       AC A4UBL5.1
#=GS E9L2T4_HBV/1-171      AC E9L2T4.1
#=GS S6A6V8_HBV/1-337      AC S6A6V8.1
#=GS C7DY76_HBV/1-347      AC C7DY76.1
#=GS I0DGC1_HBV/1-352      AC I0DGC1.1
#=GS Q4FDH9_HBV/1-352      AC Q4FDH9.1
#=GS F5C0X7_HBV/1-354      AC F5C0X7.1
#=GS R9Q884_HBV/1-114      AC R9Q884.1
#=GS S5ZK32_HBV/1-340      AC S5ZK32.1
#=GS L7R9I4_HBV/1-341      AC L7R9I4.1
#=GS G1C945_HBV/1-341      AC G1C945.1
#=GS I0DGG5_HBV/1-352      AC I0DGG5.1
#=GS I6YUX6_HBV/1-352      AC I6YUX6.1
#=GS G1E7H8_HBV/1-341      AC G1E7H8.1
#=GS B3IWX5_HBV/1-351      AC B3IWX5.1
#=GS F5C120_HBV/281-320    AC F5C120.1
#=GS B7TTW3_HBV/1-352      AC B7TTW3.1
#=GS Q9WP81_HBV/1-214      AC Q9WP81.1
#=GS D5LFF4_HBV/1-352      AC D5LFF4.1
#=GS H6WFD8_HBV/1-112      AC H6WFD8.1
#=GS D0UDN4_HBV/1-352      AC D0UDN4.1
#=GS E5F0W3_HBV/1-49       AC E5F0W3.1
#=GS A5JIN8_HBV/1-112      AC A5JIN8.1
#=GS C6F4J0_HBV/1-354      AC C6F4J0.1
#=GS F5C117_HBV/1-284      AC F5C117.1
#=GS X4Z069_HBV/1-352      AC X4Z069.1
#=GS D5LD11_HBV/1-352      AC D5LD11.1
#=GS E0ZR93_HBV/1-351      AC E0ZR93.1
#=GS O91539_HBV/1-336      AC O91539.1
#=GS I0DDM4_HBV/1-328      AC I0DDM4.1
#=GS Q99HS0_HBV/1-352      AC Q99HS0.1
#=GS O91576_HBV/1-352      AC O91576.2
#=GS I0C8F3_HBV/1-354      AC I0C8F3.1
#=GS D5LCX0_HBV/1-352      AC D5LCX0.1
#=GS Q2L4J1_HBV/1-350      AC Q2L4J1.1
#=GS G4XMF1_HBV/1-352      AC G4XMF1.1
#=GS A5JID1_HBV/1-112      AC A5JID1.1
#=GS D5LCB0_HBV/1-352      AC D5LCB0.1
#=GS B5M580_HBV/1-352      AC B5M580.1
#=GS C1K1N0_HBV/1-352      AC C1K1N0.1
#=GS DPOL_HHBV/77-295      AC P13846.1
#=GS S6A026_HBV/1-335      AC S6A026.1
#=GS Q8UZL2_HBV/1-352      AC Q8UZL2.1
#=GS B5ASV9_HBV/1-352      AC B5ASV9.1
#=GS K4NE79_HBV/1-352      AC K4NE79.1
#=GS S5ZEY6_HBV/1-352      AC S5ZEY6.1
#=GS I0C8C8_HBV/1-354      AC I0C8C8.1
#=GS I0C8L8_HBV/1-335      AC I0C8L8.1
#=GS C7AYB1_HBV/1-354      AC C7AYB1.1
#=GS F5C7L8_HBV/1-352      AC F5C7L8.1
#=GS X4ZFW0_HBV/1-352      AC X4ZFW0.1
#=GS D2JMG5_HBV/1-352      AC D2JMG5.1
#=GS H6UGK3_HBV/1-341      AC H6UGK3.1
#=GS B2CY36_HBV/1-352      AC B2CY36.1
#=GS E0ZRW3_HBV/1-351      AC E0ZRW3.1
#=GS K7QGR6_HBV/1-352      AC K7QGR6.1
#=GS Q461C4_HBV/1-351      AC Q461C4.1
#=GS I0C8Y2_HBV/1-354      AC I0C8Y2.1
#=GS Q5U7U5_HBV/1-341      AC Q5U7U5.1
#=GS C1K169_HBV/1-352      AC C1K169.1
#=GS D9U5K0_HBV/1-352      AC D9U5K0.1
#=GS D3TJB7_HBV/1-352      AC D3TJB7.1
#=GS I6XQN2_HBV/1-352      AC I6XQN2.1
#=GS D0VXI9_HBV/1-352      AC D0VXI9.1
#=GS L7R9M6_HBV/1-341      AC L7R9M6.1
#=GS H2ER96_HBV/1-352      AC H2ER96.1
#=GS S5ZJV1_HBV/1-341      AC S5ZJV1.1
#=GS B5TFK5_HBV/1-112      AC B5TFK5.1
#=GS M4HZ30_HBV/1-354      AC M4HZ30.1
#=GS E9L2P3_HBV/1-171      AC E9L2P3.1
#=GS D0E6G0_HBV/1-352      AC D0E6G0.1
#=GS I2DB82_HBV/1-341      AC I2DB82.1
#=GS Q9DUH1_HBV/1-341      AC Q9DUH1.1
#=GS V9TKL2_HBV/1-341      AC V9TKL2.1
#=GS G9HNR1_HBV/1-159      AC G9HNR1.1
#=GS K4Q377_HBV/1-352      AC K4Q377.1
#=GS K0FGS7_HBV/1-352      AC K0FGS7.1
#=GS H6WFJ3_HBV/1-112      AC H6WFJ3.1
#=GS B5LXZ2_HBV/1-341      AC B5LXZ2.1
#=GS B5TFI1_HBV/1-112      AC B5TFI1.1
#=GS S5ZLG1_HBV/1-340      AC S5ZLG1.1
#=GS Q461B2_HBV/1-351      AC Q461B2.1
#=GS Q80H20_HBV/1-352      AC Q80H20.1
#=GS A8J482_HBV/1-352      AC A8J482.1
#=GS D3YG27_HBV/1-239      AC D3YG27.1
#=GS L0HCD2_HBV/237-284    AC L0HCD2.1
#=GS S5ZKM0_HBV/1-340      AC S5ZKM0.1
#=GS S5ZLJ1_HBV/1-338      AC S5ZLJ1.1
#=GS A9CM29_HBV/1-352      AC A9CM29.1
#=GS G9BNJ8_HBV/1-354      AC G9BNJ8.1
#=GS D2JMQ1_HBV/1-352      AC D2JMQ1.1
#=GS K7QH11_HBV/1-352      AC K7QH11.1
#=GS DPOL_HBVD2/1-341      AC P24024.1
#=GS C9WDI5_HBV/251-295    AC C9WDI5.1
#=GS Q918I7_HBV/1-352      AC Q918I7.1
#=GS I0C9C7_HBV/1-334      AC I0C9C7.1
#=GS G1E7E1_HBV/1-341      AC G1E7E1.1
#=GS I0DDI2_HBV/1-328      AC I0DDI2.1
#=GS G1C8B4_HBV/1-273      AC G1C8B4.1
#=GS D0E5C1_HBV/1-352      AC D0E5C1.1
#=GS X4ZCN5_HBV/1-352      AC X4ZCN5.1
#=GS B3V8T9_HBV/240-330    AC B3V8T9.1
#=GS Q19SX2_HBV/1-341      AC Q19SX2.1
#=GS Q1JUT4_HBV/1-352      AC Q1JUT4.1
#=GS B7TU69_HBV/1-352      AC B7TU69.1
#=GS C3W3V4_HBV/1-341      AC C3W3V4.1
#=GS D0UE77_HBV/1-352      AC D0UE77.1
#=GS D0UDV4_HBV/1-352      AC D0UDV4.1
#=GS L7PDT7_HBV/1-352      AC L7PDT7.1
#=GS Q20BU9_HBV/1-55       AC Q20BU9.1
#=GS R9Q8B7_HBV/1-114      AC R9Q8B7.1
#=GS B5M5J7_HBV/1-352      AC B5M5J7.1
#=GS L7R9I0_HBV/1-341      AC L7R9I0.1
#=GS Q4R1T1_HBV/1-354      AC Q4R1T1.1
#=GS D0VXH7_HBV/1-352      AC D0VXH7.1
#=GS A0A023NL89_HBV/1-341  AC A0A023NL89.1
#=GS S6A6V1_HBV/1-337      AC S6A6V1.1
#=GS C7AY96_HBV/1-354      AC C7AY96.2
#=GS B3VLJ9_HBV/1-176      AC B3VLJ9.1
#=GS E0ZRQ4_HBV/1-351      AC E0ZRQ4.1
#=GS A6MG62_HBV/1-352      AC A6MG62.1
#=GS E5RPW5_HBV/1-343      AC E5RPW5.1
#=GS B5M596_HBV/1-342      AC B5M596.1
#=GS S5ZT24_HBV/1-352      AC S5ZT24.1
#=GS H6UN21_HBV/1-341      AC H6UN21.1
#=GS I0C8R4_HBV/224-280    AC I0C8R4.1
#=GS S6A6T9_HBV/1-340      AC S6A6T9.1
#=GS B5M5B8_HBV/1-338      AC B5M5B8.1
#=GS L7R7P6_HBV/1-341      AC L7R7P6.1
#=GS E7EFC5_HBV/1-352      AC E7EFC5.1
#=GS Q2MLR2_HBV/1-341      AC Q2MLR2.1
#=GS I0DGJ5_HBV/1-188      AC I0DGJ5.1
#=GS A7M6U1_HBV/1-352      AC A7M6U1.1
#=GS B0FD05_HBV/1-352      AC B0FD05.1
#=GS S5ZJY9_HBV/1-337      AC S5ZJY9.1
#=GS T1YVK8_HBV/1-352      AC T1YVK8.1
#=GS R9Q7R1_HBV/1-114      AC R9Q7R1.1
#=GS G1E7C9_HBV/1-341      AC G1E7C9.1
#=GS B5M5B0_HBV/1-238      AC B5M5B0.1
#=GS D0E662_HBV/1-352      AC D0E662.1
#=GS Q5DW13_HBV/1-352      AC Q5DW13.1
#=GS S5N0W5_HBV/1-352      AC S5N0W5.1
#=GS I0C901_HBV/1-354      AC I0C901.1
#=GS I0DDF8_HBV/1-317      AC I0DDF8.1
#=GS D5LB96_HBV/1-352      AC D5LB96.1
#=GS B5M5F2_HBV/1-352      AC B5M5F2.1
#=GS I4CJU3_HBV/1-30       AC I4CJU3.1
#=GS S5ZLS4_HBV/1-335      AC S5ZLS4.1
#=GS L8AYP2_HBV/1-331      AC L8AYP2.1
#=GS A5GZL8_HBV/1-352      AC A5GZL8.1
#=GS B2CY16_HBV/1-352      AC B2CY16.1
#=GS D0UEC0_HBV/1-352      AC D0UEC0.1
#=GS F5C0X2_HBV/1-354      AC F5C0X2.1
#=GS E5CZ31_HBV/1-352      AC E5CZ31.1
#=GS M9PM91_HBV/1-249      AC M9PM91.1
#=GS Q20BX7_HBV/1-57       AC Q20BX7.1
#=GS S5ZZI5_HBV/1-340      AC S5ZZI5.1
#=GS Q1XHF0_HBV/1-341      AC Q1XHF0.1
#=GS D0VXI5_HBV/1-352      AC D0VXI5.1
#=GS L0HAC9_HBV/284-323    AC L0HAC9.1
#=GS I6Y0X5_HBV/1-352      AC I6Y0X5.1
#=GS X4ZF24_HBV/1-352      AC X4ZF24.1
#=GS G9G9F3_HBV/1-227      AC G9G9F3.1
#=GS W6HVY8_HBV/1-315      AC W6HVY8.1
#=GS R9Q8E4_HBV/1-114      AC R9Q8E4.1
#=GS J7IMF5_HBV/1-352      AC J7IMF5.1
#=GS Q003Z3_HBV/1-352      AC Q003Z3.1
#=GS I0C957_HBV/1-354      AC I0C957.1
#=GS C7DMM6_HBV/1-351      AC C7DMM6.1
#=GS A5JHW8_HBV/1-112      AC A5JHW8.1
#=GS C1K159_HBV/1-238      AC C1K159.1
#=GS C7AYV3_HBV/1-354      AC C7AYV3.1
#=GS S5ZL78_HBV/1-336      AC S5ZL78.1
#=GS Q20BQ5_HBV/1-57       AC Q20BQ5.1
#=GS S5ZKD5_HBV/1-340      AC S5ZKD5.1
#=GS Q9WP84_HBV/1-339      AC Q9WP84.1
#=GS I0DCZ0_HBV/1-328      AC I0DCZ0.1
#=GS I0C8C2_HBV/1-354      AC I0C8C2.1
#=GS Q80J60_HBV/1-352      AC Q80J60.1
#=GS F5C0M3_HBV/1-354      AC F5C0M3.1
#=GS S5ZZT1_HBV/1-340      AC S5ZZT1.1
#=GS D2JMA6_HBV/1-352      AC D2JMA6.1
#=GS M9PN19_HBV/1-247      AC M9PN19.1
#=GS K7QGT9_HBV/1-352      AC K7QGT9.1
#=GS H6UN60_HBV/1-341      AC H6UN60.1
#=GS I0DDF0_HBV/1-328      AC I0DDF0.1
#=GS G1C8C0_HBV/1-341      AC G1C8C0.1
#=GS A5JHU0_HBV/1-112      AC A5JHU0.1
#=GS B5M4X7_HBV/1-352      AC B5M4X7.1
#=GS S6A053_HBV/1-337      AC S6A053.1
#=GS R9Q8A6_HBV/1-114      AC R9Q8A6.1
#=GS I3XMU4_HBV/1-354      AC I3XMU4.1
#=GS C3W463_HBV/1-340      AC C3W463.1
#=GS I0C8F7_HBV/1-354      AC I0C8F7.1
#=GS I0C8D3_HBV/1-354      AC I0C8D3.1
#=GS U3KUF8_HBV/1-171      AC U3KUF8.1
#=GS Q2L4N3_HBV/1-341      AC Q2L4N3.1
#=GS B5ATE6_HBV/1-275      AC B5ATE6.1
#=GS E5CZ65_HBV/1-352      AC E5CZ65.1
#=GS A6MG20_HBV/1-352      AC A6MG20.1
#=GS L0H859_HBV/1-352      AC L0H859.1
#=GS D2JMD6_HBV/1-352      AC D2JMD6.1
#=GS R9Q7W3_HBV/1-114      AC R9Q7W3.1
#=GS Q2F4Y9_HBV/1-351      AC Q2F4Y9.1
#=GS E5RPT3_HBV/1-343      AC E5RPT3.1
#=GS Q9IX81_HBV/1-35       AC Q9IX81.1
#=GS D6QVW3_HBV/1-352      AC D6QVW3.1
#=GS G3XH30_HBV/1-226      AC G3XH30.1
#=GS F5C155_HBV/1-354      AC F5C155.1
#=GS I0C8I4_HBV/1-350      AC I0C8I4.1
#=GS O11885_HBV/1-341      AC O11885.1
#=GS Q9YPU9_HBV/1-341      AC Q9YPU9.1
#=GS R9Q8V5_HBV/1-114      AC R9Q8V5.1
#=GS S5ZTF7_HBV/1-341      AC S5ZTF7.1
#=GS Q5U7T9_HBV/1-341      AC Q5U7T9.1
#=GS Q2L4L4_HBV/1-341      AC Q2L4L4.1
#=GS L7R8Q6_HBV/1-341      AC L7R8Q6.1
#=GS DPOL_HBVF4/1-352      AC Q99HR5.1
#=GS D2JMM7_HBV/1-352      AC D2JMM7.1
#=GS G9G931_HBV/1-341      AC G9G931.2
#=GS G8CQJ4_HBV/1-49       AC G8CQJ4.1
#=GS A5JIS0_HBV/1-112      AC A5JIS0.1
#=GS F5C1D1_HBV/1-341      AC F5C1D1.1
#=GS E0ZS19_HBV/1-354      AC E0ZS19.1
#=GS R9Q813_HBV/1-114      AC R9Q813.1
#=GS C3W3T6_HBV/1-341      AC C3W3T6.1
#=GS W6IBF5_HBV/1-315      AC W6IBF5.1
#=GS I0C874_HBV/1-354      AC I0C874.1
#=GS O39882_HBV/1-352      AC O39882.1
#=GS Q4W6F6_HBV/1-346      AC Q4W6F6.1
#=GS I0DCS4_HBV/4-329      AC I0DCS4.1
#=GS F1AEW6_HBV/1-354      AC F1AEW6.1
#=GS G4XI11_HBV/1-159      AC G4XI11.1
#=GS D9U5P0_HBV/1-286      AC D9U5P0.1
#=GS B7TUD7_HBV/1-352      AC B7TUD7.1
#=GS D3YG64_HBV/1-341      AC D3YG64.1
#=GS F5C0R5_HBV/1-351      AC F5C0R5.1
#=GS Q8JVC9_HBV/1-352      AC Q8JVC9.1
#=GS G4XI23_HBV/1-160      AC G4XI23.1
#=GS O91572_HBV/1-352      AC O91572.1
#=GS I0DDZ6_HBV/1-328      AC I0DDZ6.1
#=GS D0UDX7_HBV/1-350      AC D0UDX7.1
#=GS G0VSG3_HBV/1-354      AC G0VSG3.1
#=GS I0DCZ7_HBV/1-311      AC I0DCZ7.1
#=GS Q00K64_HBV/1-352      AC Q00K64.1
#=GS D9U5A1_HBV/1-352      AC D9U5A1.1
#=GS I0C868_HBV/1-354      AC I0C868.1
#=GS I2DB88_HBV/1-341      AC I2DB88.1
#=GS B2LRY3_HBV/1-352      AC B2LRY3.1
#=GS G4XHW3_HBV/1-160      AC G4XHW3.1
#=GS Q2EX95_HBV/1-68       AC Q2EX95.1
#=GS E3Q0L4_HBV/1-352      AC E3Q0L4.1
#=GS H9XQL4_HBV/1-91       AC H9XQL4.1
#=GS T1YU56_HBV/1-352      AC T1YU56.1
#=GS I0DGH7_HBV/1-300      AC I0DGH7.1
#=GS Q7TDQ4_HBV/1-352      AC Q7TDQ4.1
#=GS D2X3V7_HBV/15-74      AC D2X3V7.1
#=GS Q9IF40_HBV/1-341      AC Q9IF40.1
#=GS Q2F4Z7_HBV/1-351      AC Q2F4Z7.1
#=GS F5C162_HBV/1-354      AC F5C162.1
#=GS Q5R2Q7_HBV/1-341      AC Q5R2Q7.1
#=GS B5M577_HBV/1-352      AC B5M577.1
#=GS B7TV64_HBV/1-352      AC B7TV64.1
#=GS S5ZZM5_HBV/1-340      AC S5ZZM5.1
#=GS DPOL_HBVGB/1-341      AC P87744.1
#=GS Q762E7_HBV/1-352      AC Q762E7.1
#=GS Q8B4C0_HBV/1-230      AC Q8B4C0.1
#=GS E5RPS7_HBV/1-343      AC E5RPS7.1
#=GS Q80MM5_9HEPA/1-340    AC Q80MM5.1
#=GS D0E5P5_HBV/1-352      AC D0E5P5.1
#=GS W6HYC0_HBV/1-315      AC W6HYC0.1
#=GS D9U1N6_HBV/1-352      AC D9U1N6.1
#=GS A5JIQ8_HBV/1-112      AC A5JIQ8.1
#=GS K9MDM3_HBV/1-24       AC K9MDM3.1
#=GS Q67851_9HEPA/65-238   AC Q67851.1
#=GS S6A0E3_HBV/1-336      AC S6A0E3.1
#=GS Q9YKD1_HBV/1-341      AC Q9YKD1.1
#=GS S5ZLC3_HBV/1-332      AC S5ZLC3.1
#=GS I0DGK9_HBV/1-352      AC I0DGK9.1
#=GS G4XI83_HBV/1-54       AC G4XI83.1
#=GS I0DGA8_HBV/1-352      AC I0DGA8.1
#=GS L8B243_HBV/1-341      AC L8B243.1
#=GS M9PMV4_HBV/1-49       AC M9PMV4.1
#=GS D4QGI3_HBV/1-341      AC D4QGI3.1
#=GS B5B4C7_HBV/1-233      AC B5B4C7.1
#=GS S5ZTI7_HBV/1-337      AC S5ZTI7.1
#=GS B5BUS8_HBV/1-354      AC B5BUS8.1
#=GS D6QVZ1_HBV/1-352      AC D6QVZ1.1
#=GS C3W4L2_HBV/1-341      AC C3W4L2.1
#=GS L7R8R0_HBV/1-341      AC L7R8R0.1
#=GS E3VLB8_HBV/1-341      AC E3VLB8.1
#=GS I0C8E6_HBV/1-354      AC I0C8E6.1
#=GS L0BCB3_HBV/1-210      AC L0BCB3.1
#=GS S5ZKY0_HBV/1-340      AC S5ZKY0.1
#=GS Q20C16_HBV/1-55       AC Q20C16.1
#=GS C3W421_HBV/1-341      AC C3W421.1
#=GS A9QQ00_HBV/1-350      AC A9QQ00.1
#=GS X4YHR3_HBV/1-341      AC X4YHR3.1
#=GS Q20BW9_HBV/1-55       AC Q20BW9.1
#=GS A8J464_HBV/1-352      AC A8J464.1
#=GS Q20BX3_HBV/1-55       AC Q20BX3.1
#=GS H6WFN6_HBV/1-112      AC H6WFN6.1
#=GS S5ZT05_HBV/1-350      AC S5ZT05.1
#=GS C0IR97_HBV/1-352      AC C0IR97.1
#=GS I0C8Y0_HBV/1-354      AC I0C8Y0.1
#=GS D0E682_HBV/1-352      AC D0E682.1
#=GS D9U5P6_HBV/1-91       AC D9U5P6.1
#=GS X4ZFG9_HBV/1-352      AC X4ZFG9.1
#=GS C1K1P3_HBV/1-174      AC C1K1P3.1
#=GS A3F6I3_HBV/1-354      AC A3F6I3.1
#=GS B5TXY8_HBV/1-352      AC B5TXY8.1
#=GS I0DGG8_HBV/1-157      AC I0DGG8.1
#=GS Q9IXE4_HBV/1-52       AC Q9IXE4.1
#=GS A9PLI5_HBV/1-43       AC A9PLI5.1
#=GS Q00KA4_HBV/1-352      AC Q00KA4.1
#=GS L8B1Z0_HBV/1-270      AC L8B1Z0.1
#=GS B5B4I2_HBV/1-238      AC B5B4I2.1
#=GS B3IWW7_HBV/1-352      AC B3IWW7.1
#=GS C7DMP5_HBV/1-30       AC C7DMP5.1
#=GS B5TF41_HBV/1-112      AC B5TF41.1
#=GS C7DMD8_HBV/1-351      AC C7DMD8.1
#=GS S5ZFG0_HBV/1-340      AC S5ZFG0.1
#=GS S6A6Y1_HBV/1-342      AC S6A6Y1.1
#=GS I0C8U7_HBV/1-354      AC I0C8U7.1
#=GS B5B4C7_HBV/231-286    AC B5B4C7.1
#=GS Q6W5D1_HBV/1-352      AC Q6W5D1.1
#=GS D0E602_HBV/1-341      AC D0E602.1
#=GS F5C0K1_HBV/1-354      AC F5C0K1.1
#=GS A8IER8_HBV/1-52       AC A8IER8.1
#=GS U3KUE1_HBV/1-171      AC U3KUE1.1
#=GS I0C8R7_HBV/224-280    AC I0C8R7.1
#=GS B5M511_HBV/1-346      AC B5M511.1
#=GS I0DDA9_HBV/1-328      AC I0DDA9.1
#=GS U3KUG7_HBV/1-171      AC U3KUG7.1
#=GS I0C8B8_HBV/1-354      AC I0C8B8.1
#=GS J7RUG6_HBV/1-352      AC J7RUG6.1
#=GS H9XR50_HBV/1-91       AC H9XR50.1
#=GS S5ZFF2_HBV/1-344      AC S5ZFF2.1
#=GS G4XI94_HBV/29-85      AC G4XI94.1
#=GS F5C0V8_HBV/1-354      AC F5C0V8.1
#=GS R9Q7X7_HBV/1-114      AC R9Q7X7.1
#=GS B7TU45_HBV/1-352      AC B7TU45.1
#=GS L0CN97_HBV/1-341      AC L0CN97.1
#=GS W0SM49_HBV/1-352      AC W0SM49.1
#=GS S6A6S7_HBV/1-336      AC S6A6S7.1
#=GS E2FIM0_HBV/1-352      AC E2FIM0.1
#=GS O91527_HBV/1-352      AC O91527.1
#=GS D3TIF6_HBV/283-319    AC D3TIF6.1
#=GS I0C8I3_HBV/1-350      AC I0C8I3.1
#=GS I0DE56_HBV/1-328      AC I0DE56.1
#=GS S5ZFT4_HBV/1-332      AC S5ZFT4.1
#=GS Q91C40_HBV/1-347      AC Q91C40.1
#=GS U3RC46_HBV/1-218      AC U3RC46.1
#=GS K7QGL8_HBV/1-344      AC K7QGL8.1
#=GS L0HCY0_HBV/1-352      AC L0HCY0.1
#=GS A5JI13_HBV/1-112      AC A5JI13.1
#=GS D3Y5R6_HBV/1-352      AC D3Y5R6.1
#=GS K7QGN1_HBV/1-352      AC K7QGN1.1
#=GS F5C135_HBV/1-354      AC F5C135.1
#=GS Q58VZ0_HBV/1-352      AC Q58VZ0.1
#=GS M1G279_9HEPA/72-376   AC M1G279.1
#=GS V9TLN8_HBV/1-341      AC V9TLN8.1
#=GS U5JZL6_HBV/4-52       AC U5JZL6.1
#=GS G1C8R5_HBV/1-341      AC G1C8R5.1
#=GS Q6XGM0_HBV/1-354      AC Q6XGM0.1
#=GS I0DGJ5_HBV/292-352    AC I0DGJ5.1
#=GS C7DQQ0_HBV/1-341      AC C7DQQ0.1
#=GS D5LC90_HBV/1-352      AC D5LC90.1
#=GS I0DG91_HBV/1-352      AC I0DG91.1
#=GS F5C1T4_HBV/1-354      AC F5C1T4.1
#=GS I0DGI9_HBV/1-352      AC I0DGI9.1
#=GS Q9WP55_HBV/1-346      AC Q9WP55.1
#=GS B5TFL7_HBV/1-112      AC B5TFL7.1
#=GS D4QGJ0_HBV/1-352      AC D4QGJ0.1
#=GS I0DC93_HBV/1-328      AC I0DC93.1
#=GS G4XI27_HBV/1-160      AC G4XI27.1
#=GS Q5R2R3_HBV/1-341      AC Q5R2R3.1
#=GS I0DCB7_HBV/1-328      AC I0DCB7.1
#=GS G1C8J0_HBV/1-341      AC G1C8J0.1
#=GS S6A6U0_HBV/1-336      AC S6A6U0.1
#=GS E5CZ12_HBV/1-352      AC E5CZ12.1
#=GS E5RPS3_HBV/1-343      AC E5RPS3.1
#=GS K4Q396_HBV/1-84       AC K4Q396.1
#=GS B5B4M3_HBV/1-352      AC B5B4M3.1
#=GS G4XI15_HBV/1-160      AC G4XI15.1
#=GS M9PM93_HBV/1-49       AC M9PM93.1
#=GS D3TKF0_HBV/1-352      AC D3TKF0.1
#=GS I0DCT6_HBV/1-328      AC I0DCT6.1
#=GS S5ZLV2_HBV/1-340      AC S5ZLV2.1
#=GS Q8JXG2_HBV/1-349      AC Q8JXG2.1
#=GS X4ZEQ6_HBV/1-352      AC X4ZEQ6.1
#=GS B2LW86_HBV/1-352      AC B2LW86.1
#=GS S5ZZW1_HBV/1-320      AC S5ZZW1.1
#=GS M4Q3C2_9HEPA/19-359   AC M4Q3C2.1
#=GS Q80H29_HBV/1-352      AC Q80H29.1
#=GS Q4FDF9_HBV/1-352      AC Q4FDF9.1
#=GS B5M627_HBV/1-352      AC B5M627.1
#=GS S6A722_HBV/1-350      AC S6A722.1
#=GS I0C916_HBV/1-354      AC I0C916.1
#=GS Q9YPV3_HBV/1-341      AC Q9YPV3.1
#=GS I0C8V5_HBV/1-354      AC I0C8V5.1
#=GS L0HA26_HBV/1-352      AC L0HA26.1
#=GS I0C8T5_HBV/1-341      AC I0C8T5.1
#=GS B5M5H1_HBV/1-351      AC B5M5H1.1
#=GS Q9WFA8_9HEPA/61-345   AC Q9WFA8.1
#=GS D5LFK2_HBV/1-352      AC D5LFK2.1
#=GS X4Z003_HBV/1-352      AC X4Z003.1
#=GS D5LBD7_HBV/1-352      AC D5LBD7.1
#=GS I0C8G8_HBV/1-354      AC I0C8G8.1
#=GS S5ZET5_HBV/1-350      AC S5ZET5.1
#=GS Q7TDS9_HBV/1-352      AC Q7TDS9.1
#=GS D9U5F5_HBV/1-346      AC D9U5F5.1
#=GS G4XI29_HBV/1-160      AC G4XI29.1
#=GS D0UDX3_HBV/1-352      AC D0UDX3.1
#=GS G3XH00_HBV/1-343      AC G3XH00.1
#=GS H9XQX6_HBV/1-91       AC H9XQX6.1
#=GS Q9IXE7_HBV/1-52       AC Q9IXE7.1
#=GS B5U717_HBV/1-341      AC B5U717.1
#=GS B7TUJ3_HBV/1-352      AC B7TUJ3.1
#=GS X2G4S0_HBV/1-351      AC X2G4S0.1
#=GS H3K3F1_HBV/1-352      AC H3K3F1.1
#=GS I0C8Y8_HBV/1-354      AC I0C8Y8.1
#=GS W0SM96_HBV/1-352      AC W0SM96.1
#=GS D3TIL0_HBV/284-316    AC D3TIL0.1
#=GS Q20BY7_HBV/1-56       AC Q20BY7.1
#=GS X4YYE4_HBV/1-352      AC X4YYE4.1
#=GS I0C8M7_HBV/1-335      AC I0C8M7.1
#=GS I0DE60_HBV/1-328      AC I0DE60.1
#=GS K0FBE3_HBV/1-352      AC K0FBE3.1
#=GS B0FC76_HBV/1-352      AC B0FC76.1
#=GS Q5EDS5_HBV/1-276      AC Q5EDS5.1
#=GS E0ZRN3_HBV/1-351      AC E0ZRN3.1
#=GS G1E8R6_HBV/1-341      AC G1E8R6.1
#=GS B0FCB7_HBV/1-352      AC B0FCB7.1
#=GS Q4KRD8_HBV/1-354      AC Q4KRD8.1
#=GS B7TUA2_HBV/1-352      AC B7TUA2.1
#=GS S5ZLT4_HBV/1-341      AC S5ZLT4.1
#=GS L0HC47_HBV/1-352      AC L0HC47.1
#=GS G4XHY9_HBV/1-160      AC G4XHY9.1
#=GS D0UDV9_HBV/1-352      AC D0UDV9.1
#=GS A6YM40_HBV/1-351      AC A6YM40.1
#=GS R9Q842_HBV/1-114      AC R9Q842.1
#=GS K7QG15_HBV/1-352      AC K7QG15.1
#=GS A4F540_HBV/1-354      AC A4F540.1
#=GS B3VLJ6_HBV/1-176      AC B3VLJ6.1
#=GS B7TUH6_HBV/1-352      AC B7TUH6.1
#=GS B7TTB0_HBV/1-352      AC B7TTB0.1
#=GS S5NET9_HBV/1-334      AC S5NET9.1
#=GS C9WDM2_HBV/1-341      AC C9WDM2.1
#=GS I0DGJ9_HBV/1-347      AC I0DGJ9.1
#=GS H6WF38_HBV/1-112      AC H6WF38.1
#=GS K7QGR3_HBV/190-253    AC K7QGR3.1
#=GS H6UGN2_HBV/1-341      AC H6UGN2.1
#=GS Q5F4J1_HBV/1-346      AC Q5F4J1.1
#=GS C7AYD1_HBV/1-354      AC C7AYD1.1
#=GS F5C110_HBV/1-354      AC F5C110.1
#=GS F5C1B4_HBV/1-354      AC F5C1B4.1
#=GS X4YRR2_HBV/1-352      AC X4YRR2.1
#=GS D3GE60_HBV/1-352      AC D3GE60.1
#=GS L7R9L4_HBV/1-352      AC L7R9L4.1
#=GS E5RPU9_HBV/1-343      AC E5RPU9.1
#=GS D0EED2_HBV/1-354      AC D0EED2.1
#=GS L0BDF2_HBV/1-210      AC L0BDF2.1
#=GS S6A020_HBV/1-341      AC S6A020.1
#=GS C6F4Y7_HBV/1-354      AC C6F4Y7.1
#=GS B5TXJ3_HBV/1-347      AC B5TXJ3.1
#=GS K9MDM0_HBV/1-24       AC K9MDM0.1
#=GS M4Q7V8_HBV/1-171      AC M4Q7V8.1
#=GS J7RUE4_HBV/1-352      AC J7RUE4.1
#=GS F5C194_HBV/1-354      AC F5C194.1
#=GS L0HA20_HBV/1-352      AC L0HA20.1
#=GS A7L367_HBV/1-30       AC A7L367.1
#=GS C1K1S7_HBV/1-352      AC C1K1S7.1
#=GS F5C0T0_HBV/1-351      AC F5C0T0.1
#=GS I0DDK1_HBV/1-328      AC I0DDK1.1
#=GS D0E5L6_HBV/1-352      AC D0E5L6.1
#=GS C7DMB7_HBV/1-351      AC C7DMB7.1
#=GS Q598Q4_HBV/1-351      AC Q598Q4.1
#=GS A5GZM6_HBV/1-352      AC A5GZM6.1
#=GS B5TFI9_HBV/1-112      AC B5TFI9.1
#=GS D0E669_HBV/1-352      AC D0E669.1
#=GS A5JIR2_HBV/1-112      AC A5JIR2.1
#=GS I0C8S7_HBV/1-341      AC I0C8S7.1
#=GS B4YLK8_HBV/1-341      AC B4YLK8.1
#=GS G9G9D2_HBV/1-341      AC G9G9D2.1
#=GS B5BPJ3_HBV/1-352      AC B5BPJ3.1
#=GS Q03766_HBV/1-352      AC Q03766.1
#=GS Q8B3P1_9HEPA/69-375   AC Q8B3P1.1
#=GS F5C174_HBV/1-354      AC F5C174.1
#=GS I0C8J9_HBV/1-335      AC I0C8J9.1
#=GS G9G911_HBV/1-335      AC G9G911.1
#=GS T1WLI8_HBV/1-341      AC T1WLI8.1
#=GS I0C9C2_HBV/1-334      AC I0C9C2.1
#=GS D6QVJ0_HBV/1-352      AC D6QVJ0.1
#=GS V9TKG4_HBV/1-341      AC V9TKG4.1
#=GS I7L979_HBV/1-341      AC I7L979.1
#=GS H6WF18_HBV/1-112      AC H6WF18.1
#=GS D3K2D9_HBV/1-352      AC D3K2D9.1
#=GS K7QGR5_HBV/1-352      AC K7QGR5.1
#=GS B4Y7G6_HBV/1-352      AC B4Y7G6.2
#=GS X4YZP1_HBV/1-352      AC X4YZP1.1
#=GS G3E5J2_HBV/1-341      AC G3E5J2.1
#=GS D0E5T3_HBV/1-352      AC D0E5T3.1
#=GS G1C8I3_HBV/1-341      AC G1C8I3.1
#=GS G1E7S7_HBV/1-341      AC G1E7S7.1
#=GS C7DMJ2_HBV/1-351      AC C7DMJ2.1
#=GS I0DD05_HBV/1-323      AC I0DD05.1
#=GS F5C0M7_HBV/1-348      AC F5C0M7.1
#=GS H9XQZ1_HBV/1-91       AC H9XQZ1.1
#=GS B0FC45_HBV/1-352      AC B0FC45.1
#=GS H6UGD7_HBV/1-341      AC H6UGD7.1
#=GS DPOL_HBVC5/1-352      AC P03157.1
#=GS S5ZL98_HBV/1-332      AC S5ZL98.1
#=GS F5C141_HBV/1-354      AC F5C141.1
#=GS Q9E6T2_HBV/1-352      AC Q9E6T2.1
#=GS Q7TG33_9HEPA/59-342   AC Q7TG33.1
#=GS Q9QN52_HBV/1-352      AC Q9QN52.1
#=GS W6HWJ0_HBV/1-315      AC W6HWJ0.1
#=GS E0ZRI8_HBV/1-351      AC E0ZRI8.1
#=GS Q9IX66_HBV/1-52       AC Q9IX66.1
#=GS L0H9K4_HBV/1-352      AC L0H9K4.1
#=GS Q918N6_9HEPA/5-244    AC Q918N6.1
#=GS Q7TDS7_HBV/1-352      AC Q7TDS7.1
#=GS G4XIA2_HBV/1-130      AC G4XIA2.1
#=GS Q8B4G8_HBV/1-354      AC Q8B4G8.1
#=GS Q2F512_HBV/1-232      AC Q2F512.1
#=GS D9U1K8_HBV/1-352      AC D9U1K8.1
#=GS F5C118_HBV/1-284      AC F5C118.1
#=GS K9MCB9_HBV/1-24       AC K9MCB9.1
#=GS F5HRF4_HBV/1-352      AC F5HRF4.1
#=GS Q6XGK6_HBV/1-341      AC Q6XGK6.1
#=GS G4XMK3_HBV/1-352      AC G4XMK3.1
#=GS H9XRD4_HBV/1-91       AC H9XRD4.1
#=GS G4XI43_HBV/1-144      AC G4XI43.1
#=GS I0DGE1_HBV/1-352      AC I0DGE1.1
#=GS B7TUT7_HBV/1-352      AC B7TUT7.1
#=GS U3M9Y1_HBV/6-308      AC U3M9Y1.1
#=GS C6F5D9_HBV/1-354      AC C6F5D9.1
#=GS T1YU65_HBV/1-352      AC T1YU65.1
#=GS F5C148_HBV/1-354      AC F5C148.1
#=GS S5ZLP0_HBV/1-340      AC S5ZLP0.1
#=GS Q20BS1_HBV/1-52       AC Q20BS1.1
#=GS B7TTG1_HBV/1-352      AC B7TTG1.1
#=GS B4Y4L4_HBV/1-352      AC B4Y4L4.1
#=GS F5C0R1_HBV/1-351      AC F5C0R1.1
#=GS D2JMD1_HBV/1-352      AC D2JMD1.1
#=GS S6A6V0_HBV/1-336      AC S6A6V0.1
#=GS B7TV77_HBV/1-352      AC B7TV77.1
#=GS B7TU04_HBV/1-352      AC B7TU04.1
#=GS I0DGK4_HBV/1-352      AC I0DGK4.1
#=GS I0DDF4_HBV/1-317      AC I0DDF4.1
#=GS Q4FDI3_HBV/1-352      AC Q4FDI3.1
#=GS G3XGT6_HBV/1-352      AC G3XGT6.1
#=GS C7DSK6_HBV/1-341      AC C7DSK6.1
#=GS Q9WP94_HBV/1-354      AC Q9WP94.1
#=GS D5LCV4_HBV/1-352      AC D5LCV4.1
#=GS B7TUR2_HBV/1-352      AC B7TUR2.1
#=GS D3YGI5_HBV/1-341      AC D3YGI5.1
#=GS I0DD93_HBV/1-328      AC I0DD93.1
#=GS Q8B5R0_HBV/1-190      AC Q8B5R0.1
#=GS X4YR90_HBV/1-352      AC X4YR90.1
#=GS G3XGY2_HBV/1-343      AC G3XGY2.1
#=GS S6A014_HBV/1-340      AC S6A014.1
#=GS C9WDH9_HBV/1-337      AC C9WDH9.1
#=GS Q20BU3_HBV/1-57       AC Q20BU3.1
#=GS M1G255_9HEPA/65-219   AC M1G255.1
#=GS I6Y0Z3_HBV/1-350      AC I6Y0Z3.1
#=GS Q4FDA3_HBV/1-352      AC Q4FDA3.1
#=GS X4ZEX9_HBV/1-352      AC X4ZEX9.1
#=GS L7R7U8_HBV/1-341      AC L7R7U8.1
#=GS C1K222_HBV/299-330    AC C1K222.1
#=GS A6MG26_HBV/1-352      AC A6MG26.1
#=GS D3YGH9_HBV/1-341      AC D3YGH9.1
#=GS C7DM58_HBV/1-351      AC C7DM58.1
#=GS E5RPX9_HBV/1-343      AC E5RPX9.1
#=GS D7NKS3_HBV/1-341      AC D7NKS3.1
#=GS D0QP45_HBV/1-352      AC D0QP45.2
#=GS B5B4C0_HBV/236-291    AC B5B4C0.1
#=GS E9L2F7_HBV/1-171      AC E9L2F7.1
#=GS B9VL17_HBV/1-352      AC B9VL17.1
#=GS S5ZEM6_HBV/1-338      AC S5ZEM6.1
#=GS A1BLQ5_HBV/1-52       AC A1BLQ5.1
#=GS H3K3D7_HBV/1-354      AC H3K3D7.1
#=GS Q80J87_HBV/1-352      AC Q80J87.1
#=GS D5LEI9_HBV/1-352      AC D5LEI9.1
#=GS DPOL_HBVF1/1-352      AC Q05486.1
#=GS W6HWI5_HBV/1-315      AC W6HWI5.1
#=GS B5ATC8_HBV/270-318    AC B5ATC8.1
#=GS F5C0R6_HBV/1-351      AC F5C0R6.1
#=GS I0C8J4_HBV/1-350      AC I0C8J4.1
#=GS X4YXT7_HBV/1-352      AC X4YXT7.1
#=GS C7AYN1_HBV/1-352      AC C7AYN1.1
#=GS L7R8K1_HBV/1-352      AC L7R8K1.1
#=GS U3REQ7_HBV/1-218      AC U3REQ7.1
#=GS I0DC70_HBV/1-328      AC I0DC70.1
#=GS F5C0Z8_HBV/1-354      AC F5C0Z8.1
#=GS S5ZZT5_HBV/1-340      AC S5ZZT5.1
#=GS Q96846_HBV/1-341      AC Q96846.1
#=GS A9CM37_HBV/1-352      AC A9CM37.1
#=GS E0ZRY7_HBV/1-351      AC E0ZRY7.1
#=GS D0E5N8_HBV/1-352      AC D0E5N8.1
#=GS D5LBS5_HBV/1-352      AC D5LBS5.1
#=GS B2LRW3_HBV/1-352      AC B2LRW3.1
#=GS X4YYU9_HBV/1-352      AC X4YYU9.1
#=GS Q9WRK2_HBV/1-354      AC Q9WRK2.1
#=GS M4Q802_HBV/1-171      AC M4Q802.1
#=GS I0C8Z2_HBV/1-354      AC I0C8Z2.1
#=GS Q9WNS2_HBV/1-341      AC Q9WNS2.1
#=GS E9L5C8_HBV/1-352      AC E9L5C8.1
#=GS B9VKT5_HBV/1-352      AC B9VKT5.1
#=GS Q6QZR0_9HEPA/59-222   AC Q6QZR0.1
#=GS Q80GV8_HBV/1-352      AC Q80GV8.1
#=GS G4XI33_HBV/1-160      AC G4XI33.1
#=GS B5TFJ3_HBV/1-112      AC B5TFJ3.1
#=GS A5JI83_HBV/1-112      AC A5JI83.1
#=GS S5ZDS3_HBV/1-341      AC S5ZDS3.1
#=GS X4YYK3_HBV/1-352      AC X4YYK3.1
#=GS B1ABN4_HBV/1-352      AC B1ABN4.1
#=GS D0EEM5_HBV/1-354      AC D0EEM5.1
#=GS B5B4B4_HBV/1-238      AC B5B4B4.1
#=GS G4XHW5_HBV/1-160      AC G4XHW5.1
#=GS S5ZSG4_HBV/272-303    AC S5ZSG4.1
#=GS B8PTG6_HBV/1-341      AC B8PTG6.1
#=GS I0C995_HBV/1-341      AC I0C995.1
#=GS D9U5N3_HBV/1-286      AC D9U5N3.1
#=GS Q918J6_HBV/1-352      AC Q918J6.1
#=GS J7IM57_HBV/1-352      AC J7IM57.1
#=GS B9VKG4_HBV/1-348      AC B9VKG4.1
#=GS Q4FDB1_HBV/1-352      AC Q4FDB1.1
#=GS I0C8A0_HBV/1-354      AC I0C8A0.1
#=GS L7R7N7_HBV/1-352      AC L7R7N7.1
#=GS S6A6X8_HBV/1-343      AC S6A6X8.1
#=GS DPOL_GSHV/1-390       AC P03161.1
#=GS D7NKR7_HBV/1-341      AC D7NKR7.1
#=GS L7R7M2_HBV/1-341      AC L7R7M2.1
#=GS C7DM10_HBV/1-341      AC C7DM10.1
#=GS L7R7E9_HBV/1-352      AC L7R7E9.1
#=GS X4YHT5_HBV/1-341      AC X4YHT5.1
#=GS H9XRI1_HBV/1-91       AC H9XRI1.1
#=GS A5LG66_HBV/1-352      AC A5LG66.1
#=GS S6A6T6_HBV/1-319      AC S6A6T6.1
#=GS G1C8D4_HBV/1-341      AC G1C8D4.1
#=GS B0FCJ1_HBV/1-352      AC B0FCJ1.1
#=GS I0DGB6_HBV/1-352      AC I0DGB6.1
#=GS F5C7N9_HBV/1-352      AC F5C7N9.1
#=GS G1E7Q9_HBV/1-220      AC G1E7Q9.1
#=GS Q56J18_HBV/1-341      AC Q56J18.1
#=GS D3YFX2_HBV/1-341      AC D3YFX2.1
#=GS X4Z0W9_HBV/1-352      AC X4Z0W9.1
#=GS C7DMN8_HBV/1-351      AC C7DMN8.1
#=GS G9G9R4_HBV/1-341      AC G9G9R4.1
#=GS I0C895_HBV/1-354      AC I0C895.1
#=GS L8B222_HBV/1-220      AC L8B222.1
#=GS F5C0T3_HBV/1-351      AC F5C0T3.1
#=GS D9U1P3_HBV/1-352      AC D9U1P3.1
#=GS R9Q8I1_HBV/1-114      AC R9Q8I1.1
#=GS F5C140_HBV/1-354      AC F5C140.1
#=GS X4Z1A6_HBV/1-332      AC X4Z1A6.1
#=GS K9MC25_HBV/1-24       AC K9MC25.1
#=GS F5C118_HBV/281-320    AC F5C118.1
#=GS M9PN22_HBV/1-49       AC M9PN22.1
#=GS B5M5S4_HBV/282-325    AC B5M5S4.1
#=GS B5TFA9_HBV/1-112      AC B5TFA9.1
#=GS D5LBV7_HBV/1-352      AC D5LBV7.1
#=GS X2GCS6_HBV/1-351      AC X2GCS6.1
#=GS W0SKU8_HBV/1-352      AC W0SKU8.1
#=GS D0EDS9_HBV/1-340      AC D0EDS9.1
#=GS Q70B75_HBV/1-109      AC Q70B75.1
#=GS Q9QAD0_HBV/1-352      AC Q9QAD0.1
#=GS I0C9D0_HBV/1-334      AC I0C9D0.1
#=GS C3W4B8_HBV/1-341      AC C3W4B8.1
#=GS F5C154_HBV/1-354      AC F5C154.1
#=GS G3XH32_HBV/1-332      AC G3XH32.1
#=GS L7R7J4_HBV/1-352      AC L7R7J4.1
#=GS G3XH26_HBV/1-332      AC G3XH26.1
#=GS H1ACY8_HBV/1-352      AC H1ACY8.1
#=GS S5ZLR1_HBV/1-352      AC S5ZLR1.1
#=GS T1YUB8_HBV/1-352      AC T1YUB8.1
#=GS B3V8T2_HBV/1-352      AC B3V8T2.1
#=GS S6A727_HBV/1-341      AC S6A727.1
#=GS I0C9E4_HBV/1-338      AC I0C9E4.1
#=GS H9XRV7_HBV/1-91       AC H9XRV7.1
#=GS S5ZEG8_HBV/1-317      AC S5ZEG8.1
#=GS G4XHZ4_HBV/1-160      AC G4XHZ4.1
#=GS K9MDK7_HBV/1-24       AC K9MDK7.1
#=GS Q8B4B8_HBV/1-341      AC Q8B4B8.1
#=GS F5C126_HBV/1-354      AC F5C126.1
#=GS F5C107_HBV/1-354      AC F5C107.1
#=GS C3W4K6_HBV/1-341      AC C3W4K6.1
#=GS F5C186_HBV/1-354      AC F5C186.1
#=GS DPOL_HBVA9/1-354      AC Q4R1R9.1
#=GS S5ZSW8_HBV/1-340      AC S5ZSW8.1
#=GS B5TXK7_HBV/1-352      AC B5TXK7.1
#=GS D0E6C2_HBV/1-352      AC D0E6C2.1
#=GS X4ZFM7_HBV/1-352      AC X4ZFM7.1
#=GS S5ZSY3_HBV/1-341      AC S5ZSY3.1
#=GS B7TUN6_HBV/1-352      AC B7TUN6.1
#=GS T1YVL8_HBV/1-352      AC T1YVL8.1
#=GS F5C125_HBV/1-354      AC F5C125.1
#=GS F5C124_HBV/1-354      AC F5C124.1
#=GS I0DDE6_HBV/1-328      AC I0DDE6.1
#=GS L0BEB1_HBV/1-210      AC L0BEB1.1
#=GS T1YUC9_HBV/1-352      AC T1YUC9.1
#=GS A1BLV0_HBV/1-52       AC A1BLV0.1
#=GS H9XQS5_HBV/1-91       AC H9XQS5.1
#=GS H6UGB1_HBV/1-341      AC H6UGB1.1
#=GS A6MGC5_HBV/1-352      AC A6MGC5.1
#=GS B2Y6X4_HBV/1-341      AC B2Y6X4.1
#=GS L8B2A8_HBV/1-341      AC L8B2A8.1
#=GS G3XGW8_HBV/1-343      AC G3XGW8.1
#=GS Q6XGL3_HBV/1-354      AC Q6XGL3.1
#=GS G4XIA4_HBV/1-130      AC G4XIA4.1
#=GS B5TXU7_HBV/1-352      AC B5TXU7.1
#=GS B5BPS3_HBV/1-352      AC B5BPS3.1
#=GS O91529_HBV/1-352      AC O91529.1
#=GS D3XGB0_HBV/1-351      AC D3XGB0.1
#=GS S6A6T8_HBV/1-352      AC S6A6T8.1
#=GS I1UYX5_HBV/1-166      AC I1UYX5.1
#=GS Q4FDL4_HBV/1-352      AC Q4FDL4.1
#=GS B9VL01_HBV/1-352      AC B9VL01.1
#=GS H6WFN2_HBV/1-112      AC H6WFN2.1
#=GS Q8B5R2_HBV/1-203      AC Q8B5R2.1
#=GS S6A715_HBV/1-352      AC S6A715.1
#=GS C7AY60_HBV/1-354      AC C7AY60.1
#=GS I3VNV2_HBV/1-352      AC I3VNV2.1
#=GS U3RCF0_HBV/1-221      AC U3RCF0.1
#=GS D5LEF4_HBV/1-352      AC D5LEF4.1
#=GS G1E8J9_HBV/1-327      AC G1E8J9.1
#=GS S5ZZX1_HBV/1-341      AC S5ZZX1.1
#=GS B5M5Y4_HBV/1-352      AC B5M5Y4.1
#=GS I0DGI2_HBV/1-352      AC I0DGI2.1
#=GS A9QPZ4_HBV/1-351      AC A9QPZ4.1
#=GS D9U5E2_HBV/1-352      AC D9U5E2.1
#=GS B9VKK3_HBV/1-352      AC B9VKK3.1
#=GS D2JMZ4_HBV/1-352      AC D2JMZ4.1
#=GS D0E596_HBV/1-352      AC D0E596.1
#=GS D3YGF5_HBV/1-341      AC D3YGF5.1
#=GS Q4JQG7_HBV/1-354      AC Q4JQG7.1
#=GS B9VKL9_HBV/1-352      AC B9VKL9.1
#=GS I0DGK8_HBV/1-352      AC I0DGK8.1
#=GS I1VGT3_HBV/1-164      AC I1VGT3.1
#=GS H9XSY3_HBV/1-77       AC H9XSY3.1
#=GS Q8B4F2_HBV/1-352      AC Q8B4F2.1
#=GS W6HZR9_HBV/1-304      AC W6HZR9.1
#=GS C7DMX3_HBV/1-351      AC C7DMX3.1
#=GS A5GZJ2_HBV/1-352      AC A5GZJ2.1
#=GS Q8JN05_HBV/1-352      AC Q8JN05.1
#=GS Q20C22_HBV/1-57       AC Q20C22.1
#=GS L7R7X3_HBV/1-341      AC L7R7X3.1
#=GS G1E883_HBV/1-341      AC G1E883.1
#=GS K7QGD5_HBV/1-352      AC K7QGD5.1
#=GS H6UNA4_HBV/1-341      AC H6UNA4.1
#=GS Q0PMM3_HBV/1-352      AC Q0PMM3.1
#=GS C7AYZ3_HBV/1-354      AC C7AYZ3.1
#=GS R4P3I8_HBV/1-352      AC R4P3I8.1
#=GS B9VK70_HBV/1-352      AC B9VK70.1
#=GS Q19SY8_HBV/1-341      AC Q19SY8.1
#=GS Q8QZP4_HBV/1-265      AC Q8QZP4.1
#=GS M9PM92_HBV/1-250      AC M9PM92.1
#=GS C7DN68_HBV/1-351      AC C7DN68.1
#=GS Q20C28_HBV/1-57       AC Q20C28.1
#=GS B5M5L5_HBV/1-352      AC B5M5L5.1
#=GS I0C9F0_HBV/1-352      AC I0C9F0.1
#=GS I0C898_HBV/1-354      AC I0C898.1
#=GS C1K1J8_HBV/1-352      AC C1K1J8.1
#=GS D0E5K7_HBV/1-352      AC D0E5K7.1
#=GS E5RD25_HBV/1-352      AC E5RD25.1
#=GS B5M5K4_HBV/1-352      AC B5M5K4.1
#=GS B5TF61_HBV/1-112      AC B5TF61.1
#=GS Q20BP1_HBV/1-57       AC Q20BP1.1
#=GS D0E599_HBV/1-352      AC D0E599.1
#=GS B3VLG6_HBV/1-176      AC B3VLG6.1
#=GS Q81134_HBV/1-352      AC Q81134.1
#=GS B1Q2X0_HBVDR/1-352    AC B1Q2X0.1
#=GS B4YL57_HBV/1-239      AC B4YL57.1
#=GS S5ZFR8_HBV/1-336      AC S5ZFR8.1
#=GS C7DMR8_HBV/1-351      AC C7DMR8.1
#=GS S5ZZQ5_HBV/1-350      AC S5ZZQ5.1
#=GS D0E5W8_HBV/1-352      AC D0E5W8.1
#=GS I0C8T3_HBV/1-341      AC I0C8T3.1
#=GS I0DDD8_HBV/1-328      AC I0DDD8.1
#=GS I0C880_HBV/1-354      AC I0C880.1
#=GS B5ASZ2_HBV/1-352      AC B5ASZ2.1
#=GS W8PRU8_HBV/289-321    AC W8PRU8.1
#=GS L7R8Z5_HBV/1-352      AC L7R8Z5.1
#=GS R9Q8S5_HBV/1-114      AC R9Q8S5.1
#=GS I0DGB7_HBV/1-352      AC I0DGB7.1
#=GS Q7TDP8_HBV/1-352      AC Q7TDP8.1
#=GS Q8JXJ8_HBV/1-354      AC Q8JXJ8.1
#=GS H9XQY0_HBV/1-91       AC H9XQY0.1
#=GS J7H040_HBV/1-152      AC J7H040.1
#=GS B4YL91_HBV/1-341      AC B4YL91.1
#=GS W8NZ59_HBV/1-350      AC W8NZ59.1
#=GS F5C0V3_HBV/1-354      AC F5C0V3.1
#=GS Q20BV1_HBV/1-57       AC Q20BV1.1
#=GS K7QGC6_HBV/1-341      AC K7QGC6.1
#=GS L8AYK5_HBV/228-317    AC L8AYK5.1
#=GS I0C8B6_HBV/1-354      AC I0C8B6.1
#=GS B9VL52_HBV/1-352      AC B9VL52.1
#=GS K4N2S6_HBV/1-352      AC K4N2S6.1
#=GS D0EE74_HBV/1-354      AC D0EE74.1
#=GS S5ZK85_HBV/1-342      AC S5ZK85.1
#=GS G9G9C5_HBV/1-341      AC G9G9C5.1
#=GS B4YKY3_HBV/1-341      AC B4YKY3.1
#=GS K7QH21_HBV/1-352      AC K7QH21.1
#=GS Q9YQ41_HBV/1-167      AC Q9YQ41.1
#=GS W6HZN4_HBV/1-315      AC W6HZN4.1
#=GS F5C1C4_HBV/1-341      AC F5C1C4.1
#=GS B7TT97_HBV/1-352      AC B7TT97.1
#=GS F5C187_HBV/1-354      AC F5C187.1
#=GS D6QVX7_HBV/1-352      AC D6QVX7.1
#=GS I0C8U5_HBV/1-354      AC I0C8U5.1
#=GS D0EDV5_HBV/1-341      AC D0EDV5.1
#=GS D0UDT9_HBV/1-352      AC D0UDT9.1
#=GS D2JMF1_HBV/1-352      AC D2JMF1.1
#=GS D0E6K8_HBV/1-352      AC D0E6K8.1
#=GS F5C0H4_HBV/1-341      AC F5C0H4.1
#=GS G9G956_HBV/1-341      AC G9G956.1
#=GS D0E5W0_HBV/1-352      AC D0E5W0.1
#=GS I0C8J0_HBV/1-335      AC I0C8J0.1
#=GS I0C9B6_HBV/1-334      AC I0C9B6.1
#=GS W8SPL4_HBV/1-354      AC W8SPL4.1
#=GS I0C9H8_HBV/1-344      AC I0C9H8.1
#=GS A8IET3_HBV/1-52       AC A8IET3.1
#=GS X4ZFC9_HBV/1-352      AC X4ZFC9.1
#=GS C1K1Y8_HBV/1-342      AC C1K1Y8.1
#=GS Q8B5Q5_HBV/1-190      AC Q8B5Q5.1
#=GS B5M5H8_HBV/1-352      AC B5M5H8.1
#=GS I0C993_HBV/1-341      AC I0C993.1
#=GS D9U5N3_HBV/283-316    AC D9U5N3.1
#=GS B7TU95_HBV/1-352      AC B7TU95.1
#=GS R9Q856_HBV/1-114      AC R9Q856.1
#=GS S5ZDP2_HBV/1-352      AC S5ZDP2.1
#=GS B5M612_HBV/1-352      AC B5M612.1
#=GS S6A6T3_HBV/1-340      AC S6A6T3.1
#=GS C7DQQ6_HBV/1-354      AC C7DQQ6.1
#=GS F5C190_HBV/1-354      AC F5C190.1
#=GS I0DD36_HBV/1-317      AC I0DD36.1
#=GS D8KY01_HBV/1-352      AC D8KY01.1
#=GS I4CJR5_HBV/1-183      AC I4CJR5.1
#=GS R9Q8U5_HBV/1-114      AC R9Q8U5.1
#=GS Q8QXQ1_HBV/1-341      AC Q8QXQ1.1
#=GS Q805P7_HBV/1-352      AC Q805P7.1
#=GS Q8B4F4_HBV/1-352      AC Q8B4F4.1
#=GS Q9WP89_HBV/1-283      AC Q9WP89.1
#=GS H6UN41_HBV/1-341      AC H6UN41.1
#=GS B9VKJ2_HBV/272-303    AC B9VKJ2.1
#=GS Q68RP3_HBV/1-352      AC Q68RP3.1
#=GS R4P386_HBV/1-352      AC R4P386.1
#=GS C0IMV0_HBV/1-354      AC C0IMV0.1
#=GS Q9WP81_HBV/210-289    AC Q9WP81.1
#=GS L0CNG1_HBV/1-341      AC L0CNG1.1
#=GS D0EEC6_HBV/1-354      AC D0EEC6.1
#=GS I2DB68_HBV/1-354      AC I2DB68.1
#=GS S6A6W5_HBV/1-354      AC S6A6W5.1
#=GS L7R8G6_HBV/1-352      AC L7R8G6.1
#=GS Q6XGS6_HBV/1-354      AC Q6XGS6.1
#=GS S5ZEX9_HBV/1-317      AC S5ZEX9.1
#=GS S5ZTQ1_HBV/1-320      AC S5ZTQ1.1
#=GS B4ZYW8_HBV/223-280    AC B4ZYW8.1
#=GS A5JJ36_HBV/70-125     AC A5JJ36.1
#=GS D7NKX7_HBV/1-341      AC D7NKX7.1
#=GS K7QGZ3_HBV/1-352      AC K7QGZ3.1
#=GS Q91IF4_HBV/2-161      AC Q91IF4.1
#=GS X4ZF57_HBV/1-352      AC X4ZF57.1
#=GS I0DE52_HBV/1-328      AC I0DE52.1
#=GS K9MD50_HBV/1-352      AC K9MD50.1
#=GS X2G9P8_HBV/1-351      AC X2G9P8.1
#=GS H9XQD0_HBV/1-91       AC H9XQD0.1
#=GS Q5U7V1_HBV/1-341      AC Q5U7V1.1
#=GS H6V5M0_HBV/1-341      AC H6V5M0.1
#=GS V5JE34_HBV/1-354      AC V5JE34.1
#=GS H6UG89_HBV/1-341      AC H6UG89.1
#=GS E0AD08_9HEPA/53-285   AC E0AD08.1
#=GS Q9WP89_HBV/282-328    AC Q9WP89.1
#=GS J7ICS1_HBV/1-354      AC J7ICS1.1
#=GS I0C944_HBV/1-354      AC I0C944.1
#=GS D2U638_HBV/1-351      AC D2U638.1
#=GS D4QGJ9_HBV/1-341      AC D4QGJ9.1
#=GS R9Q8D8_HBV/1-114      AC R9Q8D8.1
#=GS D6QW38_HBV/1-352      AC D6QW38.1
#=GS D6QVM7_HBV/1-352      AC D6QVM7.1
#=GS A5JJ33_HBV/1-180      AC A5JJ33.1
#=GS I4CJR3_HBV/1-183      AC I4CJR3.1
#=GS W0SKU0_HBV/1-352      AC W0SKU0.1
#=GS C7DSH8_HBV/1-341      AC C7DSH8.1
#=GS S5ZEI9_HBV/1-352      AC S5ZEI9.1
#=GS B4ZYW3_HBV/1-340      AC B4ZYW3.1
#=GS I0DE72_HBV/1-328      AC I0DE72.1
#=GS C7AYR8_HBV/1-354      AC C7AYR8.1
#=GS A9QPX4_HBV/1-351      AC A9QPX4.1
#=GS B3V3Q1_HBV/284-321    AC B3V3Q1.1
#=GS F5C0J0_HBV/1-341      AC F5C0J0.1
#=GS S5ZSJ8_HBV/1-341      AC S5ZSJ8.1
#=GS S5ZEW5_HBV/1-341      AC S5ZEW5.1
#=GS Q9QMK1_HBV/1-352      AC Q9QMK1.1
#=GS L7R8N1_HBV/1-341      AC L7R8N1.1
#=GS S5ZTH4_HBV/1-317      AC S5ZTH4.1
#=GS S6A059_HBV/1-337      AC S6A059.1
#=GS Q9QMN3_HBV/283-332    AC Q9QMN3.1
#=GS DPOL_WHV1/5-388       AC P03160.1
#=GS R9Q7T1_HBV/1-99       AC R9Q7T1.1
#=GS B5BPV0_HBV/1-340      AC B5BPV0.1
#=GS W8NZA8_HBV/1-352      AC W8NZA8.1
#=GS B9VKB0_HBV/1-352      AC B9VKB0.1
#=GS F5C120_HBV/1-284      AC F5C120.1
#=GS F4ZCB9_HBV/1-49       AC F4ZCB9.1
#=GS I0DD25_HBV/1-328      AC I0DD25.1
#=GS Q2F509_HBV/1-351      AC Q2F509.1
#=GS S6A6T0_HBV/1-332      AC S6A6T0.1
#=GS S6A718_HBV/1-337      AC S6A718.1
#=GS Q8UYY1_HHBV/73-354    AC Q8UYY1.1
#=GS B7TUE8_HBV/1-341      AC B7TUE8.1
#=GS M1G269_9HEPA/73-312   AC M1G269.1
#=GS I7LSS0_HBV/1-341      AC I7LSS0.1
#=GS Q3ZKP1_HBV/1-351      AC Q3ZKP1.1
#=GS Q9QRQ9_HBV/136-175    AC Q9QRQ9.1
#=GS Q4FD83_HBV/1-352      AC Q4FD83.1
#=GS Q20BR9_HBV/1-57       AC Q20BR9.1
#=GS B5M5U4_HBV/1-352      AC B5M5U4.1
#=GS A6MFZ8_HBV/1-352      AC A6MFZ8.1
#=GS V5JE28_HBV/1-354      AC V5JE28.1
#=GS I0DGI0_HBV/1-352      AC I0DGI0.1
#=GS C1K1M5_HBV/1-276      AC C1K1M5.1
#=GS Q67907_HBV/541-832    AC Q67907.1
#=GS H9XR86_HBV/1-91       AC H9XR86.1
#=GS C7DY93_HBV/1-347      AC C7DY93.1
#=GS X2G4S5_HBV/1-351      AC X2G4S5.1
#=GS I0C8M9_HBV/1-335      AC I0C8M9.1
#=GS G4XI71_HBV/1-160      AC G4XI71.1
#=GS B2CS92_HBV/1-352      AC B2CS92.1
#=GS I0C8E5_HBV/1-354      AC I0C8E5.1
#=GS X4YHW2_HBV/1-233      AC X4YHW2.1
#=GS M4QJC1_HBV/1-171      AC M4QJC1.1
#=GS D0UE54_HBV/1-352      AC D0UE54.1
#=GS B9VKV1_HBV/1-352      AC B9VKV1.1
#=GS Q5EDT7_HBV/1-341      AC Q5EDT7.1
#=GS D0E5U9_HBV/1-352      AC D0E5U9.1
#=GS D0E6G8_HBV/1-352      AC D0E6G8.1
#=GS S6A006_HBV/1-336      AC S6A006.1
#=GS A5JIG3_HBV/1-112      AC A5JIG3.1
#=GS S5ZZY2_HBV/1-341      AC S5ZZY2.1
#=GS F5C105_HBV/1-354      AC F5C105.1
#=GS D3TIG1_HBV/1-352      AC D3TIG1.1
#=GS B7TTZ3_HBV/1-352      AC B7TTZ3.1
#=GS S5ZTB1_HBV/1-342      AC S5ZTB1.1
#=GS I4CJT5_HBV/1-30       AC I4CJT5.1
#=GS F5C1B1_HBV/1-354      AC F5C1B1.1
#=GS F5C0V5_HBV/1-354      AC F5C0V5.1
#=GS Q4R1R4_HBV/1-38       AC Q4R1R4.1
#=GS U3RGX7_HBV/1-221      AC U3RGX7.1
#=GS Q20C00_HBV/1-53       AC Q20C00.1
#=GS S5ZF84_HBV/1-350      AC S5ZF84.1
#=GS D3YGH3_HBV/1-341      AC D3YGH3.1
#=GS L0HCS5_HBV/1-352      AC L0HCS5.1
#=GS Q8B4D3_HBV/1-328      AC Q8B4D3.1
#=GS G1C932_HBV/1-341      AC G1C932.1
#=GS Q77BG8_HBV/1-167      AC Q77BG8.1
#=GS C6FHW4_HBV/1-354      AC C6FHW4.1
#=GS S6A710_HBV/1-343      AC S6A710.1
#=GS S5ZT14_HBV/1-352      AC S5ZT14.1
#=GS Q7TDQ7_HBV/1-352      AC Q7TDQ7.1
#=GS D0E5F4_HBV/1-352      AC D0E5F4.1
#=GS DPOL_DHBV1/109-389    AC P03162.2
#=GS I0C872_HBV/1-354      AC I0C872.1
#=GS B2LW81_HBV/1-352      AC B2LW81.1
#=GS L0BDA9_HBV/1-210      AC L0BDA9.1
#=GS B5B4N0_HBV/1-352      AC B5B4N0.1
#=GS S5ZDZ3_HBV/1-336      AC S5ZDZ3.1
#=GS Q77BF3_HBV/1-167      AC Q77BF3.1
#=GS J7H0E3_HBV/292-323    AC J7H0E3.1
#=GS B3IWV1_HBV/1-352      AC B3IWV1.1
#=GS D2JMS8_HBV/1-352      AC D2JMS8.1
#=GS B4YTA9_HBV/1-352      AC B4YTA9.1
#=GS I0DD01_HBV/1-328      AC I0DD01.1
#=GS Q2I359_HBV/1-341      AC Q2I359.1
#=GS F5C1T3_HBV/1-352      AC F5C1T3.1
#=GS K4PXQ2_HBV/1-85       AC K4PXQ2.1
#=GS D3TK50_HBV/1-352      AC D3TK50.1
#=GS C7DNI1_HBV/1-351      AC C7DNI1.1
#=GS Q9E8K6_HBV/1-352      AC Q9E8K6.1
#=GS G4XHZ0_HBV/1-160      AC G4XHZ0.1
#=GS S5ZSA1_HBV/1-337      AC S5ZSA1.1
#=GS B7TUU4_HBV/1-352      AC B7TUU4.1
#=GS A5JHY0_HBV/1-112      AC A5JHY0.1
#=GS H9XRL2_HBV/1-91       AC H9XRL2.1
#=GS D3TJC9_HBV/211-306    AC D3TJC9.1
#=GS M9PN00_HBV/1-247      AC M9PN00.1
#=GS S5ZS49_HBV/1-340      AC S5ZS49.1
#=GS Q81096_HBV/1-354      AC Q81096.1
#=GS C9WDT1_HBV/1-351      AC C9WDT1.1
#=GS H9XQU4_HBV/1-91       AC H9XQU4.1
#=GS B0FCN7_HBV/1-352      AC B0FCN7.1
#=GS H6WFH8_HBV/1-112      AC H6WFH8.1
#=GS S5ZSI5_HBV/1-352      AC S5ZSI5.1
#=GS I0C8S4_HBV/1-341      AC I0C8S4.1
#=GS W6HYB4_HBV/1-315      AC W6HYB4.1
#=GS D5LCJ4_HBV/1-352      AC D5LCJ4.1
#=GS Q91C53_HBV/1-347      AC Q91C53.1
#=GS H9XRU1_HBV/1-91       AC H9XRU1.1
#=GS S5ZZU9_HBV/1-341      AC S5ZZU9.1
#=GS Q9WP77_HBV/1-352      AC Q9WP77.1
#=GS X4YXV7_HBV/1-352      AC X4YXV7.1
#=GS S5ZEQ0_HBV/1-336      AC S5ZEQ0.1
#=GS J7H754_HBV/1-152      AC J7H754.1
#=GS L0H844_HBV/1-352      AC L0H844.1
#=GS I6YUT3_HBV/1-352      AC I6YUT3.1
#=GS I4CJR2_HBV/1-183      AC I4CJR2.1
#=GS L0HCF0_HBV/1-352      AC L0HCF0.1
#=GS B5M508_HBV/1-352      AC B5M508.1
#=GS C7DN16_HBV/1-351      AC C7DN16.1
#=GS E0ZRC0_HBV/1-351      AC E0ZRC0.1
#=GS I0C8Y6_HBV/1-354      AC I0C8Y6.1
#=GS C7DMI5_HBV/1-351      AC C7DMI5.1
#=GS E5RPR3_HBV/1-343      AC E5RPR3.1
#=GS H9XRH7_HBV/1-91       AC H9XRH7.1
#=GS E5RPW7_HBV/1-332      AC E5RPW7.1
#=GS S5ZDX8_HBV/1-352      AC S5ZDX8.1
#=GS I0DD44_HBV/1-327      AC I0DD44.1
#=GS D0E5A9_HBV/1-352      AC D0E5A9.1
#=GS C3W415_HBV/1-341      AC C3W415.1
#=GS V5JE10_HBV/1-340      AC V5JE10.1
#=GS K4PX32_HBV/1-81       AC K4PX32.1
#=GS F5C0R9_HBV/1-351      AC F5C0R9.1
#=GS A6MG86_HBV/1-352      AC A6MG86.1
#=GS K9UUY1_HBV/1-352      AC K9UUY1.1
#=GS E5CZ16_HBV/1-352      AC E5CZ16.1
#=GS D2JML4_HBV/1-352      AC D2JML4.1
#=GS S6A0C6_HBV/1-332      AC S6A0C6.1
#=GS A8J4D8_HBV/1-352      AC A8J4D8.1
#=GS Q6RSG2_9HEPA/61-234   AC Q6RSG2.1
#=GS F5C7J7_HBV/1-352      AC F5C7J7.1
#=GS E5F0W2_HBV/1-49       AC E5F0W2.1
#=GS S5ZS34_HBV/1-302      AC S5ZS34.1
#=GS O91536_HBV/1-352      AC O91536.1
#=GS G3E5E3_HBV/1-341      AC G3E5E3.1
#=GS I0C8Q2_HBV/1-341      AC I0C8Q2.1
#=GS I0C8R8_HBV/1-227      AC I0C8R8.1
#=GS F5C0J6_HBV/1-341      AC F5C0J6.1
#=GS I0DCX4_HBV/1-328      AC I0DCX4.1
#=GS F5C0R7_HBV/1-351      AC F5C0R7.1
#=GS A5JIK7_HBV/1-112      AC A5JIK7.1
#=GS G1C959_HBV/1-341      AC G1C959.1
#=GS B9VKU3_HBV/1-352      AC B9VKU3.1
#=GS F5C144_HBV/1-354      AC F5C144.1
#=GS I0DGK2_HBV/1-352      AC I0DGK2.1
#=GS H9XQJ3_HBV/1-91       AC H9XQJ3.1
#=GS G3XGX2_HBV/1-343      AC G3XGX2.1
#=GS G1E7Y7_HBV/1-341      AC G1E7Y7.1
#=GS G1C8K4_HBV/1-341      AC G1C8K4.1
#=GS E3WCQ7_HBV/1-352      AC E3WCQ7.1
#=GS I0DCH9_HBV/1-317      AC I0DCH9.1
#=GS G1E7D5_HBV/1-293      AC G1E7D5.1
#=GS Q4FDL8_HBV/1-352      AC Q4FDL8.1
#=GS A1YTL7_HBV/1-352      AC A1YTL7.1
#=GS A7L373_HBV/1-30       AC A7L373.1
#=GS G3GDQ1_HBV/1-352      AC G3GDQ1.1
#=GS L7R8T7_HBV/1-341      AC L7R8T7.1
#=GS R9Q8A5_HBV/1-114      AC R9Q8A5.1
#=GS I0DCQ4_HBV/1-328      AC I0DCQ4.1
#=GS G1E8J2_HBV/223-280    AC G1E8J2.1
#=GS W8PS45_HBV/1-352      AC W8PS45.1
#=GS S5ZSP1_HBV/1-332      AC S5ZSP1.1
#=GS E0ZRX5_HBV/1-351      AC E0ZRX5.1
#=GS E5RPQ1_HBV/1-329      AC E5RPQ1.1
#=GS E7D6T6_9HEPA/62-340   AC E7D6T6.1
#=GS H9XRI5_HBV/1-91       AC H9XRI5.1
#=GS B3IWW3_HBV/1-352      AC B3IWW3.1
#=GS G3XGZ6_HBV/1-343      AC G3XGZ6.1
#=GS A8IEU0_HBV/1-52       AC A8IEU0.1
#=GS DPOL_HBVD4/1-341      AC Q9QMI1.1
#=GS B5TF26_HBV/1-112      AC B5TF26.1
#=GS Q67889_HBV/1-341      AC Q67889.1
#=GS H6UN84_HBV/1-343      AC H6UN84.1
#=GS G1E7T3_HBV/1-231      AC G1E7T3.1
#=GS I0C8P6_HBV/1-341      AC I0C8P6.1
#=GS B5AT39_HBV/1-352      AC B5AT39.1
#=GS S5ZLR9_HBV/1-340      AC S5ZLR9.1
#=GS B9VJW2_HBV/1-352      AC B9VJW2.1
#=GS I0DD40_HBV/1-317      AC I0DD40.1
#=GS Q765Y3_HBV/1-352      AC Q765Y3.1
#=GS I6YUR9_HBV/1-352      AC I6YUR9.1
#=GS B9W3Z5_HBV/1-354      AC B9W3Z5.1
#=GS F5C0Y5_HBV/1-354      AC F5C0Y5.1
#=GS I0DGJ0_HBV/1-352      AC I0DGJ0.1
#=GS B5TF97_HBV/1-112      AC B5TF97.1
#=GS D0EZ04_HBV/1-341      AC D0EZ04.1
#=GS H6UN29_HBV/1-341      AC H6UN29.1
#=GS C7DM65_HBV/1-351      AC C7DM65.1
#=GS I0DCC1_HBV/1-328      AC I0DCC1.1
#=GS L0BC99_HBV/1-210      AC L0BC99.1
#=GS H6UNC0_HBV/1-341      AC H6UNC0.1
#=GS L8E908_HBV/1-319      AC L8E908.1
#=GS K9MDM4_HBV/1-351      AC K9MDM4.1
#=GS F5C101_HBV/1-354      AC F5C101.1
#=GS F5C1A2_HBV/1-354      AC F5C1A2.1
#=GS Q5R2N1_HBV/1-352      AC Q5R2N1.1
#=GS T2HQZ6_HBV/1-50       AC T2HQZ6.1
#=GS I0DE40_HBV/1-317      AC I0DE40.1
#=GS T1YUB4_HBV/1-352      AC T1YUB4.1
#=GS F5C0T4_HBV/1-351      AC F5C0T4.1
#=GS Q461A4_HBV/1-351      AC Q461A4.1
#=GS I0C8H6_HBV/1-354      AC I0C8H6.1
#=GS A5JIT2_HBV/1-112      AC A5JIT2.1
#=GS G1C8U3_HBV/1-341      AC G1C8U3.1
#=GS I0C8C9_HBV/1-354      AC I0C8C9.1
#=GS Q1PCZ2_HBV/1-352      AC Q1PCZ2.1
#=GS D0E581_HBV/1-352      AC D0E581.1
#=GS C9WD94_HBV/1-341      AC C9WD94.1
#=GS C9WDT8_HBV/1-347      AC C9WDT8.1
#=GS L0BEC0_HBV/1-210      AC L0BEC0.1
#=GS K9MCC1_HBV/1-24       AC K9MCC1.1
#=GS S5ZF08_HBV/1-336      AC S5ZF08.1
#=GS L0BC53_HBV/1-210      AC L0BC53.1
#=GS Q80SD6_HBV/1-341      AC Q80SD6.1
#=GS Q9QMI5_HBV/1-352      AC Q9QMI5.1
#=GS Q77BG6_HBV/1-167      AC Q77BG6.1
#=GS D9U1M2_HBV/1-352      AC D9U1M2.1
#=GS S6A709_HBV/1-342      AC S6A709.1
#=GS H9XR18_HBV/1-91       AC H9XR18.1
#=GS D0E6J2_HBV/1-352      AC D0E6J2.1
#=GS A8J473_HBV/1-352      AC A8J473.1
#=GS H9XQF8_HBV/1-91       AC H9XQF8.1
#=GS D0E6E8_HBV/1-352      AC D0E6E8.1
#=GS U3KUF9_HBV/1-171      AC U3KUF9.1
#=GS I0DDX8_HBV/1-328      AC I0DDX8.1
#=GS D5MSH9_HBV/1-343      AC D5MSH9.1
#=GS E5RPU7_HBV/1-343      AC E5RPU7.1
#=GS Q9IXF3_HBV/1-52       AC Q9IXF3.1
#=GS H9XR42_HBV/1-91       AC H9XR42.1
#=GS C6F5C5_HBV/1-354      AC C6F5C5.1
#=GS B9VKW4_HBV/1-352      AC B9VKW4.1
#=GS D5LD25_HBV/1-352      AC D5LD25.1
#=GS I7JCB9_HBV/1-341      AC I7JCB9.1
#=GS Q67929_HBV/1-291      AC Q67929.1
#=GS Q5Y2B9_HBV/1-354      AC Q5Y2B9.1
#=GS S5ZTK5_HBV/1-332      AC S5ZTK5.1
#=GS G3XGY6_HBV/1-343      AC G3XGY6.1
#=GS Q67833_HBV/1-94       AC Q67833.1
#=GS L7X9Q2_HBV/1-354      AC L7X9Q2.1
#=GS E9L2G3_HBV/1-171      AC E9L2G3.1
#=GS Q9IR28_HBV/1-174      AC Q9IR28.1
#=GS I1UYT9_HBV/1-166      AC I1UYT9.1
#=GS Q5EDQ1_HBV/1-354      AC Q5EDQ1.1
#=GS E0D3B7_HBV/1-352      AC E0D3B7.1
#=GS S5ZT56_HBV/1-340      AC S5ZT56.1
#=GS G3XH10_HBV/1-343      AC G3XH10.1
#=GS H6UG63_HBV/1-341      AC H6UG63.1
#=GS W8P7I4_HBV/1-352      AC W8P7I4.1
#=GS S5ZSE1_HBV/1-352      AC S5ZSE1.1
#=GS U3RER7_HBV/1-218      AC U3RER7.1
#=GS L0BC71_HBV/1-210      AC L0BC71.1
#=GS F5C115_HBV/1-284      AC F5C115.1
#=GS E5CYX7_HBV/1-352      AC E5CYX7.1
#=GS B3GSV7_HBV/1-354      AC B3GSV7.1
#=GS G1E7W9_HBV/1-341      AC G1E7W9.1
#=GS B4YKQ0_HBV/1-354      AC B4YKQ0.1
#=GS Q461D2_HBV/1-351      AC Q461D2.1
#=GS B9VKH6_HBV/1-352      AC B9VKH6.1
#=GS D0E5F7_HBV/1-352      AC D0E5F7.1
#=GS I0C935_HBV/1-354      AC I0C935.1
#=GS A7YEW7_HBV/1-352      AC A7YEW7.1
#=GS W6HWI0_HBV/1-315      AC W6HWI0.1
#=GS I0DE28_HBV/1-328      AC I0DE28.1
#=GS I0C8Z4_HBV/1-354      AC I0C8Z4.1
#=GS L0BE49_HBV/1-210      AC L0BE49.1
#=GS F5C0K4_HBV/1-354      AC F5C0K4.1
#=GS D5MSH1_HBV/1-343      AC D5MSH1.1
#=GS I1UYT0_HBV/1-166      AC I1UYT0.1
#=GS C9WE55_HBV/1-346      AC C9WE55.1
#=GS E7CU87_HBV/1-352      AC E7CU87.1
#=GS G9HVG1_HBV/1-352      AC G9HVG1.1
#=GS B5TF14_HBV/1-112      AC B5TF14.1
#=GS G3XKW5_HBV/1-352      AC G3XKW5.1
#=GS I0C8K7_HBV/1-350      AC I0C8K7.1
#=GS H6UN92_HBV/1-340      AC H6UN92.1
#=GS X4YRA4_HBV/1-352      AC X4YRA4.1
#=GS S5ZKE3_HBV/1-335      AC S5ZKE3.1
#=GS B5M557_HBV/1-352      AC B5M557.1
#=GS H9XQS9_HBV/1-91       AC H9XQS9.1
#=GS D0UDP9_HBV/1-352      AC D0UDP9.1
#=GS Q5DVZ8_HBV/1-352      AC Q5DVZ8.1
#=GS S6A719_HBV/1-331      AC S6A719.1
#=GS F5C0L8_HBV/1-354      AC F5C0L8.1
#=GS I0DG93_HBV/1-352      AC I0DG93.1
#=GS B5BPX4_HBV/1-352      AC B5BPX4.1
#=GS Q9WFA5_9HEPA/61-350   AC Q9WFA5.1
#=GS K4N102_HBV/1-352      AC K4N102.1
#=GS H6WFA2_HBV/1-112      AC H6WFA2.1
#=GS B5M574_HBV/1-352      AC B5M574.1
#=GS C7AYY7_HBV/1-354      AC C7AYY7.1
#=GS I0C8F8_HBV/1-354      AC I0C8F8.1
#=GS E5F0W4_HBV/1-49       AC E5F0W4.1
#=GS M4QJ63_HBV/1-171      AC M4QJ63.1
#=GS I0C930_HBV/1-354      AC I0C930.1
#=GS I0DGK1_HBV/1-352      AC I0DGK1.1
#=GS M1FT10_HBV/1-352      AC M1FT10.1
#=GS H6WFH4_HBV/1-112      AC H6WFH4.1
#=GS I0DDN6_HBV/1-328      AC I0DDN6.1
#=GS D3TJX6_HBV/1-352      AC D3TJX6.1
#=GS G4XHY0_HBV/1-130      AC G4XHY0.1
#=GS F5C1T2_HBV/1-343      AC F5C1T2.1
#=GS H9N855_HBV/1-341      AC H9N855.1
#=GS Q9QAF6_HBV/1-341      AC Q9QAF6.1
#=GS D0E5I6_HBV/1-352      AC D0E5I6.1
#=GS B5M5K0_HBV/1-352      AC B5M5K0.1
#=GS T1YT11_HBV/1-352      AC T1YT11.1
#=GS K7QG54_HBV/1-352      AC K7QG54.1
#=GS I0C8G4_HBV/1-354      AC I0C8G4.1
#=GS I0DDG2_HBV/1-328      AC I0DDG2.1
#=GS L7R8I3_HBV/1-352      AC L7R8I3.1
#=GS E5CYY2_HBV/1-352      AC E5CYY2.1
#=GS V5JE76_HBV/1-354      AC V5JE76.1
#=GS D2JMB1_HBV/1-352      AC D2JMB1.1
#=GS G9G8L2_HBV/1-341      AC G9G8L2.1
#=GS D0UDR4_HBV/1-352      AC D0UDR4.1
#=GS I0C8K3_HBV/1-335      AC I0C8K3.1
#=GS L8E6G9_HBV/1-253      AC L8E6G9.1
#=GS Q8B4D2_HBV/1-325      AC Q8B4D2.1
#=GS B5BPP5_HBV/1-352      AC B5BPP5.1
#=GS I0C9D2_HBV/1-334      AC I0C9D2.1
#=GS J7IMC3_HBV/1-352      AC J7IMC3.1
#=GS M1G267_9HEPA/67-376   AC M1G267.1
#=GS B5B4P4_HBV/1-352      AC B5B4P4.1
#=GS Q9QMK4_HBV/1-352      AC Q9QMK4.1
#=GS G1E835_HBV/1-341      AC G1E835.1
#=GS B9VK78_HBV/1-352      AC B9VK78.1
#=GS K9MDN7_HBV/1-24       AC K9MDN7.1
#=GS L8B222_HBV/218-262    AC L8B222.1
#=GS H6UGE2_HBV/1-341      AC H6UGE2.1
#=GS S5ZKN0_HBV/1-332      AC S5ZKN0.1
#=GS K7QH50_HBV/1-352      AC K7QH50.1
#=GS H9N867_HBV/1-341      AC H9N867.1
#=GS A5GZJ9_HBV/1-352      AC A5GZJ9.1
#=GS A5JHQ1_HBV/1-112      AC A5JHQ1.1
#=GS C7AYQ6_HBV/1-354      AC C7AYQ6.2
#=GS I0C8Y7_HBV/1-354      AC I0C8Y7.1
#=GS K4KGT2_HBV/1-341      AC K4KGT2.1
#=GS B4ZYY6_HBV/1-341      AC B4ZYY6.1
#=GS S5ZF52_HBV/1-340      AC S5ZF52.1
#=GS W8NZN0_HBV/1-352      AC W8NZN0.1
#=GS Q9IXC3_HBV/1-52       AC Q9IXC3.1
#=GS B4ZYZ9_HBV/1-352      AC B4ZYZ9.1
#=GS X4YRW9_HBV/1-352      AC X4YRW9.1
#=GS C3W4K0_HBV/1-341      AC C3W4K0.1
#=GS I0DGJ3_HBV/1-352      AC I0DGJ3.1
#=GS S6A6Y4_HBV/1-352      AC S6A6Y4.1
#=GS C3W4F6_HBV/1-341      AC C3W4F6.1
#=GS H9XQW4_HBV/1-91       AC H9XQW4.1
#=GS D2JZX4_HBV/1-352      AC D2JZX4.1
#=GS H6WFB0_HBV/1-112      AC H6WFB0.1
#=GS A5JIS8_HBV/1-112      AC A5JIS8.1
#=GS D0EE86_HBV/1-354      AC D0EE86.1
#=GS Q9IXF0_HBV/1-52       AC Q9IXF0.1
#=GS E5RPV1_HBV/1-343      AC E5RPV1.1
#=GS I0DDJ3_HBV/1-328      AC I0DDJ3.1
#=GS W6HY96_HBV/1-315      AC W6HY96.1
#=GS C7DMB1_HBV/1-351      AC C7DMB1.1
#=GS Q06AN8_HBV/1-352      AC Q06AN8.1
#=GS D0UE95_HBV/1-352      AC D0UE95.1
#=GS Q20BP5_HBV/1-57       AC Q20BP5.1
#=GS E5RPP5_HBV/1-343      AC E5RPP5.1
#=GS I0DCA5_HBV/1-327      AC I0DCA5.1
#=GS B9VL05_HBV/1-352      AC B9VL05.1
#=GS G0YVN1_HBV/1-341      AC G0YVN1.1
#=GS D9U5H0_HBV/1-351      AC D9U5H0.1
#=GS C7DM17_HBV/1-351      AC C7DM17.1
#=GS F5C1M1_HBV/1-336      AC F5C1M1.1
#=GS D0E6D2_HBV/1-352      AC D0E6D2.1
#=GS B4YL31_HBV/1-341      AC B4YL31.1
#=GS B5TFA5_HBV/1-112      AC B5TFA5.1
#=GS F5C0Q8_HBV/1-351      AC F5C0Q8.1
#=GS J7IFT7_HBV/1-352      AC J7IFT7.1
#=GS Q1JUT8_HBV/1-352      AC Q1JUT8.1
#=GS M4PV95_9HEPA/19-359   AC M4PV95.1
#=GS K4N2N1_HBV/1-352      AC K4N2N1.1
#=GS G9G8Z1_HBV/1-341      AC G9G8Z1.1
#=GS D9U559_HBV/1-347      AC D9U559.1
#=GS G1E8M5_HBV/1-341      AC G1E8M5.1
#=GS B5TXW7_HBV/1-352      AC B5TXW7.1
#=GS S6A6S6_HBV/1-341      AC S6A6S6.1
#=GS B7TU25_HBV/1-352      AC B7TU25.1
#=GS Q5SDJ8_HBV/1-347      AC Q5SDJ8.1
#=GS J7IJE4_HBV/1-352      AC J7IJE4.1
#=GS J7RFP0_HBV/1-347      AC J7RFP0.1
#=GS A5JI51_HBV/1-112      AC A5JI51.1
#=GS F5C0H1_HBV/1-341      AC F5C0H1.1
#=GS A5GZI8_HBV/1-352      AC A5GZI8.1
#=GS F5C1M8_HBV/1-341      AC F5C1M8.1
#=GS Q68RN5_HBV/1-351      AC Q68RN5.1
#=GS Q70B87_HBV/1-105      AC Q70B87.1
#=GS D5LF04_HBV/1-352      AC D5LF04.1
#=GS I0C8A2_HBV/1-354      AC I0C8A2.1
#=GS G3E5J9_HBV/1-341      AC G3E5J9.1
#=GS Q98VM6_HBV/1-346      AC Q98VM6.1
#=GS H9XRX7_HBV/1-91       AC H9XRX7.1
#=GS Q91IN8_HBV/1-203      AC Q91IN8.1
#=GS L0BED1_HBV/1-210      AC L0BED1.1
#=GS I0C937_HBV/1-354      AC I0C937.1
#=GS Q29VF9_HBV/1-351      AC Q29VF9.1
#=GS S5ZFD0_HBV/1-341      AC S5ZFD0.1
#=GS D5LEK3_HBV/1-352      AC D5LEK3.1
#=GS H3K3T3_HBV/1-354      AC H3K3T3.1
#=GS F5C1T6_HBV/1-354      AC F5C1T6.1
#=GS T2HRM6_HBV/1-50       AC T2HRM6.1
#=GS C5WJV4_HBV/1-352      AC C5WJV4.1
#=GS Q9WFB5_9HEPA/63-335   AC Q9WFB5.1
#=GS W8PAK4_HBV/1-352      AC W8PAK4.1
#=GS D0UDU9_HBV/1-352      AC D0UDU9.1
#=GS Q9QMJ8_HBV/1-352      AC Q9QMJ8.1
#=GS C1K1B9_HBV/1-352      AC C1K1B9.1
#=GS B5B485_HBV/1-352      AC B5B485.1
#=GS H6UMZ3_HBV/1-341      AC H6UMZ3.1
#=GS B9VJX0_HBV/236-291    AC B9VJX0.1
#=GS H6WFF8_HBV/1-112      AC H6WFF8.1
#=GS F5C191_HBV/1-354      AC F5C191.1
#=GS Q7TDS1_HBV/1-352      AC Q7TDS1.1
#=GS C1K1W8_HBV/1-352      AC C1K1W8.1
#=GS Q8B4B4_HBV/1-341      AC Q8B4B4.1
#=GS F5C0Z4_HBV/1-354      AC F5C0Z4.1
#=GS Q80H13_HBV/1-352      AC Q80H13.1
#=GS T1YVJ2_HBV/1-352      AC T1YVJ2.1
#=GS Q9QMI9_HBV/1-352      AC Q9QMI9.1
#=GS A5JIN4_HBV/1-112      AC A5JIN4.1
#=GS G4XHX4_HBV/1-160      AC G4XHX4.1
#=GS C7DMZ8_HBV/1-351      AC C7DMZ8.1
#=GS A0MMK6_HBV/1-352      AC A0MMK6.1
#=GS V5NS16_HBV/1-350      AC V5NS16.1
#=GS G9G8W3_HBV/1-340      AC G9G8W3.1
#=GS S5ZKP2_HBV/1-340      AC S5ZKP2.1
#=GS Q99HU3_HBV/1-352      AC Q99HU3.1
#=GS B5TFK9_HBV/1-112      AC B5TFK9.1
#=GS O72884_9HEPA/62-349   AC O72884.1
#=GS A5JII7_HBV/1-112      AC A5JII7.1
#=GS L0BDZ7_HBV/1-210      AC L0BDZ7.1
#=GS H6UNC8_HBV/1-340      AC H6UNC8.1
#=GS Q9WP72_HBV/1-324      AC Q9WP72.1
#=GS I0DDC2_HBV/1-328      AC I0DDC2.1
#=GS Q918N9_9HEPA/5-393    AC Q918N9.1
#=GS D5LEH5_HBV/1-352      AC D5LEH5.1
#=GS B5M5T0_HBV/1-352      AC B5M5T0.1
#=GS U5K634_HBV/3-50       AC U5K634.1
#=GS Q7T668_HBV/1-341      AC Q7T668.1
#=GS F5C7L1_HBV/1-352      AC F5C7L1.1
#=GS W8NZK0_HBV/1-352      AC W8NZK0.1
#=GS D4QGJ6_HBV/1-341      AC D4QGJ6.1
#=GS A5JHV2_HBV/1-112      AC A5JHV2.1
#=GS D2JMP6_HBV/1-346      AC D2JMP6.1
#=GS F5C0U0_HBV/1-351      AC F5C0U0.1
#=GS B5TXP5_HBV/1-352      AC B5TXP5.1
#=GS I0DDM0_HBV/1-328      AC I0DDM0.1
#=GS I0C8T4_HBV/1-341      AC I0C8T4.1
#=GS Q81120_HBV/1-352      AC Q81120.1
#=GS B4ZZ11_HBV/1-341      AC B4ZZ11.1
#=GS S5ZL45_HBV/1-340      AC S5ZL45.1
#=GS W6HWK2_HBV/1-315      AC W6HWK2.1
#=GS Q80GW5_HBV/282-365    AC Q80GW5.1
#=GS A6MFZ3_HBV/1-352      AC A6MFZ3.1
#=GS D6QVY4_HBV/1-352      AC D6QVY4.1
#=GS Q8UYX5_HHBV/70-355    AC Q8UYX5.1
#=GS H6WF30_HBV/1-112      AC H6WF30.1
#=GS J7RFM7_HBV/1-352      AC J7RFM7.1
#=GS X4Z0L6_HBV/1-352      AC X4Z0L6.1
#=GS D0EE54_HBV/1-354      AC D0EE54.1
#=GS S5ZSU8_HBV/1-341      AC S5ZSU8.1
#=GS S6A6V6_HBV/1-341      AC S6A6V6.1
#=GS O91524_HBV/1-352      AC O91524.1
#=GS B2CY02_HBV/1-352      AC B2CY02.1
#=GS X4YHV6_HBV/1-341      AC X4YHV6.1
#=GS A4F530_HBV/30-360     AC A4F530.1
#=GS H9XRY1_HBV/1-91       AC H9XRY1.1
#=GS D0E610_HBV/1-350      AC D0E610.1
#=GS F5C121_HBV/281-320    AC F5C121.1
#=GS D6QVZ8_HBV/1-352      AC D6QVZ8.1
#=GS H2ER51_HBV/1-352      AC H2ER51.1
#=GS T1YU83_HBV/1-352      AC T1YU83.1
#=GS B7TTM6_HBV/1-347      AC B7TTM6.1
#=GS X4ZCY1_HBV/1-352      AC X4ZCY1.1
#=GS I0C875_HBV/1-354      AC I0C875.1
#=GS S5ZSK8_HBV/1-334      AC S5ZSK8.1
#=GS H6UND2_HBV/1-333      AC H6UND2.1
#=GS G1C906_HBV/1-341      AC G1C906.1
#=GS K7QH17_HBV/1-352      AC K7QH17.1
#=GS I0DGF7_HBV/1-352      AC I0DGF7.1
#=GS C7DNI8_HBV/1-351      AC C7DNI8.1
#=GS S6A6Z2_HBV/1-340      AC S6A6Z2.1
#=GS I0C8M6_HBV/1-335      AC I0C8M6.1
#=GS B5TFC1_HBV/1-112      AC B5TFC1.1
#=GS G3XGW2_HBV/1-343      AC G3XGW2.1
#=GS B5TF02_HBV/1-112      AC B5TF02.1
#=GS K9MDM8_HBV/1-24       AC K9MDM8.1
#=GS H9XRS5_HBV/1-91       AC H9XRS5.1
#=GS Q19T02_HBV/1-340      AC Q19T02.1
#=GS F5C0X9_HBV/1-354      AC F5C0X9.1
#=GS L7R7U1_HBV/1-352      AC L7R7U1.1
#=GS C7DME5_HBV/1-351      AC C7DME5.1
#=GS I3XMT0_HBV/1-354      AC I3XMT0.1
#=GS S5ZFW1_HBV/1-320      AC S5ZFW1.1
#=GS S5ZFU4_HBV/1-340      AC S5ZFU4.1
#=GS E5CZ46_HBV/1-352      AC E5CZ46.1
#=GS D3GE50_HBV/1-352      AC D3GE50.1
#=GS W8PS94_HBV/1-352      AC W8PS94.1
#=GS C1K1F8_HBV/1-352      AC C1K1F8.1
#=GS S5ZE48_HBV/1-352      AC S5ZE48.1
#=GS G1C8S9_HBV/1-341      AC G1C8S9.1
#=GS D3GE39_HBV/1-352      AC D3GE39.1
#=GS K4Q384_HBV/1-85       AC K4Q384.1
#=GS B8PTH3_HBV/1-341      AC B8PTH3.1
#=GS A0A024F8X9_HBV/1-352  AC A0A024F8X9.1
#=GS Q4R1R2_HBV/1-38       AC Q4R1R2.1
#=GS D0E694_HBV/1-352      AC D0E694.1
#=GS D2X4P4_HBV/1-121      AC D2X4P4.1
#=GS I0DCH1_HBV/1-328      AC I0DCH1.1
#=GS F1AER9_HBV/1-354      AC F1AER9.1
#=GS E5CZ02_HBV/1-352      AC E5CZ02.1
#=GS D2X401_HBV/37-97      AC D2X401.1
#=GS I0C8J5_HBV/1-350      AC I0C8J5.1
#=GS D9U575_HBV/1-346      AC D9U575.1
#=GS Q3ZKP5_HBV/1-351      AC Q3ZKP5.1
#=GS C7DSI5_HBV/1-341      AC C7DSI5.1
#=GS U3PSB2_HBV/1-351      AC U3PSB2.1
#=GS S5ZE17_HBV/1-340      AC S5ZE17.1
#=GS S5ZF96_HBV/1-350      AC S5ZF96.1
#=GS G3XH22_HBV/1-332      AC G3XH22.1
#=GS H9XQC6_HBV/1-91       AC H9XQC6.1
#=GS G4XI82_HBV/1-160      AC G4XI82.1
#=GS A7L364_HBV/1-30       AC A7L364.1
#=GS O91551_HBV/1-352      AC O91551.1
#=GS B2LRT6_HBV/1-352      AC B2LRT6.1
#=GS I0DDQ2_HBV/1-163      AC I0DDQ2.1
#=GS D5LBM4_HBV/1-352      AC D5LBM4.1
#=GS D2JMX5_HBV/1-352      AC D2JMX5.1
#=GS C3W4I1_HBV/1-341      AC C3W4I1.1
#=GS S5ZLG7_HBV/1-341      AC S5ZLG7.1
#=GS X4ZEP9_HBV/1-352      AC X4ZEP9.1
#=GS I0C8I0_HBV/1-350      AC I0C8I0.1
#=GS H2ER64_HBV/1-352      AC H2ER64.1
#=GS Q2LCF6_HBV/1-341      AC Q2LCF6.1
#=GS H6UGE8_HBV/1-341      AC H6UGE8.1
#=GS D3YGC5_HBV/1-341      AC D3YGC5.1
#=GS B9VKA6_HBV/1-352      AC B9VKA6.1
#=GS B5M5N5_HBV/1-352      AC B5M5N5.1
#=GS W6IBH3_HBV/1-315      AC W6IBH3.1
#=GS G3XGY4_HBV/1-343      AC G3XGY4.1
#=GS X4YZ35_HBV/1-352      AC X4YZ35.1
#=GS I4CJT7_HBV/1-30       AC I4CJT7.1
#=GS L0HBX9_HBV/1-354      AC L0HBX9.1
#=GS B9VKB8_HBV/1-352      AC B9VKB8.1
#=GS D2JMK9_HBV/1-352      AC D2JMK9.1
#=GS A5JIC7_HBV/1-112      AC A5JIC7.1
#=GS U3M9X7_HBV/6-314      AC U3M9X7.1
#=GS F4ZCB8_HBV/1-49       AC F4ZCB8.1
#=GS M4Q8D5_HBV/1-160      AC M4Q8D5.1
#=GS K4PWB3_HBV/1-84       AC K4PWB3.1
#=GS F1AEN7_HBV/1-354      AC F1AEN7.1
#=GS F5C0J1_HBV/1-341      AC F5C0J1.1
#=GS D3TIR3_HBV/1-352      AC D3TIR3.1
#=GS Q69590_HBV/541-842    AC Q69590.1
#=GS G9G943_HBV/1-258      AC G9G943.2
#=GS B9VL60_HBV/1-195      AC B9VL60.1
#=GS I0DCE0_HBV/1-246      AC I0DCE0.1
#=GS I0C8K6_HBV/1-335      AC I0C8K6.1
#=GS D0U3X2_HBV/1-354      AC D0U3X2.1
#=GS U3KUF7_HBV/1-171      AC U3KUF7.1
#=GS A9CM41_HBV/1-352      AC A9CM41.1
#=GS B5AST7_HBV/1-352      AC B5AST7.1
#=GS C5WK38_HBV/1-352      AC C5WK38.1
#=GS J7IFD8_HBV/1-352      AC J7IFD8.1
#=GS G9G9F3_HBV/223-280    AC G9G9F3.1
#=GS B5M5X2_HBV/1-352      AC B5M5X2.1
#=GS R9Q8A7_HBV/1-114      AC R9Q8A7.1
#=GS G4XI37_HBV/1-160      AC G4XI37.1
#=GS X4YHW2_HBV/229-313    AC X4YHW2.1
#=GS B4YKZ7_HBV/1-341      AC B4YKZ7.1
#=GS M4QBP3_HBV/1-171      AC M4QBP3.1
#=GS G1E7Y1_HBV/1-341      AC G1E7Y1.1
#=GS S5ZT37_HBV/1-350      AC S5ZT37.1
#=GS I0C8T9_HBV/1-354      AC I0C8T9.1
#=GS F1AEQ1_HBV/1-354      AC F1AEQ1.1
#=GS B2LSK9_HBV/1-352      AC B2LSK9.1
#=GS H6UN33_HBV/1-341      AC H6UN33.1
#=GS Q67908_HBV/267-390    AC Q67908.1
#=GS K4PWB7_HBV/1-49       AC K4PWB7.1
#=GS I0C969_HBV/1-354      AC I0C969.1
#=GS E3Q0P8_HBV/1-352      AC E3Q0P8.1
#=GS Q918N8_9HEPA/5-393    AC Q918N8.1
#=GS H9XR03_HBV/1-91       AC H9XR03.1
#=GS C5WJY6_HBV/1-352      AC C5WJY6.1
#=GS C3W4G8_HBV/1-341      AC C3W4G8.1
#=GS D9U5I2_HBV/1-352      AC D9U5I2.1
#=GS I0DGK3_HBV/1-352      AC I0DGK3.1
#=GS F5C1E4_HBV/1-341      AC F5C1E4.1
#=GS A5JIN0_HBV/1-112      AC A5JIN0.1
#=GS C7DML3_HBV/1-351      AC C7DML3.1
#=GS G3E573_HBV/1-341      AC G3E573.1
#=GS Q69616_HBV/541-843    AC Q69616.1
#=GS F2WS96_HBV/1-352      AC F2WS96.1
#=GS D0EZ10_HBV/1-341      AC D0EZ10.1
#=GS F5C0S9_HBV/1-333      AC F5C0S9.1
#=GS D0E5C9_HBV/1-352      AC D0E5C9.1
#=GS B4YLJ5_HBV/1-341      AC B4YLJ5.1
#=GS B5M656_HBV/1-352      AC B5M656.1
#=GS B5TFE5_HBV/1-112      AC B5TFE5.1
#=GS M4QJF4_HBV/1-171      AC M4QJF4.1
#=GS D3YGG1_HBV/1-341      AC D3YGG1.1
#=GS H2ERG8_HBV/1-334      AC H2ERG8.1
#=GS A6H2L8_HBV/1-341      AC A6H2L8.1
#=GS M4QBC3_HBV/1-171      AC M4QBC3.1
#=GS S5MHW5_HBV/1-352      AC S5MHW5.1
#=GS I0DCL5_HBV/1-328      AC I0DCL5.1
#=GS H6WF50_HBV/1-112      AC H6WF50.1
#=GS D0EEF2_HBV/1-354      AC D0EEF2.1
#=GS G9G8J1_HBV/1-341      AC G9G8J1.1
#=GS I0C870_HBV/1-354      AC I0C870.1
#=GS S5ZZL2_HBV/1-352      AC S5ZZL2.1
#=GS C1K1X4_HBV/1-352      AC C1K1X4.1
#=GS H3K3T9_HBV/1-352      AC H3K3T9.1
#=GS Q2I363_HBV/1-341      AC Q2I363.1
#=GS F5C180_HBV/1-354      AC F5C180.1
#=GS A5JJ30_HBV/52-101     AC A5JJ30.1
#=GS A7XNR0_HBV/1-354      AC A7XNR0.1
#=GS F5C1B9_HBV/1-354      AC F5C1B9.1
#=GS Q20C26_HBV/1-52       AC Q20C26.1
#=GS Q20BQ9_HBV/1-57       AC Q20BQ9.1
#=GS B0FCF8_HBV/1-352      AC B0FCF8.1
#=GS S6A6W0_HBV/1-337      AC S6A6W0.1
#=GS F1AER5_HBV/1-341      AC F1AER5.1
#=GS Q8JXH7_HBV/1-351      AC Q8JXH7.1
#=GS B5M534_HBV/1-352      AC B5M534.2
#=GS B5TFB7_HBV/1-112      AC B5TFB7.1
#=GS H3K3U6_HBV/1-354      AC H3K3U6.1
#=GS K7QGC4_HBV/1-280      AC K7QGC4.1
#=GS M4QBM6_HBV/1-171      AC M4QBM6.1
#=GS B2LWC4_HBV/1-337      AC B2LWC4.1
#=GS G1E8T4_HBV/1-341      AC G1E8T4.1
#=GS I0DDS9_HBV/1-317      AC I0DDS9.1
#=GS A5GZH3_HBV/1-352      AC A5GZH3.1
#=GS D2JMH4_HBV/1-330      AC D2JMH4.1
#=GS E5RDA1_HBV/1-341      AC E5RDA1.1
#=GS S6A6X2_HBV/1-336      AC S6A6X2.1
#=GS D3YG15_HBV/236-317    AC D3YG15.1
#=GS B7TV53_HBV/1-352      AC B7TV53.1
#=GS R9Q8C6_HBV/1-114      AC R9Q8C6.1
#=GS K7QGJ0_HBV/1-350      AC K7QGJ0.1
#=GS B9VKX5_HBV/1-352      AC B9VKX5.1
#=GS Q9IXB4_HBV/1-52       AC Q9IXB4.1
#=GS B5BPL3_HBV/1-352      AC B5BPL3.1
#=GS F5C1A5_HBV/1-354      AC F5C1A5.1
#=GS F5C0S0_HBV/1-351      AC F5C0S0.1
#=GS L0HAH3_HBV/1-352      AC L0HAH3.1
#=GS C1K1R4_HBV/1-352      AC C1K1R4.1
#=GS B5M631_HBV/1-352      AC B5M631.1
#=GS F5C7R0_HBV/1-352      AC F5C7R0.1
#=GS S6A6V7_HBV/1-336      AC S6A6V7.1
#=GS D7NL29_HBV/1-341      AC D7NL29.1
#=GS B4YKZ0_HBV/1-341      AC B4YKZ0.1
#=GS G3E5H8_HBV/1-341      AC G3E5H8.1
#=GS H6V5T0_HBV/1-352      AC H6V5T0.1
#=GS D3TK10_HBV/1-253      AC D3TK10.1
#=GS C1K1D2_HBV/1-352      AC C1K1D2.1
#=GS D0E6K4_HBV/1-352      AC D0E6K4.1
#=GS Q9IX96_HBV/1-52       AC Q9IX96.1
#=GS C3W3W0_HBV/1-341      AC C3W3W0.1
#=GS S5ZTK2_HBV/1-337      AC S5ZTK2.1
#=GS S5ZSH5_HBV/1-341      AC S5ZSH5.1
#=GS E5RD57_HBV/1-352      AC E5RD57.1
#=GS L0CL63_HBV/1-341      AC L0CL63.1
#=GS S5ZTL6_HBV/1-336      AC S5ZTL6.1
#=GS B4ZYT6_HBV/1-352      AC B4ZYT6.1
#=GS U3M9V9_HBV/3-337      AC U3M9V9.1
#=GS E0ZRZ1_HBV/1-351      AC E0ZRZ1.1
#=GS K0FBE1_HBV/1-352      AC K0FBE1.1
#=GS H6UGM1_HBV/1-341      AC H6UGM1.1
#=GS Q8B4F6_HBV/259-303    AC Q8B4F6.1
#=GS B0FCM6_HBV/1-352      AC B0FCM6.1
#=GS Q91IF8_HBV/19-161     AC Q91IF8.1
#=GS W8Q331_HBV/1-184      AC W8Q331.1
#=GS G4XMM3_HBV/1-352      AC G4XMM3.1
#=GS Q3ZKQ3_HBV/1-354      AC Q3ZKQ3.1
#=GS L7R8D2_HBV/1-347      AC L7R8D2.1
#=GS A6MG74_HBV/1-352      AC A6MG74.1
#=GS I0C8G2_HBV/1-354      AC I0C8G2.1
#=GS B5BUT2_HBV/1-354      AC B5BUT2.1
#=GS S5ZZN4_HBV/269-310    AC S5ZZN4.1
#=GS Q6RSE7_9HEPA/61-382   AC Q6RSE7.1
#=GS D0E5P1_HBV/1-352      AC D0E5P1.1
#=GS B5B4F7_HBV/1-352      AC B5B4F7.1
#=GS I0C910_HBV/1-354      AC I0C910.1
#=GS B7TTV6_HBV/1-352      AC B7TTV6.1
#=GS K4N0A0_HBV/1-352      AC K4N0A0.1
#=GS Q80J66_HBV/1-345      AC Q80J66.1
#=GS I4CJV3_HBV/1-172      AC I4CJV3.1
#=GS G9G9P3_HBV/228-308    AC G9G9P3.1
#=GS M4QIZ9_HBV/1-171      AC M4QIZ9.1
#=GS E5F0W7_HBV/1-49       AC E5F0W7.1
#=GS L8B2K3_HBV/1-341      AC L8B2K3.1
#=GS Q918N5_9HEPA/6-393    AC Q918N5.1
#=GS Q8UYX7_HHBV/70-355    AC Q8UYX7.1
#=GS F4ZCB0_HBV/1-49       AC F4ZCB0.1
#=GS Q9YZS3_HBV/1-334      AC Q9YZS3.1
#=GS B9VKH2_HBV/1-352      AC B9VKH2.1
#=GS T1YU92_HBV/1-352      AC T1YU92.1
#=GS S6A6T5_HBV/1-336      AC S6A6T5.1
#=GS S5ZFJ7_HBV/1-336      AC S5ZFJ7.1
#=GS L0H7F4_HBV/1-352      AC L0H7F4.1
#=GS E9L2N3_HBV/1-171      AC E9L2N3.1
#=GS Q9ELS4_HBV/1-172      AC Q9ELS4.1
#=GS G4XML9_HBV/1-352      AC G4XML9.1
#=GS S5ZFU0_HBV/1-341      AC S5ZFU0.1
#=GS G1E7H1_HBV/1-341      AC G1E7H1.1
#=GS D2JMG9_HBV/1-352      AC D2JMG9.1
#=GS C9WDR7_HBV/1-351      AC C9WDR7.1
#=GS H6WFF0_HBV/1-112      AC H6WFF0.1
#=GS B9VKE8_HBV/1-352      AC B9VKE8.1
#=GS Q8BCI7_HBV/1-352      AC Q8BCI7.1
#=GS Q8JN01_HBV/1-348      AC Q8JN01.1
#=GS H9XRB0_HBV/1-91       AC H9XRB0.1
#=GS I0DGB4_HBV/1-352      AC I0DGB4.1
#=GS I0C8I6_HBV/1-350      AC I0C8I6.1
#=GS B7TV21_HBV/1-352      AC B7TV21.1
#=GS W6IBE2_HBV/1-315      AC W6IBE2.1
#=GS S5ZKB0_HBV/1-317      AC S5ZKB0.1
#=GS O09517_HBV/1-214      AC O09517.1
#=GS B7TUL4_HBV/1-347      AC B7TUL4.1
#=GS I0DCF5_HBV/1-328      AC I0DCF5.1
#=GS I0C9B1_HBV/1-341      AC I0C9B1.1
#=GS C9WDH3_HBV/1-341      AC C9WDH3.1
#=GS A0FDL8_HBV/301-333    AC A0FDL8.1
#=GS R4P3A4_HBV/1-352      AC R4P3A4.1
#=GS I0DCV5_HBV/1-328      AC I0DCV5.1
#=GS I7KJJ0_HBV/1-354      AC I7KJJ0.1
#=GS H2ERB0_HBV/1-352      AC H2ERB0.1
#=GS O91514_HBV/1-336      AC O91514.1
#=GS G3XGY0_HBV/1-343      AC G3XGY0.1
#=GS D0EE22_HBV/1-354      AC D0EE22.1
#=GS I0DD33_HBV/1-328      AC I0DD33.1
#=GS B7TUC1_HBV/1-352      AC B7TUC1.1
#=GS X4ZFA7_HBV/1-352      AC X4ZFA7.1
#=GS C6F583_HBV/1-354      AC C6F583.1
#=GS S6A000_HBV/1-340      AC S6A000.1
#=GS Q45V32_HBV/1-341      AC Q45V32.1
#=GS S6A6T4_HBV/1-332      AC S6A6T4.1
#=GS A5JHZ6_HBV/1-112      AC A5JHZ6.1
#=GS S6A017_HBV/1-336      AC S6A017.1
#=GS D3YG83_HBV/1-341      AC D3YG83.1
#=GS C7DN82_HBV/1-351      AC C7DN82.1
#=GS D3Y1K7_HBV/1-352      AC D3Y1K7.1
#=GS DPOL_WHV5/5-393       AC P17396.1
#=GS D0UE12_HBV/1-352      AC D0UE12.1
#=GS H9XQB8_HBV/1-91       AC H9XQB8.1
#=GS C9WDF0_HBV/1-325      AC C9WDF0.1
#=GS B0FCZ8_HBV/1-352      AC B0FCZ8.1
#=GS K7QGB1_HBV/1-352      AC K7QGB1.1
#=GS D0E679_HBV/1-352      AC D0E679.1
#=GS B5M618_HBV/1-352      AC B5M618.1
#=GS X4YR35_HBV/1-352      AC X4YR35.1
#=GS Q9PWY8_HBV/1-352      AC Q9PWY8.1
#=GS Q8B5Q0_HBV/1-200      AC Q8B5Q0.1
#=GS S6A046_HBV/1-337      AC S6A046.1
#=GS I0C8D9_HBV/1-354      AC I0C8D9.1
#=GS B5TFB3_HBV/1-112      AC B5TFB3.1
#=GS Q9QMI7_HBV/1-352      AC Q9QMI7.1
#=GS S5ZTH8_HBV/1-331      AC S5ZTH8.1
#=GS D3TKE3_HBV/1-352      AC D3TKE3.1
#=GS C7DSN2_HBV/1-341      AC C7DSN2.1
#=GS F5C0I6_HBV/1-341      AC F5C0I6.1
#=GS I0C9B0_HBV/1-341      AC I0C9B0.1
#=GS Q20C18_HBV/1-57       AC Q20C18.1
#=GS C7DNE9_HBV/1-351      AC C7DNE9.1
#=GS B5B4H1_HBV/236-291    AC B5B4H1.1
#=GS L0BDE0_HBV/1-210      AC L0BDE0.1
#=GS Q7TDP5_HBV/1-352      AC Q7TDP5.1
#=GS B1ABM2_HBV/236-291    AC B1ABM2.1
#=GS B9VKG8_HBV/1-292      AC B9VKG8.1
#=GS C7AYW5_HBV/1-354      AC C7AYW5.1
#=GS E5RPQ9_HBV/1-325      AC E5RPQ9.1
#=GS Q80J80_HBV/1-352      AC Q80J80.1
#=GS I0DDU9_HBV/1-328      AC I0DDU9.1
#=GS K0FBG3_HBV/1-352      AC K0FBG3.1
#=GS V5JE80_HBV/1-354      AC V5JE80.1
#=GS Q99HT1_HBV/1-352      AC Q99HT1.1
#=GS D6QVN4_HBV/1-352      AC D6QVN4.1
#=GS S5ZJU3_HBV/1-337      AC S5ZJU3.1
#=GS S5ZZK7_HBV/1-340      AC S5ZZK7.1
#=GS C1K1L9_HBV/1-346      AC C1K1L9.1
#=GS M4QBG1_HBV/1-171      AC M4QBG1.1
#=GS H9XQY4_HBV/1-91       AC H9XQY4.1
#=GS L7R9H3_HBV/1-352      AC L7R9H3.1
#=GS S6A6Z8_HBV/1-352      AC S6A6Z8.1
#=GS A7L369_HBV/1-30       AC A7L369.1
#=GS E5RD37_HBV/1-352      AC E5RD37.1
#=GS B7TV34_HBV/1-352      AC B7TV34.1
#=GS S6A050_HBV/1-340      AC S6A050.1
#=GS I0DGK5_HBV/1-352      AC I0DGK5.1
#=GS E5F0X7_HBV/1-49       AC E5F0X7.1
#=GS Q67874_HBV/1-341      AC Q67874.1
#=GS G1E8N9_HBV/1-341      AC G1E8N9.1
#=GS E3Q0Q4_HBV/1-352      AC E3Q0Q4.1
#=GS E0ZS08_HBV/1-351      AC E0ZS08.1
#=GS L7R9E7_HBV/1-341      AC L7R9E7.1
#=GS Q80J53_HBV/1-352      AC Q80J53.1
#=GS W0SPN7_HBV/1-352      AC W0SPN7.1
#=GS L0ES47_HBV/1-352      AC L0ES47.1
#=GS D0E5X6_HBV/1-352      AC D0E5X6.1
#=GS C1K1Z4_HBV/1-342      AC C1K1Z4.1
#=GS G4XMN9_HBV/1-352      AC G4XMN9.1
#=GS L0BCA7_HBV/1-210      AC L0BCA7.1
#=GS E0ZRS9_HBV/1-351      AC E0ZRS9.1
#=GS F5C1A8_HBV/1-354      AC F5C1A8.1
#=GS K9MD38_HBV/1-24       AC K9MD38.1
#=GS I0C8Z8_HBV/1-354      AC I0C8Z8.1
#=GS F5C0Z0_HBV/1-354      AC F5C0Z0.1
#=GS B4YKL6_HBV/1-354      AC B4YKL6.1
#=GS S5ZZJ2_HBV/1-336      AC S5ZZJ2.1
#=GS S5ZTB8_HBV/1-341      AC S5ZTB8.1
#=GS B2CZG3_HBV/1-352      AC B2CZG3.1
#=GS A9PLI8_HBV/1-43       AC A9PLI8.1
#=GS S6A6Z9_HBV/1-341      AC S6A6Z9.1
#=GS H6WF66_HBV/1-112      AC H6WF66.1
#=GS S5ZLZ1_HBV/1-351      AC S5ZLZ1.1
#=GS Q6XGH8_HBV/1-341      AC Q6XGH8.1
#=GS F5C188_HBV/1-354      AC F5C188.1
#=GS A9QPY1_HBV/1-351      AC A9QPY1.1
#=GS D6QVU3_HBV/1-352      AC D6QVU3.1
#=GS C7DY99_HBV/1-347      AC C7DY99.1
#=GS Q67932_HBV/1-291      AC Q67932.1
#=GS E5RPN1_HBV/1-352      AC E5RPN1.1
#=GS L7R7L6_HBV/1-341      AC L7R7L6.1
#=GS M4QAI2_HBV/1-171      AC M4QAI2.1
#=GS U3KUC4_HBV/1-161      AC U3KUC4.1
#=GS C5WJW2_HBV/1-352      AC C5WJW2.1
#=GS Q7THT0_HBV/1-352      AC Q7THT0.1
#=GS U3RGY2_HBV/1-218      AC U3RGY2.1
#=GS F5C0J2_HBV/1-312      AC F5C0J2.1
#=GS D3KZ70_HBV/1-354      AC D3KZ70.1
#=GS G1E7M2_HBV/1-341      AC G1E7M2.1
#=GS G3EQX4_HBV/1-41       AC G3EQX4.1
#=GS I0C8K1_HBV/1-350      AC I0C8K1.1
#=GS X4Z0E5_HBV/1-352      AC X4Z0E5.1
#=GS W8NZK4_HBV/1-352      AC W8NZK4.1
#=GS E5RD49_HBV/1-352      AC E5RD49.1
#=GS B5M5R4_HBV/1-352      AC B5M5R4.1
#=GS Q67885_HBV/1-334      AC Q67885.1
#=GS I0C8S1_HBV/1-341      AC I0C8S1.1
#=GS D3TIS6_HBV/1-352      AC D3TIS6.1
#=GS F5C0S3_HBV/1-333      AC F5C0S3.1
#=GS K0FB50_HBV/1-352      AC K0FB50.1
#=GS E7CT74_HBV/1-352      AC E7CT74.1
#=GS E5RPR9_HBV/1-343      AC E5RPR9.1
#=GS F5C0W1_HBV/1-354      AC F5C0W1.1
#=GS A9PLI7_HBV/3-43       AC A9PLI7.1
#=GS B0FCV6_HBV/1-352      AC B0FCV6.1
#=GS O39644_HBV/1-352      AC O39644.1
#=GS Q4FDL0_HBV/1-352      AC Q4FDL0.1
#=GS E5RPM7_HBV/1-352      AC E5RPM7.1
#=GS B2WSQ9_HBV/1-352      AC B2WSQ9.1
#=GS D9U5A6_HBV/1-352      AC D9U5A6.1
#=GS F5C182_HBV/1-354      AC F5C182.1
#=GS D0UE39_HBV/1-352      AC D0UE39.1
#=GS D5LBB7_HBV/1-352      AC D5LBB7.1
#=GS A5LG26_HBV/1-352      AC A5LG26.1
#=GS L8E7X0_HBV/1-294      AC L8E7X0.1
#=GS K4P278_9HEPA/59-344   AC K4P278.1
#=GS A9CM33_HBV/1-352      AC A9CM33.1
#=GS I0DCG3_HBV/1-328      AC I0DCG3.1
#=GS B9VK23_HBV/1-352      AC B9VK23.1
#=GS C6L681_HBV/1-341      AC C6L681.1
#=GS D3YG09_HBV/1-341      AC D3YG09.1
#=GS B4ZYU9_HBV/1-341      AC B4ZYU9.1
#=GS B9VKP6_HBV/1-352      AC B9VKP6.1
#=GS H9XRI9_HBV/1-91       AC H9XRI9.1
#=GS B5ASQ6_HBV/1-352      AC B5ASQ6.1
#=GS A5LG70_HBV/1-352      AC A5LG70.1
#=GS T1YVJ6_HBV/1-352      AC T1YVJ6.1
#=GS B9VL33_HBV/1-352      AC B9VL33.1
#=GS B5BUU0_HBV/1-354      AC B5BUU0.1
#=GS F5C0W6_HBV/1-354      AC F5C0W6.1
#=GS C6F501_HBV/1-354      AC C6F501.1
#=GS D3YFX8_HBV/1-341      AC D3YFX8.1
#=GS C7DNL5_HBV/1-352      AC C7DNL5.1
#=GS Q8QXQ7_HBV/1-354      AC Q8QXQ7.1
#=GS L0CL90_HBV/1-341      AC L0CL90.1
#=GS B9VJX4_HBV/1-352      AC B9VJX4.1
#=GS Q8JXH4_HBV/1-351      AC Q8JXH4.1
#=GS F5C198_HBV/1-354      AC F5C198.1
#=GS I0DDE2_HBV/1-326      AC I0DDE2.1
#=GS Q20BX5_HBV/1-56       AC Q20BX5.1
#=GS F5C0W7_HBV/1-354      AC F5C0W7.1
#=GS X4YRL0_HBV/1-352      AC X4YRL0.1
#=GS D0E5X9_HBV/1-352      AC D0E5X9.1
#=GS U5K8Q8_HBV/3-50       AC U5K8Q8.1
#=GS G1C8E1_HBV/1-341      AC G1C8E1.1
#=GS B5M669_HBV/1-352      AC B5M669.1
#=GS S6A717_HBV/1-318      AC S6A717.1
#=GS D3YGD1_HBV/1-341      AC D3YGD1.1
#=GS S5ZEB3_HBV/1-336      AC S5ZEB3.1
#=GS G1E7V7_HBV/1-260      AC G1E7V7.1
#=GS G4XI97_HBV/27-82      AC G4XI97.1
#=GS A0MML3_HBV/1-352      AC A0MML3.1
#=GS Q20BQ7_HBV/1-56       AC Q20BQ7.1
#=GS H6WFA6_HBV/1-112      AC H6WFA6.1
#=GS A5JHQ5_HBV/1-112      AC A5JHQ5.1
#=GS B5M5L8_HBV/1-352      AC B5M5L8.1
#=GS I0DC51_HBV/1-328      AC I0DC51.1
#=GS X4YYQ0_HBV/1-352      AC X4YYQ0.1
#=GS I0C9H6_HBV/1-344      AC I0C9H6.1
#=GS W8E654_HBV/1-352      AC W8E654.1
#=GS Q8B5Q7_HBV/1-190      AC Q8B5Q7.1
#=GS H6V5K0_HBV/1-352      AC H6V5K0.1
#=GS F5C173_HBV/1-354      AC F5C173.1
#=GS I0DGF0_HBV/1-352      AC I0DGF0.1
#=GS D3TIJ9_HBV/1-286      AC D3TIJ9.1
#=GS D2U666_HBV/1-351      AC D2U666.1
#=GS T1YUC4_HBV/1-352      AC T1YUC4.1
#=GS G4XMC3_HBV/1-342      AC G4XMC3.1
#=GS F5C0K6_HBV/1-354      AC F5C0K6.1
#=GS S5ZLU8_HBV/1-341      AC S5ZLU8.1
#=GS C7DN55_HBV/1-351      AC C7DN55.1
#=GS B9VKQ3_HBV/1-352      AC B9VKQ3.1
#=GS D0E675_HBV/1-352      AC D0E675.1
#=GS G3XGW0_HBV/1-352      AC G3XGW0.1
#=GS H6WF78_HBV/1-112      AC H6WF78.1
#=GS W0SK74_HBV/1-352      AC W0SK74.1
#=GS S5ZTD5_HBV/1-341      AC S5ZTD5.1
#=GS G3E5D6_HBV/1-341      AC G3E5D6.1
#=GS F4ZCA7_HBV/1-35       AC F4ZCA7.1
#=GS D2X4R6_HBV/154-195    AC D2X4R6.1
#=GS Q2LCG4_HBV/1-341      AC Q2LCG4.1
#=GS D2JMY5_HBV/1-352      AC D2JMY5.1
#=GS Q9QAW1_HBV/1-341      AC Q9QAW1.1
#=GS B5ASR2_HBV/1-352      AC B5ASR2.1
#=GS D2JMS4_HBV/1-352      AC D2JMS4.1
#=GS A5LG82_HBV/1-337      AC A5LG82.1
#=GS A8J4F6_HBV/1-304      AC A8J4F6.1
#=GS B9VKD3_HBV/285-323    AC B9VKD3.1
#=GS U3REQ2_HBV/1-218      AC U3REQ2.1
#=GS K4PW99_HBV/1-352      AC K4PW99.1
#=GS B2CZH0_HBV/1-352      AC B2CZH0.1
#=GS R9Q8S1_HBV/1-114      AC R9Q8S1.1
#=GS F5C0K7_HBV/1-354      AC F5C0K7.1
#=GS D9U596_HBV/1-352      AC D9U596.1
#=GS H6UG99_HBV/1-341      AC H6UG99.1
#=GS Q4FDK6_HBV/1-352      AC Q4FDK6.1
#=GS A5JI08_HBV/1-112      AC A5JI08.1
#=GS D9U1K1_HBV/1-352      AC D9U1K1.1
#=GS F5C0H2_HBV/1-341      AC F5C0H2.1
#=GS I0C953_HBV/1-354      AC I0C953.1
#=GS G1E8S2_HBV/1-341      AC G1E8S2.1
#=GS E5CZ26_HBV/1-352      AC E5CZ26.1
#=GS C7DMR1_HBV/1-351      AC C7DMR1.1
#=GS Q2MLQ0_HBV/1-341      AC Q2MLQ0.1
#=GS B5TF57_HBV/1-112      AC B5TF57.1
#=GS G9G9B1_HBV/1-341      AC G9G9B1.1
#=GS Q4FDD1_HBV/1-352      AC Q4FDD1.1
#=GS S6A0B8_HBV/1-332      AC S6A0B8.1
#=GS C7DNH0_HBV/1-351      AC C7DNH0.1
#=GS D3YC82_HBV/1-352      AC D3YC82.1
#=GS S5ZLH2_HBV/1-333      AC S5ZLH2.1
#=GS E5RPY5_HBV/1-326      AC E5RPY5.1
#=GS W8TMW2_HBV/1-354      AC W8TMW2.1
#=GS I1UYR8_HBV/1-166      AC I1UYR8.1
#=GS D2JMU1_HBV/1-352      AC D2JMU1.1
#=GS L0HCW5_HBV/1-346      AC L0HCW5.1
#=GS D5LC97_HBV/1-352      AC D5LC97.1
#=GS K9MCA9_HBV/1-24       AC K9MCA9.1
#=GS D0E644_HBV/1-352      AC D0E644.1
#=GS X4ZD12_HBV/1-352      AC X4ZD12.1
#=GS I0C8M3_HBV/1-335      AC I0C8M3.1
#=GS I0DDB3_HBV/1-328      AC I0DDB3.1
#=GS I0DDD0_HBV/1-328      AC I0DDD0.1
#=GS DPOL_HBVD6/1-341      AC Q67878.1
#=GS F5C146_HBV/1-354      AC F5C146.1
#=GS Q75TM0_HBV/1-354      AC Q75TM0.1
#=GS B2CFG3_HBV/273-304    AC B2CFG3.1
#=GS Q6XGJ9_HBV/1-341      AC Q6XGJ9.1
#=GS B2Y6U1_HBV/1-341      AC B2Y6U1.1
#=GS B5BPY2_HBV/1-334      AC B5BPY2.1
#=GS D5LB68_HBV/1-352      AC D5LB68.1
#=GS B7TUE1_HBV/1-352      AC B7TUE1.1
#=GS F1AEV9_HBV/1-354      AC F1AEV9.1
#=GS K7QGM7_HBV/1-352      AC K7QGM7.1
#=GS B9VKD6_HBV/1-352      AC B9VKD6.1
#=GS L0BEE4_HBV/1-210      AC L0BEE4.1
#=GS E5CZ55_HBV/1-352      AC E5CZ55.1
#=GS T1YUE0_HBV/1-352      AC T1YUE0.1
#=GS B7TUX1_HBV/1-352      AC B7TUX1.1
#=GS S5ZLR3_HBV/1-337      AC S5ZLR3.1
#=GS DPOL_HBVC9/1-352      AC P0C690.1
#=GS A5JIF1_HBV/1-112      AC A5JIF1.1
#=GS W0SPF7_HBV/1-352      AC W0SPF7.1
#=GS I0DGB1_HBV/1-352      AC I0DGB1.1
#=GS I0C8N3_HBV/1-335      AC I0C8N3.1
#=GS Q461C0_HBV/1-351      AC Q461C0.1
#=GS T1YSY8_HBV/1-352      AC T1YSY8.1
#=GS D3YG27_HBV/231-303    AC D3YG27.1
#=GS E0ZRG7_HBV/1-351      AC E0ZRG7.1
#=GS D3GIK1_HBV/1-352      AC D3GIK1.1
#=GS S5ZSY8_HBV/1-352      AC S5ZSY8.1
#=GS I0DC66_HBV/1-328      AC I0DC66.1
#=GS B3V3Q1_HBV/1-291      AC B3V3Q1.1
#=GS E1U7N1_HBV/1-341      AC E1U7N1.1
#=GS L8B269_HBV/1-341      AC L8B269.1
#=GS T1YVK2_HBV/1-341      AC T1YVK2.1
#=GS S5ZLT1_HBV/1-342      AC S5ZLT1.1
#=GS M4Q7U6_HBV/1-171      AC M4Q7U6.1
#=GS R4NTS8_HBV/1-352      AC R4NTS8.1
#=GS A2T1E4_HBV/1-341      AC A2T1E4.1
#=GS K4PWB0_HBV/1-85       AC K4PWB0.1
#=GS E5RPY1_HBV/1-343      AC E5RPY1.1
#=GS A5JI11_HBV/1-89       AC A5JI11.1
#=GS Q20C06_HBV/1-55       AC Q20C06.1
#=GS D3K2F3_HBV/1-341      AC D3K2F3.1
#=GS E5CZ36_HBV/1-352      AC E5CZ36.1
#=GS B9VL64_HBV/1-352      AC B9VL64.1
#=GS X4Z0J9_HBV/1-352      AC X4Z0J9.1
#=GS B5BPQ3_HBV/1-341      AC B5BPQ3.1
#=GS H1ZN34_HBV/1-341      AC H1ZN34.1
#=GS A5JIJ5_HBV/1-112      AC A5JIJ5.1
#=GS A6MFY1_HBV/1-352      AC A6MFY1.1
#=GS Q06AN4_HBV/1-352      AC Q06AN4.1
#=GS D6QVD4_HBV/1-352      AC D6QVD4.1
#=GS D2U642_HBV/1-351      AC D2U642.1
#=GS I0DD56_HBV/1-328      AC I0DD56.1
#=GS F5C0M1_HBV/1-354      AC F5C0M1.1
#=GS D3Y5Q9_HBV/1-352      AC D3Y5Q9.1
#=GS S6A087_HBV/1-336      AC S6A087.1
#=GS L0BCB7_HBV/1-210      AC L0BCB7.1
#=GS F5C184_HBV/1-354      AC F5C184.1
#=GS H9XQT7_HBV/1-91       AC H9XQT7.1
#=GS S5ZKG7_HBV/1-328      AC S5ZKG7.1
#=GS I0C8K9_HBV/1-350      AC I0C8K9.1
#=GS B0YK33_HBV/1-341      AC B0YK33.1
#=GS G9G8K5_HBV/1-341      AC G9G8K5.1
#=GS W8PA27_HBV/1-71       AC W8PA27.1
#=GS I0DGI6_HBV/1-352      AC I0DGI6.1
#=GS J7S583_HBV/1-351      AC J7S583.1
#=GS C6F5B8_HBV/1-354      AC C6F5B8.1
#=GS Q80J74_HBV/1-284      AC Q80J74.1
#=GS B4Y7G4_HBV/1-352      AC B4Y7G4.2
#=GS A5JID5_HBV/1-112      AC A5JID5.1
#=GS L8AYM8_HBV/1-341      AC L8AYM8.1
#=GS I0C8E2_HBV/1-354      AC I0C8E2.1
#=GS E5CYY4_HBV/1-352      AC E5CYY4.1
#=GS X4ZF85_HBV/1-352      AC X4ZF85.1
#=GS X4Z196_HBV/1-347      AC X4Z196.1
#=GS L8B1Y9_HBV/1-341      AC L8B1Y9.1
#=GS Q8B5Q6_HBV/1-190      AC Q8B5Q6.1
#=GS D3XGG6_HBV/1-352      AC D3XGG6.1
#=GS X4Z0X9_HBV/1-352      AC X4Z0X9.1
#=GS B4YTB6_HBV/1-184      AC B4YTB6.1
#=GS B5M673_HBV/1-341      AC B5M673.1
#=GS X4ZCM5_HBV/1-352      AC X4ZCM5.1
#=GS D6QVK1_HBV/1-352      AC D6QVK1.1
#=GS A2A1E6_HBV/1-352      AC A2A1E6.1
#=GS I0C8P2_HBV/1-227      AC I0C8P2.1
#=GS B7TTK8_HBV/1-352      AC B7TTK8.1
#=GS B7TTP5_HBV/1-352      AC B7TTP5.1
#=GS DPOL_HBVH2/1-352      AC Q8JN08.1
#=GS B9VK27_HBV/1-352      AC B9VK27.1
#=GS S5ZTF2_HBV/1-317      AC S5ZTF2.1
#=GS D3TJZ7_HBV/236-280    AC D3TJZ7.1
#=GS Q4KRE9_HBV/1-354      AC Q4KRE9.1
#=GS S5ZZR2_HBV/1-340      AC S5ZZR2.1
#=GS B2WSN2_HBV/1-352      AC B2WSN2.1
#=GS D2JMR0_HBV/1-352      AC D2JMR0.1
#=GS K4N2S1_HBV/1-352      AC K4N2S1.1
#=GS B9VL44_HBV/1-352      AC B9VL44.1
#=GS K0FB75_HBV/1-352      AC K0FB75.1
#=GS M4PW50_9HEPA/19-359   AC M4PW50.1
#=GS G3XGX8_HBV/1-343      AC G3XGX8.1
#=GS I0C9E2_HBV/1-352      AC I0C9E2.1
#=GS A4UIM3_HBV/1-58       AC A4UIM3.1
#=GS G1E7F8_HBV/1-335      AC G1E7F8.1
#=GS C1K1M5_HBV/274-323    AC C1K1M5.1
#=GS G1C8W4_HBV/1-341      AC G1C8W4.1
#=GS R9Q8M0_HBV/1-114      AC R9Q8M0.1
#=GS W8PRU8_HBV/1-291      AC W8PRU8.1
#=GS B5ASQ0_HBV/1-352      AC B5ASQ0.1
#=GS B5M5E0_HBV/1-352      AC B5M5E0.1
#=GS B4YL17_HBV/1-341      AC B4YL17.1
#=GS I0DCM6_HBV/1-328      AC I0DCM6.1
#=GS C1K1L0_HBV/235-291    AC C1K1L0.1
#=GS Q8UYX9_HHBV/70-355    AC Q8UYX9.1
#=GS F5C7Q3_HBV/1-352      AC F5C7Q3.1
#=GS B9VJY5_HBV/1-352      AC B9VJY5.1
#=GS U3M9Y0_HBV/3-337      AC U3M9Y0.1
#=GS I0DGJ6_HBV/1-352      AC I0DGJ6.1
#=GS G8CQJ6_HBV/1-49       AC G8CQJ6.1
#=GS E0ZR86_HBV/1-351      AC E0ZR86.1
#=GS X4YXY7_HBV/1-352      AC X4YXY7.1
#=GS E0D3B3_HBV/1-351      AC E0D3B3.1
#=GS C9WD88_HBV/1-341      AC C9WD88.1
#=GS Q9WRK8_HBV/1-354      AC Q9WRK8.1
#=GS F5C0I0_HBV/1-341      AC F5C0I0.1
#=GS D0E6I0_HBV/1-352      AC D0E6I0.1
#=GS C7DN61_HBV/1-354      AC C7DN61.1
#=GS S5ZT32_HBV/1-317      AC S5ZT32.1
#=GS D0UEC4_HBV/1-352      AC D0UEC4.1
#=GS E0ZRW9_HBV/1-351      AC E0ZRW9.1
#=GS E0ZRV3_HBV/1-351      AC E0ZRV3.1
#=GS F5C0Q9_HBV/1-351      AC F5C0Q9.1
#=GS A5JJ26_HBV/1-73       AC A5JJ26.1
#=GS B5ATB9_HBV/1-275      AC B5ATB9.1
#=GS B4Y4K2_HBV/1-352      AC B4Y4K2.1
#=GS A5JI75_HBV/1-112      AC A5JI75.1
#=GS B5M5Y8_HBV/1-352      AC B5M5Y8.1
#=GS B0I379_HBV/1-352      AC B0I379.1
#=GS S5ZTL0_HBV/1-340      AC S5ZTL0.1
#=GS G9G9M9_HBV/1-341      AC G9G9M9.1
#=GS B5BPU6_HBV/1-352      AC B5BPU6.1
#=GS G1C939_HBV/1-341      AC G1C939.1
#=GS S6A6Y5_HBV/1-341      AC S6A6Y5.1
#=GS S5ZZY9_HBV/1-337      AC S5ZZY9.1
#=GS F4ZCA5_HBV/1-49       AC F4ZCA5.1
#=GS R9Q7V6_HBV/1-114      AC R9Q7V6.1
#=GS Q77BF9_HBV/1-167      AC Q77BF9.1
#=GS I0CF22_HBV/1-288      AC I0CF22.1
#=GS I0DCY6_HBV/1-328      AC I0DCY6.1
#=GS T1YT16_HBV/1-352      AC T1YT16.1
#=GS Q00K76_HBV/1-352      AC Q00K76.1
#=GS Q5Q0Y8_HBV/1-341      AC Q5Q0Y8.1
#=GS I0C8T6_HBV/1-341      AC I0C8T6.1
#=GS C7DMD1_HBV/1-351      AC C7DMD1.1
#=GS H9XR38_HBV/1-91       AC H9XR38.1
#=GS L8B1Z0_HBV/269-300    AC L8B1Z0.1
#=GS L7R6Z8_HBV/1-341      AC L7R6Z8.1
#=GS H9XQM5_HBV/1-91       AC H9XQM5.1
#=GS L0HA58_HBV/1-352      AC L0HA58.1
#=GS Q6X5F0_HBV/1-24       AC Q6X5F0.1
#=GS B9VKX2_HBV/1-352      AC B9VKX2.1
#=GS H1ACW4_HBV/1-352      AC H1ACW4.1
#=GS H9XQQ6_HBV/1-91       AC H9XQQ6.1
#=GS A5LG86_HBV/1-352      AC A5LG86.1
#=GS I0C8R8_HBV/224-280    AC I0C8R8.1
#=GS Q76B09_HBV/1-352      AC Q76B09.1
#=GS L7R9B9_HBV/1-341      AC L7R9B9.1
#=GS B7TTG8_HBV/1-352      AC B7TTG8.1
#=GS X4ZCT8_HBV/1-352      AC X4ZCT8.1
#=GS R4NTU4_HBV/1-352      AC R4NTU4.1
#=GS H6UGH9_HBV/1-341      AC H6UGH9.1
#=GS E5RDB7_HBV/1-341      AC E5RDB7.1
#=GS M9PN20_HBV/1-49       AC M9PN20.1
#=GS B5M5E8_HBV/1-352      AC B5M5E8.1
#=GS R9Q8N7_HBV/1-114      AC R9Q8N7.1
#=GS S6A6U7_HBV/1-340      AC S6A6U7.1
#=GS K4Q388_HBV/1-147      AC K4Q388.1
#=GS B7TTQ0_HBV/1-352      AC B7TTQ0.1
#=GS L7R8W9_HBV/1-352      AC L7R8W9.1
#=GS E0ZS14_HBV/1-354      AC E0ZS14.1
#=GS Q6TMG8_9HEPA/62-261   AC Q6TMG8.1
#=GS A0FDL1_HBV/1-341      AC A0FDL1.1
#=GS G3XLD2_HBV/1-352      AC G3XLD2.1
#=GS Q8V4P1_HBV/44-119     AC Q8V4P1.1
#=GS L0HA71_HBV/1-352      AC L0HA71.1
#=GS S5ZTM5_HBV/1-340      AC S5ZTM5.1
#=GS K7QGJ8_HBV/1-352      AC K7QGJ8.1
#=GS D3TJC9_HBV/1-212      AC D3TJC9.1
#=GS S6A6Z3_HBV/1-337      AC S6A6Z3.1
#=GS B5M641_HBV/1-352      AC B5M641.1
#=GS F5C0M2_HBV/1-348      AC F5C0M2.1
#=GS H9XR46_HBV/1-91       AC H9XR46.1
#=GS I0C9E6_HBV/1-352      AC I0C9E6.1
#=GS J7SC93_HBV/1-352      AC J7SC93.1
#=GS I0DGA0_HBV/1-352      AC I0DGA0.1
#=GS X2G4W5_HBV/1-341      AC X2G4W5.1
#=GS I0C8Y5_HBV/1-354      AC I0C8Y5.1
#=GS U3KUD7_HBV/1-171      AC U3KUD7.1
#=GS L7R6U5_HBV/1-341      AC L7R6U5.1
#=GS E0D2U9_HBV/1-354      AC E0D2U9.1
#=GS G4XHW9_HBV/1-160      AC G4XHW9.1
#=GS S6A6W8_HBV/1-350      AC S6A6W8.1
#=GS D3YGK4_HBV/1-341      AC D3YGK4.1
#=GS I0C8Q6_HBV/224-280    AC I0C8Q6.1
#=GS D2U5Z0_HBV/1-351      AC D2U5Z0.1
#=GS S5ZSD5_HBV/1-340      AC S5ZSD5.1
#=GS S5ZE96_HBV/1-340      AC S5ZE96.1
#=GS S6A6U5_HBV/1-352      AC S6A6U5.1
#=GS U3KUE2_HBV/1-162      AC U3KUE2.1
#=GS S5ZLQ1_HBV/1-352      AC S5ZLQ1.1
#=GS D6QVT6_HBV/1-352      AC D6QVT6.1
#=GS C3W494_HBV/229-308    AC C3W494.1
#=GS F2WS84_HBV/1-352      AC F2WS84.1
#=GS T1YT01_HBV/1-345      AC T1YT01.1
#=GS D3YGG7_HBV/1-341      AC D3YGG7.1
#=GS D3K2C5_HBV/1-352      AC D3K2C5.1
#=GS D0E5Z8_HBV/1-352      AC D0E5Z8.1
#=GS I4CJU1_HBV/1-30       AC I4CJU1.1
#=GS L0BDH0_HBV/1-210      AC L0BDH0.1
#=GS Q1XHD5_HBV/1-352      AC Q1XHD5.1
#=GS D2JMN2_HBV/1-352      AC D2JMN2.1
#=GS D9U565_HBV/1-352      AC D9U565.1
#=GS D3TK10_HBV/273-317    AC D3TK10.1
#=GS Q7TG38_9HEPA/111-391  AC Q7TG38.1
#=GS G1E7X5_HBV/1-341      AC G1E7X5.1
#=GS D3YGM8_HBV/1-341      AC D3YGM8.1
#=GS D0E6E0_HBV/1-352      AC D0E6E0.1
#=GS F4ZCC0_HBV/1-49       AC F4ZCC0.1
#=GS U3KUE0_HBV/1-171      AC U3KUE0.1
#=GS F5C1B2_HBV/1-354      AC F5C1B2.1
#=GS H9XQK4_HBV/1-91       AC H9XQK4.1
#=GS B0FCD6_HBV/1-352      AC B0FCD6.1
#=GS W0SPL6_HBV/1-352      AC W0SPL6.1
#=GS O91522_HBV/1-185      AC O91522.1
#=GS W0SKU4_HBV/1-352      AC W0SKU4.1
#=GS G9G8M6_HBV/1-340      AC G9G8M6.2
#=GS L7R8L2_HBV/1-352      AC L7R8L2.1
#=GS X4ZEB0_HBV/1-352      AC X4ZEB0.1
#=GS H6UGF4_HBV/1-341      AC H6UGF4.1
#=GS A7L370_HBV/1-30       AC A7L370.1
#=GS I6YUT6_HBV/1-352      AC I6YUT6.1
#=GS D5LD32_HBV/1-352      AC D5LD32.1
#=GS Q19SV4_HBV/1-341      AC Q19SV4.1
#=GS B4YKV6_HBV/1-341      AC B4YKV6.1
#=GS Q2EIG2_HBV/1-346      AC Q2EIG2.1
#=GS B5M568_HBV/1-352      AC B5M568.1
#=GS L0BCC4_HBV/1-210      AC L0BCC4.1
#=GS C7DNK1_HBV/1-351      AC C7DNK1.1
#=GS S5ZLW8_HBV/1-166      AC S5ZLW8.1
#=GS X4YZ70_HBV/1-352      AC X4YZ70.1
#=GS B5M505_HBV/1-352      AC B5M505.1
#=GS D5LDE2_HBV/1-352      AC D5LDE2.1
#=GS G3XH34_HBV/1-332      AC G3XH34.1
#=GS L7R8T3_HBV/1-352      AC L7R8T3.1
#=GS C7EA81_HBV/1-352      AC C7EA81.1
#=GS L7R8M5_HBV/1-352      AC L7R8M5.1
#=GS E9L2R1_HBV/1-171      AC E9L2R1.1
#=GS F4ZCA8_HBV/1-49       AC F4ZCA8.1
#=GS I0DGG4_HBV/1-171      AC I0DGG4.1
#=GS I0C992_HBV/1-341      AC I0C992.1
#=GS I0C8Q6_HBV/1-227      AC I0C8Q6.1
#=GS S5ZSR5_HBV/1-340      AC S5ZSR5.1
#=GS G1E7W3_HBV/1-341      AC G1E7W3.1
#=GS X4ZD28_HBV/1-352      AC X4ZD28.1
#=GS L7R9G6_HBV/1-341      AC L7R9G6.1
#=GS D0E617_HBV/1-352      AC D0E617.1
#=GS B7TU89_HBV/1-352      AC B7TU89.1
#=GS Q4FDB5_HBV/1-352      AC Q4FDB5.1
#=GS B0FCS1_HBV/1-352      AC B0FCS1.1
#=GS B5B4H6_HBV/1-239      AC B5B4H6.1
#=GS I0DCJ5_HBV/1-328      AC I0DCJ5.1
#=GS B0YGJ8_HBV/1-341      AC B0YGJ8.1
#=GS B5M5R8_HBV/1-352      AC B5M5R8.1
#=GS I0DD60_HBV/1-328      AC I0DD60.1
#=GS B5A2H1_HBV/1-352      AC B5A2H1.1
#=GS D7NKR1_HBV/1-341      AC D7NKR1.1
#=GS U3KUG3_HBV/1-161      AC U3KUG3.1
#=GS G9G8N2_HBV/1-341      AC G9G8N2.1
#=GS S5ZKA4_HBV/1-320      AC S5ZKA4.1
#=GS I0DDW1_HBV/1-195      AC I0DDW1.1
#=GS B5TFE1_HBV/1-112      AC B5TFE1.1
#=GS B2CXZ6_HBV/1-352      AC B2CXZ6.1
#=GS K4PD67_9HEPA/59-226   AC K4PD67.1
#=GS B2CSB3_HBV/1-352      AC B2CSB3.1
#=GS I0DCK0_HBV/1-328      AC I0DCK0.1
#=GS Q5SDK9_HBVC1/1-352    AC Q5SDK9.1
#=GS U3M9X1_HBV/6-314      AC U3M9X1.1
#=GS F5C159_HBV/1-354      AC F5C159.1
#=GS X4ZFT4_HBV/1-352      AC X4ZFT4.1
#=GS D3YGA1_HBV/1-341      AC D3YGA1.1
#=GS I0C8L3_HBV/1-350      AC I0C8L3.1
#=GS L0BCF2_HBV/1-210      AC L0BCF2.1
#=GS K7QGK2_HBV/1-352      AC K7QGK2.1
#=GS K0FC89_HBV/1-352      AC K0FC89.1
#=GS S5ZFE4_HBV/1-336      AC S5ZFE4.1
#=GS F5C0Z7_HBV/1-354      AC F5C0Z7.1
#=GS I0C9F5_HBV/1-352      AC I0C9F5.1
#=GS L0HA11_HBV/1-352      AC L0HA11.1
#=GS W0SK96_HBV/1-352      AC W0SK96.1
#=GS F5C0K9_HBV/1-348      AC F5C0K9.1
#=GS E0ZRM6_HBV/1-351      AC E0ZRM6.1
#=GS Q81099_HBV/1-352      AC Q81099.2
#=GS B5TFH3_HBV/1-112      AC B5TFH3.1
#=GS D3YGQ2_HBV/1-341      AC D3YGQ2.1
#=GS H6UGQ0_HBV/1-341      AC H6UGQ0.1
#=GS S5ZK08_HBV/1-352      AC S5ZK08.1
#=GS D3TJ98_HBV/1-349      AC D3TJ98.1
#=GS Q784K8_HBVF5/1-352    AC Q784K8.1
#=GS L7R8E2_HBV/1-341      AC L7R8E2.1
#=GS F5C0T6_HBV/1-351      AC F5C0T6.1
#=GS C3W482_HBV/1-341      AC C3W482.1
#=GS D0UE02_HBV/1-346      AC D0UE02.1
#=GS L0BCH5_HBV/1-210      AC L0BCH5.1
#=GS Q8B4F0_HBV/1-229      AC Q8B4F0.1
#=GS S5ZK55_HBV/1-341      AC S5ZK55.1
#=GS I7LRA3_HBV/1-354      AC I7LRA3.1
#=GS W6HYC9_HBV/1-315      AC W6HYC9.1
#=GS Q69616_HBV/1-49       AC Q69616.1
#=GS B4X9N0_HBV/1-352      AC B4X9N0.2
#=GS I2DB95_HBV/1-354      AC I2DB95.1
#=GS Q9DKP0_HBV/1-19       AC Q9DKP0.1
#=GS B5M5Q8_HBV/1-352      AC B5M5Q8.1
#=GS H9XRT3_HBV/1-91       AC H9XRT3.1
#=GS F5C160_HBV/1-354      AC F5C160.1
#=GS H6UN45_HBV/1-341      AC H6UN45.1
#=GS S5ZT09_HBV/1-340      AC S5ZT09.1
#=GS D3TK38_HBV/1-352      AC D3TK38.1
#=GS E5RPV3_HBV/1-343      AC E5RPV3.1
#=GS S5ZLN4_HBV/1-341      AC S5ZLN4.1
#=GS B5TXS5_HBV/1-334      AC B5TXS5.1
#=GS B7TV59_HBV/1-352      AC B7TV59.1
#=GS B7TTM0_HBV/1-346      AC B7TTM0.1
#=GS D2JMW6_HBV/1-352      AC D2JMW6.1
#=GS F5C0X6_HBV/1-354      AC F5C0X6.1
#=GS D0EEK4_HBV/1-354      AC D0EEK4.1
#=GS I0DE64_HBV/1-312      AC I0DE64.1
#=GS D0EEN8_HBV/1-354      AC D0EEN8.1
#=GS I0CF25_HBV/1-253      AC I0CF25.1
#=GS A6MFY7_HBV/1-352      AC A6MFY7.1
#=GS G4XI88_HBV/1-160      AC G4XI88.1
#=GS B9VJW6_HBV/1-352      AC B9VJW6.1
#=GS B5M5A1_HBV/1-352      AC B5M5A1.1
#=GS D5LBK0_HBV/1-352      AC D5LBK0.1
#=GS Q4FDA7_HBV/1-352      AC Q4FDA7.1
#=GS S5ZED8_HBV/1-339      AC S5ZED8.1
#=GS H9XRY5_HBV/1-91       AC H9XRY5.1
#=GS I3XMR7_HBV/1-354      AC I3XMR7.1
#=GS R9Q867_HBV/1-114      AC R9Q867.1
#=GS A0FDU8_HBV/1-189      AC A0FDU8.1
#=GS S5ZZP7_HBV/1-340      AC S5ZZP7.1
#=GS G1C8S2_HBV/1-341      AC G1C8S2.1
#=GS X4ZDG9_HBV/1-352      AC X4ZDG9.1
#=GS I0DGC7_HBV/1-352      AC I0DGC7.1
#=GS H2ERJ2_HBV/1-352      AC H2ERJ2.1
#=GS I0C8Q9_HBV/223-280    AC I0C8Q9.1
#=GS Q3ZKR1_HBV/1-354      AC Q3ZKR1.1
#=GS D3YGE3_HBV/1-341      AC D3YGE3.1
#=GS B5M5Q1_HBV/1-352      AC B5M5Q1.1
#=GS Q9QAF3_HBV/1-341      AC Q9QAF3.1
#=GS B4YKN0_HBV/1-354      AC B4YKN0.1
#=GS I0C893_HBV/1-354      AC I0C893.1
#=GS H9XR10_HBV/1-91       AC H9XR10.1
#=GS A5JIQ0_HBV/1-112      AC A5JIQ0.1
#=GS Q910V6_HBV/1-352      AC Q910V6.1
#=GS D6QVR0_HBV/1-352      AC D6QVR0.1
#=GS I0C8B0_HBV/1-354      AC I0C8B0.1
#=GS D3YFY5_HBV/1-341      AC D3YFY5.1
#=GS S5ZEF4_HBV/1-227      AC S5ZEF4.1
#=GS K9MCB7_HBV/1-24       AC K9MCB7.1
#=GS Q9QRQ8_HBV/165-207    AC Q9QRQ8.1
#=GS R9Q8C7_HBV/1-114      AC R9Q8C7.1
#=GS D0E5E7_HBV/1-352      AC D0E5E7.1
#=GS C1K1J1_HBV/1-352      AC C1K1J1.1
#=GS G1E7U5_HBV/1-341      AC G1E7U5.1
#=GS B7TUM3_HBV/1-352      AC B7TUM3.1
#=GS S5MVC0_HBV/1-352      AC S5MVC0.1
#=GS S5ZTP7_HBV/1-333      AC S5ZTP7.1
#=GS D9U5B9_HBV/1-352      AC D9U5B9.1
#=GS H9XRJ6_HBV/1-91       AC H9XRJ6.1
#=GS X4Z0B1_HBV/1-352      AC X4Z0B1.1
#=GS B5B4Q1_HBV/1-352      AC B5B4Q1.1
#=GS U3RGX1_HBV/1-218      AC U3RGX1.1
#=GS Q7TDQ1_HBV/1-352      AC Q7TDQ1.1
#=GS E5F0X0_HBV/1-49       AC E5F0X0.1
#=GS K4PXR2_HBV/2-86       AC K4PXR2.1
#=GS H9XRK0_HBV/1-91       AC H9XRK0.1
#=GS Q8B459_HBV/17-108     AC Q8B459.1
#=GS G0YVM3_HBV/233-287    AC G0YVM3.1
#=GS B0YJS3_HBV/1-351      AC B0YJS3.1
#=GS C9WDI5_HBV/1-255      AC C9WDI5.1
#=GS E5RPV7_HBV/1-343      AC E5RPV7.1
#=GS Q461C8_HBV/1-351      AC Q461C8.1
#=GS X4YXY0_HBV/1-352      AC X4YXY0.1
#=GS M4QBE2_HBV/1-171      AC M4QBE2.1
#=GS S5ZKF8_HBV/1-329      AC S5ZKF8.1
#=GS Q2L4J6_HBV/1-354      AC Q2L4J6.1
#=GS Q805G6_HBV/1-352      AC Q805G6.1
#=GS F5C100_HBV/1-354      AC F5C100.1
#=GS S5NZ83_HBV/1-341      AC S5NZ83.1
#=GS W6HYA1_HBV/1-315      AC W6HYA1.1
#=GS A0A023NKJ3_HBV/1-341  AC A0A023NKJ3.1
#=GS S6A6U3_HBV/1-342      AC S6A6U3.1
#=GS G1C8Q8_HBV/1-341      AC G1C8Q8.1
#=GS B5BPI5_HBV/1-352      AC B5BPI5.1
#=GS M4QAM0_HBV/1-153      AC M4QAM0.1
#=GS A5JI48_HBV/1-112      AC A5JI48.1
#=GS T2HR83_HBV/1-50       AC T2HR83.1
#=GS I0DCQ0_HBV/1-328      AC I0DCQ0.1
#=GS K7QG50_HBV/1-352      AC K7QG50.1
#=GS Q769K5_HBV/1-352      AC Q769K5.1
#=GS B5TFC5_HBV/1-112      AC B5TFC5.1
#=GS T2HS28_HBV/1-50       AC T2HS28.1
#=GS D3TJ85_HBV/1-352      AC D3TJ85.1
#=GS I7L946_HBV/1-354      AC I7L946.1
#=GS C5WJW6_HBV/1-352      AC C5WJW6.1
#=GS C1K1T9_HBV/1-350      AC C1K1T9.1
#=GS D5LC28_HBV/1-352      AC D5LC28.1
#=GS A0FDL8_HBV/1-303      AC A0FDL8.1
#=GS H9XRM0_HBV/1-91       AC H9XRM0.1
#=GS I0DDT3_HBV/1-328      AC I0DDT3.1
#=GS F5C1A7_HBV/1-354      AC F5C1A7.1
#=GS W0SPH8_HBV/1-352      AC W0SPH8.1
#=GS H6UGR2_HBV/1-337      AC H6UGR2.1
#=GS J7H6V3_HBV/1-152      AC J7H6V3.1
#=GS V9THC5_HBV/1-341      AC V9THC5.1
#=GS R9Q8Q9_HBV/1-114      AC R9Q8Q9.1
#=GS Q80H07_HBV/1-352      AC Q80H07.1
#=GS T1YU60_HBV/1-352      AC T1YU60.1
#=GS Q19SX6_HBV/1-341      AC Q19SX6.1
#=GS I0C8X6_HBV/1-354      AC I0C8X6.1
#=GS H6UGJ1_HBV/1-341      AC H6UGJ1.1
#=GS E5F0Y4_HBV/1-48       AC E5F0Y4.1
#=GS B9VKK7_HBV/1-352      AC B9VKK7.1
#=GS B5M600_HBV/1-352      AC B5M600.1
#=GS F5C102_HBV/1-354      AC F5C102.1
#=GS Q8JXG7_HBV/1-354      AC Q8JXG7.1
#=GS D0UDQ4_HBV/1-352      AC D0UDQ4.1
#=GS Q9YKJ0_HBV/1-352      AC Q9YKJ0.1
#=GS B3VLF7_HBV/1-165      AC B3VLF7.1
#=GS Q5DW09_HBV/1-352      AC Q5DW09.1
#=GS D6R6U9_HBV/1-352      AC D6R6U9.1
#=GS R9Q891_HBV/1-114      AC R9Q891.1
#=GS D3TJC3_HBV/218-305    AC D3TJC3.1
#=GS C3W3Z7_HBV/1-341      AC C3W3Z7.1
#=GS S5ZDT0_HBV/1-335      AC S5ZDT0.1
#=GS S5ZE30_HBV/1-341      AC S5ZE30.1
#=GS S5ZJV7_HBV/1-333      AC S5ZJV7.1
#=GS Q20C10_HBV/1-55       AC Q20C10.1
#=GS B9VKR9_HBV/1-352      AC B9VKR9.1
#=GS D0UEB5_HBV/1-352      AC D0UEB5.1
#=GS A5JIM7_HBV/41-77      AC A5JIM7.1
#=GS S5ZEL8_HBV/1-340      AC S5ZEL8.1
#=GS W6HVW6_HBV/1-315      AC W6HVW6.1
#=GS I0DDC6_HBV/1-328      AC I0DDC6.1
#=GS M4QIX9_HBV/1-171      AC M4QIX9.1
#=GS K4PX02_HBV/1-157      AC K4PX02.1
#=GS I0DE68_HBV/1-328      AC I0DE68.1
#=GS Q2F501_HBV/272-320    AC Q2F501.1
#=GS Q598R1_HBV/1-354      AC Q598R1.1
#=GS Q8JN15_HBV/1-341      AC Q8JN15.1
#=GS Q8B5Q9_HBV/1-190      AC Q8B5Q9.1
#=GS Q8B4E4_HBV/3-50       AC Q8B4E4.1
#=GS S6A6U4_HBV/1-343      AC S6A6U4.1
#=GS B5M5P2_HBV/1-352      AC B5M5P2.1
#=GS F5C1L4_HBV/1-341      AC F5C1L4.1
#=GS Q17UT1_HBVAW/1-354    AC Q17UT1.1
#=GS Q769H3_HBV/1-352      AC Q769H3.1
#=GS F5C0V7_HBV/1-354      AC F5C0V7.1
#=GS X2G9M7_HBV/1-351      AC X2G9M7.1
#=GS D7NL08_HBV/1-341      AC D7NL08.1
#=GS C7AYK5_HBV/1-355      AC C7AYK5.1
#=GS U3KUG1_HBV/1-162      AC U3KUG1.1
#=GS L7R7A0_HBV/1-341      AC L7R7A0.1
#=GS R9Q7W4_HBV/1-114      AC R9Q7W4.1
#=GS H6V5M4_HBV/1-341      AC H6V5M4.1
#=GS R9Q7Z8_HBV/1-114      AC R9Q7Z8.1
#=GS T1YU71_HBV/1-352      AC T1YU71.1
#=GS Q4FD57_HBV/1-339      AC Q4FD57.1
#=GS H6V5L2_HBV/1-341      AC H6V5L2.1
#=GS Q81110_HBV/1-49       AC Q81110.1
#=GS E5CZ60_HBV/1-352      AC E5CZ60.1
#=GS Q762E4_HBV/1-352      AC Q762E4.1
#=GS K7QG95_HBV/1-352      AC K7QG95.1
#=GS H9XQF4_HBV/1-91       AC H9XQF4.1
#=GS D3YGM2_HBV/1-339      AC D3YGM2.1
#=GS F5C114_HBV/1-284      AC F5C114.1
#=GS F5C0L9_HBV/1-354      AC F5C0L9.1
#=GS C9WDG1_HBV/1-341      AC C9WDG1.1
#=GS M9WR70_HBV/1-248      AC M9WR70.1
#=GS C7AY29_HBV/1-187      AC C7AY29.1
#=GS B5TXQ0_HBV/1-350      AC B5TXQ0.1
#=GS B7SXT7_HBV/1-334      AC B7SXT7.1
#=GS G9BNJ4_HBV/1-354      AC G9BNJ4.1
#=GS Q80GY2_HBV/1-352      AC Q80GY2.1
#=GS Q67919_HBV/1-341      AC Q67919.1
#=GS H1ACX2_HBV/1-352      AC H1ACX2.1
#=GS D0EE47_HBV/1-354      AC D0EE47.1
#=GS B5TFG9_HBV/1-112      AC B5TFG9.1
#=GS E0ZRP7_HBV/1-351      AC E0ZRP7.1
#=GS DPOL_HBVB2/1-352      AC P17393.1
#=GS G4XHX7_HBV/1-159      AC G4XHX7.1
#=GS D3YGR4_HBV/1-341      AC D3YGR4.1
#=GS F5C111_HBV/1-352      AC F5C111.1
#=GS B1GS21_HBV/1-354      AC B1GS21.1
#=GS B7TTY8_HBV/1-349      AC B7TTY8.1
#=GS G4XMD9_HBV/1-341      AC G4XMD9.1
#=GS S5ZL01_HBV/1-352      AC S5ZL01.1
#=GS S5ZT87_HBV/1-336      AC S5ZT87.1
#=GS S6A6X6_HBV/1-352      AC S6A6X6.1
#=GS K4PYL9_HBV/1-84       AC K4PYL9.1
#=GS D0E637_HBV/1-352      AC D0E637.1
#=GS D3TJZ0_HBV/1-352      AC D3TJZ0.1
#=GS S6C420_HBV/1-354      AC S6C420.1
#=GS G1C919_HBV/1-341      AC G1C919.1
#=GS Q81169_HBV/1-341      AC Q81169.1
#=GS Q20BY1_HBV/1-57       AC Q20BY1.1
#=GS I0DGE8_HBV/1-352      AC I0DGE8.1
#=GS B2LRW9_HBV/1-352      AC B2LRW9.1
#=GS DPOL_HBVF6/1-352      AC Q69605.1
#=GS A6MGA8_HBV/1-352      AC A6MGA8.1
#=GS S6A6S8_HBV/1-341      AC S6A6S8.1
#=GS Q8B4E6_HBV/1-353      AC Q8B4E6.1
#=GS F5C192_HBV/1-354      AC F5C192.1
#=GS F5C0H0_HBV/1-341      AC F5C0H0.1
#=GS I0DGE7_HBV/1-352      AC I0DGE7.1
#=GS B5M5J4_HBV/1-347      AC B5M5J4.1
#=GS S5ZT29_HBV/1-318      AC S5ZT29.1
#=GS B3VLJ3_HBV/1-176      AC B3VLJ3.1
#=GS A5JIE7_HBV/1-102      AC A5JIE7.1
#=GS D5LCE2_HBV/1-352      AC D5LCE2.1
#=GS A7YEU7_HBV/1-352      AC A7YEU7.1
#=GS D3TKD0_HBV/1-352      AC D3TKD0.1
#=GS H9N879_HBV/1-341      AC H9N879.1
#=GS D0E666_HBV/1-352      AC D0E666.1
#=GS E5RD85_HBV/1-352      AC E5RD85.1
#=GS S6A6V2_HBV/1-343      AC S6A6V2.1
#=GS I0C9H4_HBV/1-352      AC I0C9H4.1
#=GS X4YSQ2_HBV/1-352      AC X4YSQ2.1
#=GS S5ZDR6_HBV/1-352      AC S5ZDR6.1
#=GS C7DY71_HBV/1-347      AC C7DY71.1
#=GS Q20BP7_HBV/1-57       AC Q20BP7.1
#=GS B0FCS8_HBV/1-352      AC B0FCS8.1
#=GS B5B4F0_HBV/1-352      AC B5B4F0.1
#=GS F5C0V0_HBV/1-354      AC F5C0V0.1
#=GS G4XI21_HBV/1-160      AC G4XI21.1
#=GS O91582_HBV/1-276      AC O91582.1
#=GS B5TXT1_HBV/1-343      AC B5TXT1.1
#=GS G0YVN5_HBV/1-341      AC G0YVN5.1
#=GS Q9IXB1_HBV/1-52       AC Q9IXB1.1
#=GS B7TU57_HBV/1-352      AC B7TU57.1
#=GS H6UGS2_HBV/1-306      AC H6UGS2.1
#=GS I0DGE6_HBV/1-352      AC I0DGE6.1
#=GS A8R7F2_HBV/1-352      AC A8R7F2.1
#=GS I0C8I2_HBV/1-335      AC I0C8I2.1
#=GS D8KY05_HBV/1-352      AC D8KY05.1
#=GS Q1PCY4_HBV/1-352      AC Q1PCY4.1
#=GS K9UVF1_HBV/1-352      AC K9UVF1.1
#=GS R9Q8I6_HBV/1-114      AC R9Q8I6.1
#=GS B9VAZ4_HBV/1-352      AC B9VAZ4.1
#=GS I0C903_HBV/1-354      AC I0C903.1
#=GS S5ZFI0_HBV/1-335      AC S5ZFI0.1
#=GS I0C9F8_HBV/1-352      AC I0C9F8.1
#=GS E3Q0M1_HBV/1-352      AC E3Q0M1.1
#=GS H6UN72_HBV/1-341      AC H6UN72.1
#=GS I0DCN0_HBV/1-327      AC I0DCN0.1
#=GS B5M546_HBV/1-352      AC B5M546.1
#=GS C9WDA7_HBV/1-341      AC C9WDA7.1
#=GS R9Q7S3_HBV/1-114      AC R9Q7S3.1
#=GS Q20BP3_HBV/1-57       AC Q20BP3.1
#=GS X4YZY9_HBV/1-352      AC X4YZY9.1
#=GS H1ACW8_HBV/1-352      AC H1ACW8.1
#=GS Q20C14_HBV/1-56       AC Q20C14.1
#=GS D8KY09_HBV/1-352      AC D8KY09.1
#=GS DPOL_HBVE1/1-351      AC Q69602.1
#=GS M1G272_9HEPA/66-319   AC M1G272.1
#=GS A5JJ23_HBV/1-180      AC A5JJ23.1
#=GS G9HVZ5_HBV/1-352      AC G9HVZ5.1
#=GS K4PXP4_HBV/1-84       AC K4PXP4.1
#=GS U3RCD8_HBV/1-218      AC U3RCD8.1
#=GS G4XME7_HBV/1-341      AC G4XME7.1
#=GS F5C0M8_HBV/1-348      AC F5C0M8.1
#=GS B4YL77_HBV/1-341      AC B4YL77.1
#=GS Q4R1R6_HBV/1-38       AC Q4R1R6.1
#=GS K7QH42_HBV/1-222      AC K7QH42.1
#=GS S5ZZZ8_HBV/1-352      AC S5ZZZ8.1
#=GS L0BDH8_HBV/1-210      AC L0BDH8.1
#=GS G1E8K6_HBV/1-341      AC G1E8K6.1
#=GS C5WJX8_HBV/1-352      AC C5WJX8.1
#=GS L7R895_HBV/1-341      AC L7R895.1
#=GS S5ZFR2_HBV/1-336      AC S5ZFR2.1
#=GS A5JIP6_HBV/1-112      AC A5JIP6.1
#=GS E5F0W5_HBV/1-49       AC E5F0W5.1
#=GS G3XLB8_HBV/1-352      AC G3XLB8.1
#=GS D5LF71_HBV/1-352      AC D5LF71.1
#=GS L0BCA9_HBV/1-210      AC L0BCA9.1
#=GS J7IT22_HBV/1-352      AC J7IT22.1
#=GS Q80J83_HBV/1-352      AC Q80J83.1
#=GS G1E8F9_HBV/1-341      AC G1E8F9.1
#=GS D3YG45_HBV/1-341      AC D3YG45.1
#=GS D0E6I8_HBV/1-352      AC D0E6I8.1
#=GS Q9QAF7_HBV/1-341      AC Q9QAF7.1
#=GS B9VK47_HBV/1-352      AC B9VK47.1
#=GS B7TUT1_HBV/1-352      AC B7TUT1.1
#=GS H6UG47_HBV/1-341      AC H6UG47.1
#=GS DPOL_HBVA5/1-354      AC Q02314.2
#=GS A5JHU4_HBV/1-112      AC A5JHU4.1
#=GS Q20BV9_HBV/1-57       AC Q20BV9.1
#=GS G4XI41_HBV/1-160      AC G4XI41.1
#=GS E5RPK3_HBV/1-352      AC E5RPK3.1
#=GS C7DNJ5_HBV/1-351      AC C7DNJ5.1
#=GS B5AT85_HBV/1-352      AC B5AT85.1
#=GS Q20BQ3_HBV/1-57       AC Q20BQ3.1
#=GS I4CJS0_HBV/1-183      AC I4CJS0.1
#=GS D5LFM1_HBV/1-352      AC D5LFM1.1
#=GS H9XQG6_HBV/1-91       AC H9XQG6.1
#=GS B8PTD8_HBV/1-341      AC B8PTD8.1
#=GS Q2LCC8_HBV/1-333      AC Q2LCC8.1
#=GS H2ER90_HBV/1-352      AC H2ER90.1
#=GS I0C876_HBV/1-354      AC I0C876.1
#=GS G4XI05_HBV/1-160      AC G4XI05.1
#=GS S5ZF05_HBV/1-336      AC S5ZF05.1
#=GS S5ZZU1_HBV/1-340      AC S5ZZU1.1
#=GS H9XQE2_HBV/1-91       AC H9XQE2.1
#=GS Q8JXI0_HBV/1-351      AC Q8JXI0.1
#=GS A6MG96_HBV/1-352      AC A6MG96.1
#=GS F4ZCA2_HBV/1-49       AC F4ZCA2.1
#=GS S5ZLE8_HBV/1-341      AC S5ZLE8.1
#=GS Q9DLM4_HBV/1-341      AC Q9DLM4.1
#=GS B3V8V6_HBV/1-341      AC B3V8V6.1
#=GS X4Z680_HBV/50-111     AC X4Z680.1
#=GS F5C0N9_HBV/1-354      AC F5C0N9.1
#=GS K4N0V0_HBV/1-352      AC K4N0V0.1
#=GS I0C974_HBV/1-351      AC I0C974.1
#=GS B7TUQ0_HBV/1-352      AC B7TUQ0.1
#=GS I0DGJ2_HBV/1-352      AC I0DGJ2.1
#=GS H9XRC2_HBV/1-91       AC H9XRC2.1
#=GS M9PN23_HBV/1-49       AC M9PN23.1
#=GS I0DGD8_HBV/1-352      AC I0DGD8.1
#=GS D5L234_9HEPA/5-388    AC D5L234.1
#=GS A5LG78_HBV/1-346      AC A5LG78.1
#=GS B5BPS7_HBV/1-352      AC B5BPS7.1
#=GS Q91EH3_HBV/1-354      AC Q91EH3.1
#=GS I0DCD6_HBV/1-328      AC I0DCD6.1
#=GS G9G9T6_HBV/1-326      AC G9G9T6.2
#=GS S6A024_HBV/1-341      AC S6A024.1
#=GS B5M5T6_HBV/1-352      AC B5M5T6.1
#=GS A6MG68_HBV/1-352      AC A6MG68.1
#=GS M9PNG7_HBV/1-49       AC M9PNG7.1
#=GS H6WFM5_HBV/1-112      AC H6WFM5.1
#=GS D5LDA7_HBV/1-352      AC D5LDA7.1
#=GS F5C0T2_HBV/1-351      AC F5C0T2.1
#=GS B7TTR2_HBV/1-352      AC B7TTR2.1
#=GS K0F4Q0_HBV/1-352      AC K0F4Q0.1
#=GS D2JMJ2_HBV/1-336      AC D2JMJ2.1
#=GS Q5U7P8_HBV/1-341      AC Q5U7P8.1
#=GS J7H043_HBV/1-353      AC J7H043.1
#=GS B3VLG3_HBV/1-176      AC B3VLG3.1
#=GS O91574_HBV/1-339      AC O91574.1
#=GS X4Z081_HBV/1-238      AC X4Z081.1
#=GS I0DCH5_HBV/1-328      AC I0DCH5.1
#=GS I0C8U4_HBV/1-354      AC I0C8U4.1
#=GS S5ZFD5_HBV/1-337      AC S5ZFD5.1
#=GS Q918N7_9HEPA/222-393  AC Q918N7.1
#=GS H6UGJ7_HBV/1-341      AC H6UGJ7.1
#=GS H9XR82_HBV/1-91       AC H9XR82.1
#=GS B5M5W4_HBV/237-291    AC B5M5W4.1
#=GS G8CQJ7_HBV/1-49       AC G8CQJ7.1
#=GS G0YVL9_HBV/1-341      AC G0YVL9.1
#=GS D5LEL0_HBV/1-352      AC D5LEL0.1
#=GS DPOL_HBVGO/1-341      AC Q9YPV8.1
#=GS F5C0R2_HBV/1-351      AC F5C0R2.1
#=GS R9Q8Q8_HBV/1-114      AC R9Q8Q8.1
#=GS Q5SDL6_HBV/1-352      AC Q5SDL6.1
#=GS B5TXZ5_HBV/1-352      AC B5TXZ5.1
#=GS Q80GV2_HBV/1-352      AC Q80GV2.1
#=GS R9Q8D2_HBV/1-109      AC R9Q8D2.1
#=GS X4YHQ5_HBV/1-341      AC X4YHQ5.1
#=GS E5F0Y1_HBV/1-49       AC E5F0Y1.1
#=GS Q5R2L9_HBV/1-352      AC Q5R2L9.1
#=GS M4Q822_HBV/1-171      AC M4Q822.1
#=GS G4XMH9_HBV/1-352      AC G4XMH9.1
#=GS Q4KRC1_HBV/1-354      AC Q4KRC1.1
#=GS B0YK46_HBV/1-352      AC B0YK46.1
#=GS D2JMR9_HBV/1-352      AC D2JMR9.1
#=GS S6A0C9_HBV/1-332      AC S6A0C9.1
#=GS S5ZEL3_HBV/1-328      AC S5ZEL3.1
#=GS B5TF89_HBV/1-112      AC B5TF89.1
#=GS O09509_HBV/1-352      AC O09509.1
#=GS Q80J89_HBV/1-352      AC Q80J89.1
#=GS L0H877_HBV/1-352      AC L0H877.1
#=GS S6A6R9_HBV/1-342      AC S6A6R9.1
#=GS B4YLG8_HBV/1-341      AC B4YLG8.1
#=GS S5ZSB3_HBV/223-307    AC S5ZSB3.1
#=GS I0DGC0_HBV/1-352      AC I0DGC0.1
#=GS H9XRX3_HBV/1-91       AC H9XRX3.1
#=GS I0DDB7_HBV/1-328      AC I0DDB7.1
#=GS C7DMY5_HBV/1-351      AC C7DMY5.1
#=GS O91562_HBV/1-352      AC O91562.2
#=GS F5C068_HBV/1-352      AC F5C068.1
#=GS K0FGZ3_HBV/1-352      AC K0FGZ3.1
#=GS D0E641_HBV/1-352      AC D0E641.1
#=GS V5JEP2_HBV/1-354      AC V5JEP2.1
#=GS L0BDG8_HBV/1-210      AC L0BDG8.1
#=GS B4Y4K7_HBV/1-352      AC B4Y4K7.1
#=GS F5C0Z3_HBV/1-354      AC F5C0Z3.1
#=GS S5ZF59_HBV/1-339      AC S5ZF59.1
#=GS Q20BS7_HBV/2-63       AC Q20BS7.1
#=GS B9VKN6_HBV/1-352      AC B9VKN6.1
#=GS I0C8U3_HBV/1-354      AC I0C8U3.1
#=GS B5TF65_HBV/1-112      AC B5TF65.1
#=GS I0C8N7_HBV/1-341      AC I0C8N7.1
#=GS M4QB89_HBV/1-171      AC M4QB89.1
#=GS B9VK43_HBV/1-352      AC B9VK43.1
#=GS D5LEG1_HBV/1-352      AC D5LEG1.1
#=GS C9WDP1_HBV/1-341      AC C9WDP1.1
#=GS G9G8Y4_HBV/1-341      AC G9G8Y4.1
#=GS L0HCH7_HBV/1-352      AC L0HCH7.1
#=GS D0E5L3_HBV/1-352      AC D0E5L3.2
#=GS I0DDW2_HBV/1-328      AC I0DDW2.1
#=GS Q2LCC4_HBV/1-341      AC Q2LCC4.1
#=GS I4CJR8_HBV/1-183      AC I4CJR8.1
#=GS D6QVL5_HBV/1-352      AC D6QVL5.1
#=GS H9XQX2_HBV/1-91       AC H9XQX2.1
#=GS R9Q8P5_HBV/1-114      AC R9Q8P5.1
#=GS F5C0Z1_HBV/1-354      AC F5C0Z1.1
#=GS B4YKK9_HBV/1-354      AC B4YKK9.1
#=GS H9XRN2_HBV/1-91       AC H9XRN2.1
#=GS C7DSL0_HBV/1-341      AC C7DSL0.1
#=GS G9G984_HBV/1-245      AC G9G984.1
#=GS F5C0Y1_HBV/1-354      AC F5C0Y1.1
#=GS D5MSI7_HBV/1-343      AC D5MSI7.1
#=GS B5M5F9_HBV/1-352      AC B5M5F9.1
#=GS Q8V1I3_HBV/1-345      AC Q8V1I3.1
#=GS D4QGI7_HBV/1-341      AC D4QGI7.1
#=GS D5MSF5_HBV/1-352      AC D5MSF5.1
#=GS G9G977_HBV/1-341      AC G9G977.1
#=GS W0SKT6_HBV/1-352      AC W0SKT6.1
#=GS S5ZT65_HBV/1-341      AC S5ZT65.1
#=GS F5C185_HBV/1-354      AC F5C185.1
#=GS H9XRW1_HBV/1-91       AC H9XRW1.1
#=GS B9W407_HBV/1-354      AC B9W407.1
#=GS Q89248_9HEPA/5-243    AC Q89248.1
#=GS A5JIF5_HBV/1-112      AC A5JIF5.1
#=GS T1YUE5_HBV/1-352      AC T1YUE5.1
#=GS Q80H26_HBV/1-337      AC Q80H26.1
#=GS G3XH18_HBV/1-332      AC G3XH18.1
#=GS Q67835_HBV/1-81       AC Q67835.1
#=GS E5CYW7_HBV/1-352      AC E5CYW7.1
#=GS C7AYM5_HBV/1-354      AC C7AYM5.1
#=GS Q80H48_HBV/1-352      AC Q80H48.1
#=GS B7TU18_HBV/1-352      AC B7TU18.1
#=GS Q9DUH5_HBV/1-341      AC Q9DUH5.1
#=GS Q19SZ8_HBV/1-340      AC Q19SZ8.1
#=GS B5TXL8_HBV/1-352      AC B5TXL8.1
#=GS A5JIF9_HBV/1-112      AC A5JIF9.1
#=GS Q58VZ4_HBV/1-352      AC Q58VZ4.1
#=GS D0EDY1_HBV/1-354      AC D0EDY1.1
#=GS D0EE67_HBV/1-354      AC D0EE67.1
#=GS A5GZM2_HBV/1-352      AC A5GZM2.1
#=GS B2Y6V5_HBV/1-341      AC B2Y6V5.1
#=GS C7DMN2_HBV/1-351      AC C7DMN2.1
#=GS I0DC82_HBV/1-328      AC I0DC82.1
#=GS I0DGA6_HBV/1-352      AC I0DGA6.1
#=GS B8PTD1_HBV/1-341      AC B8PTD1.1
#=GS W8NZU3_HBV/1-352      AC W8NZU3.1
#=GS R9Q846_HBV/1-114      AC R9Q846.1
#=GS Q2L4P3_HBV/1-341      AC Q2L4P3.1
#=GS Q9YIV1_HBV/1-167      AC Q9YIV1.1
#=GS I0DGH1_HBV/1-352      AC I0DGH1.1
#=GS K9MD26_HBV/1-24       AC K9MD26.1
#=GS C7AYL9_HBV/1-354      AC C7AYL9.1
#=GS A5JHQ8_HBV/1-112      AC A5JHQ8.1
#=GS E0ZRA7_HBV/1-351      AC E0ZRA7.1
#=GS Q9QAD4_HBV/1-352      AC Q9QAD4.1
#=GS Q9IXC6_HBV/1-52       AC Q9IXC6.1
#=GS I0DCV1_HBV/1-328      AC I0DCV1.1
#=GS E0ZRC7_HBV/1-351      AC E0ZRC7.1
#=GS C3W476_HBV/1-341      AC C3W476.1
#=GS H9XRR8_HBV/1-91       AC H9XRR8.1
#=GS D0E5F1_HBV/1-346      AC D0E5F1.1
#=GS D0EEH1_HBV/1-354      AC D0EEH1.1
#=GS B5M663_HBV/1-352      AC B5M663.1
#=GS A7L368_HBV/1-30       AC A7L368.1
#=GS A5LG30_HBV/1-352      AC A5LG30.1
#=GS E5F0X6_HBV/1-49       AC E5F0X6.1
#=GS B5M5K8_HBV/1-352      AC B5M5K8.1
#=GS B9VKM3_HBV/1-352      AC B9VKM3.1
#=GS C9WDR0_HBV/1-352      AC C9WDR0.1
#=GS D0E659_HBV/1-352      AC D0E659.1
#=GS I0DE08_HBV/1-328      AC I0DE08.1
#=GS K0FCE1_HBV/1-352      AC K0FCE1.1
#=GS B8PTF2_HBV/1-341      AC B8PTF2.1
#=GS Q20BS3_HBV/1-57       AC Q20BS3.1
#=GS I0C873_HBV/1-354      AC I0C873.1
#=GS B0FCA2_HBV/1-283      AC B0FCA2.1
#=GS Q5KR19_HBV/1-352      AC Q5KR19.1
#=GS L0HAF1_HBV/1-352      AC L0HAF1.1
#=GS C3W3U8_HBV/1-341      AC C3W3U8.1
#=GS A5JI95_HBV/1-112      AC A5JI95.1
#=GS B4YL96_HBV/1-341      AC B4YL96.1
#=GS F5C0Y4_HBV/1-354      AC F5C0Y4.1
#=GS E5RDA9_HBV/1-341      AC E5RDA9.1
#=GS E5RD65_HBV/1-352      AC E5RD65.1
#=GS T2HTN0_HBV/1-50       AC T2HTN0.1
#=GS G3XGZ2_HBV/1-343      AC G3XGZ2.1
#=GS W6HWJ6_HBV/1-315      AC W6HWJ6.1
#=GS H9XQL7_HBV/1-91       AC H9XQL7.1
#=GS G4XI47_HBV/1-160      AC G4XI47.1
#=GS F5C0W2_HBV/1-354      AC F5C0W2.1
#=GS E0ZRK2_HBV/1-351      AC E0ZRK2.1
#=GS B5M5V8_HBV/243-310    AC B5M5V8.1
#=GS D5LDM2_HBV/1-352      AC D5LDM2.1
#=GS I0DCI3_HBV/1-330      AC I0DCI3.1
#=GS K4GHB8_HBV/64-117     AC K4GHB8.1
#=GS B5M5N9_HBV/1-352      AC B5M5N9.1
#=GS B0FD79_HBV/1-346      AC B0FD79.1
#=GS D6QVQ3_HBV/1-352      AC D6QVQ3.1
#=GS Q80GW5_HBV/1-286      AC Q80GW5.1
#=GS B9VJZ7_HBV/1-352      AC B9VJZ7.1
#=GS I0DGA3_HBV/1-352      AC I0DGA3.1
#=GS S6A0A4_HBV/1-340      AC S6A0A4.1
#=GS D0UE99_HBV/1-352      AC D0UE99.1
#=GS A5GZN4_HBV/1-352      AC A5GZN4.1
#=GS S6A063_HBV/1-336      AC S6A063.1
#=GS D5LEQ2_HBV/1-352      AC D5LEQ2.1
#=GS F5C0H9_HBV/1-341      AC F5C0H9.1
#=GS B7TTA3_HBV/1-352      AC B7TTA3.1
#=GS S5ZF68_HBV/1-331      AC S5ZF68.1
#=GS G1E7P6_HBV/1-341      AC G1E7P6.1
#=GS F5C0J5_HBV/1-341      AC F5C0J5.1
#=GS H3K3H2_HBV/1-354      AC H3K3H2.1
#=GS F5C153_HBV/1-354      AC F5C153.1
#=GS S6A002_HBV/1-352      AC S6A002.1
#=GS C7DML9_HBV/1-351      AC C7DML9.1
#=GS G1C8X8_HBV/1-341      AC G1C8X8.1
#=GS Q5DW20_HBV/1-354      AC Q5DW20.1
#=GS Q91IF5_HBV/1-161      AC Q91IF5.1
#=GS D0E5T7_HBV/1-352      AC D0E5T7.1
#=GS B9VK90_HBV/1-352      AC B9VK90.1
#=GS B5ASN8_HBV/1-352      AC B5ASN8.1
#=GS D5MSF9_HBV/1-352      AC D5MSF9.1
#=GS C7DSJ9_HBV/1-341      AC C7DSJ9.1
#=GS G8CQJ5_HBV/1-49       AC G8CQJ5.1
#=GS G3XGX6_HBV/1-343      AC G3XGX6.1
#=GS I0DCR6_HBV/1-317      AC I0DCR6.1
#=GS D7NL48_HBV/1-341      AC D7NL48.1
#=GS G3EQX2_HBV/1-48       AC G3EQX2.1
#=GS L7R7P7_HBV/1-341      AC L7R7P7.1
#=GS E5F0W6_HBV/1-41       AC E5F0W6.1
#=GS D6QVV0_HBV/1-352      AC D6QVV0.1
#=GS H9XRQ6_HBV/1-91       AC H9XRQ6.1
#=GS I0DGE2_HBV/1-352      AC I0DGE2.1
#=GS G1C8N8_HBV/1-341      AC G1C8N8.1
#=GS D0UDZ2_HBV/1-352      AC D0UDZ2.1
#=GS A0A023NKN5_HBV/1-341  AC A0A023NKN5.1
#=GS J7IN75_HBV/1-352      AC J7IN75.1
#=GS E5F0X4_HBV/1-49       AC E5F0X4.1
#=GS W0SLP7_HBV/1-353      AC W0SLP7.1
#=GS G4XML5_HBV/1-352      AC G4XML5.1
#=GS C1K1I4_HBV/1-352      AC C1K1I4.1
#=GS G3XGT2_HBV/1-342      AC G3XGT2.1
#=GS D5LCR8_HBV/1-352      AC D5LCR8.1
#=GS F5C0V1_HBV/1-354      AC F5C0V1.1
#=GS R9Q877_HBV/1-111      AC R9Q877.1
#=GS C7AYK1_HBV/1-348      AC C7AYK1.2
#=GS DPOL_ASHV/222-388     AC Q64898.1
#=GS R9Q8K5_HBV/1-114      AC R9Q8K5.1
#=GS H6V5S2_HBV/1-352      AC H6V5S2.1
#=GS O91578_HBV/1-352      AC O91578.1
#=GS A0A023NJZ6_HBV/1-341  AC A0A023NJZ6.1
#=GS D5LDG3_HBV/1-352      AC D5LDG3.1
#=GS D5LD79_HBV/1-352      AC D5LD79.1
#=GS H9XRU9_HBV/1-91       AC H9XRU9.1
#=GS F5C1T5_HBV/1-347      AC F5C1T5.1
#=GS I0C8K0_HBV/1-350      AC I0C8K0.1
#=GS C1K1E6_HBV/1-351      AC C1K1E6.1
#=GS X2G839_HBV/1-351      AC X2G839.1
#=GS D5LBB0_HBV/1-352      AC D5LBB0.1
#=GS Q6IT65_9HEPA/5-388    AC Q6IT65.1
#=GS Q9QMJ3_HBV/1-352      AC Q9QMJ3.1
#=GS D3YG77_HBV/1-341      AC D3YG77.1
#=GS J7IFM4_HBV/1-352      AC J7IFM4.1
#=GS D0E652_HBV/1-352      AC D0E652.1
#=GS F5C1F9_HBV/1-341      AC F5C1F9.1
#=GS B9VKS3_HBV/1-352      AC B9VKS3.1
#=GS L0BDZ1_HBV/1-210      AC L0BDZ1.1
#=GS S5ZLW2_HBV/1-341      AC S5ZLW2.1
#=GS E5F0W9_HBV/1-26       AC E5F0W9.1
#=GS D3YGP6_HBV/1-341      AC D3YGP6.1
#=GS G1C8P4_HBV/1-324      AC G1C8P4.1
#=GS B2Y6W7_HBV/1-341      AC B2Y6W7.1
#=GS F5C133_HBV/1-354      AC F5C133.1
#=GS DPOL_HBVD7/1-341      AC O56655.1
#=GS K4PXL1_HBV/1-352      AC K4PXL1.1
#=GS O72031_HBV/1-171      AC O72031.1
#=GS A6MG80_HBV/1-352      AC A6MG80.1
#=GS Q2L4M8_HBV/1-341      AC Q2L4M8.1
#=GS U3MBX0_HBV/2-199      AC U3MBX0.1
#=GS G1E8D3_HBV/1-341      AC G1E8D3.1
#=GS B9VKA2_HBV/1-352      AC B9VKA2.1
#=GS B7TU14_HBV/1-352      AC B7TU14.1
#=GS Q9QBF6_HBV/1-352      AC Q9QBF6.1
#=GS X2G9N5_HBV/1-351      AC X2G9N5.1
#=GS I0DDZ4_HBV/1-241      AC I0DDZ4.1
#=GS E5CYZ3_HBV/1-352      AC E5CYZ3.1
#=GS B0YK52_HBV/1-352      AC B0YK52.1
#=GS R9Q852_HBV/1-114      AC R9Q852.1
#=GS C3W3P5_HBV/1-341      AC C3W3P5.1
#=GS D0E5Z1_HBV/1-352      AC D0E5Z1.1
#=GS E5F0X9_HBV/1-49       AC E5F0X9.1
#=GS B1ABQ3_HBV/1-352      AC B1ABQ3.1
#=GS C9WDN4_HBV/1-341      AC C9WDN4.1
#=GS S6A6Z1_HBV/1-341      AC S6A6Z1.1
#=GS DPOL_WHV4/5-393       AC P12898.1
#=GS D3GIL7_HBV/1-336      AC D3GIL7.1
#=GS H9XQW0_HBV/1-91       AC H9XQW0.1
#=GS Q00K72_HBV/1-352      AC Q00K72.1
#=GS A8D6R3_HBV/1-352      AC A8D6R3.1
#=GS Q20BV3_HBV/1-57       AC Q20BV3.1
#=GS B0FC38_HBV/1-352      AC B0FC38.1
#=GS J7H606_HBV/223-298    AC J7H606.1
#=GS S5ZS38_HBV/1-352      AC S5ZS38.1
#=GS L8E6T9_HBV/1-352      AC L8E6T9.1
#=GS D9U5P0_HBV/283-316    AC D9U5P0.1
#=GS D2JMJ6_HBV/1-352      AC D2JMJ6.1
#=GS B3VLL7_HBV/1-176      AC B3VLL7.1
#=GS I3XMM0_HBV/1-354      AC I3XMM0.1
#=GS B5M5V2_HBV/1-281      AC B5M5V2.1
#=GS Q20BR5_HBV/1-56       AC Q20BR5.1
#=GS B0FCH9_HBV/1-352      AC B0FCH9.1
#=GS F5C0L6_HBV/1-354      AC F5C0L6.1
#=GS Q4W6E8_HBV/1-351      AC Q4W6E8.1
#=GS B9VK08_HBV/1-352      AC B9VK08.1
#=GS H9XRR4_HBV/1-91       AC H9XRR4.1
#=GS Q1T7D1_HBV/1-341      AC Q1T7D1.1
#=GS F1CFC3_HBV/1-341      AC F1CFC3.1
#=GS DPOL_HBVE3/1-351      AC Q9QAW8.1
#=GS Q1XHG2_HBV/1-354      AC Q1XHG2.2
#=GS W8PAG0_HBV/1-352      AC W8PAG0.1
#=GS D3TKA3_HBV/1-352      AC D3TKA3.1
#=GS Q2EIF9_HBV/1-346      AC Q2EIF9.1
#=GS B5M5D0_HBV/1-352      AC B5M5D0.1
#=GS L7R8V0_HBV/1-341      AC L7R8V0.1
#=GS B0FD90_HBV/1-352      AC B0FD90.1
#=GS B9VL25_HBV/1-352      AC B9VL25.1
#=GS F5C116_HBV/281-320    AC F5C116.1
#=GS S5ZZL0_HBV/1-336      AC S5ZZL0.1
#=GS X4YY79_HBV/1-352      AC X4YY79.1
#=GS F5C0S6_HBV/1-333      AC F5C0S6.1
#=GS G4XIB5_HBV/1-130      AC G4XIB5.1
#=GS M9PMV3_HBV/1-24       AC M9PMV3.1
#=GS B5BPV8_HBV/1-352      AC B5BPV8.1
#=GS A5JIE3_HBV/1-112      AC A5JIE3.1
#=GS F5C0T9_HBV/1-351      AC F5C0T9.1
#=GS S6A056_HBV/1-340      AC S6A056.1
#=GS I0C8V8_HBV/1-354      AC I0C8V8.1
#=GS B7TUF5_HBV/1-340      AC B7TUF5.1
#=GS S6A712_HBV/1-341      AC S6A712.1
#=GS G4XI77_HBV/1-160      AC G4XI77.1
#=GS S5ZZJ5_HBV/1-340      AC S5ZZJ5.1
#=GS I0DGG6_HBV/1-160      AC I0DGG6.1
#=GS R9Q8F5_HBV/1-103      AC R9Q8F5.1
#=GS H9BDZ7_HBV/1-351      AC H9BDZ7.1
#=GS F5C062_HBV/1-352      AC F5C062.1
#=GS X4Z0C9_HBV/1-352      AC X4Z0C9.1
#=GS X4ZCW7_HBV/1-352      AC X4ZCW7.1
#=GS B5M522_HBV/1-352      AC B5M522.1
#=GS Q8JLX3_HBV/1-354      AC Q8JLX3.1
#=GS I0DCW7_HBV/1-328      AC I0DCW7.1
#=GS D6QVS9_HBV/1-352      AC D6QVS9.1
#=GS B1ABL4_HBV/236-291    AC B1ABL4.1
#=GS F5C0W0_HBV/1-354      AC F5C0W0.1
#=GS E0ZRU7_HBV/1-351      AC E0ZRU7.1
#=GS Q1XHE6_HBV/1-341      AC Q1XHE6.1
#=GS I0C918_HBV/1-354      AC I0C918.1
#=GS G9G905_HBV/1-341      AC G9G905.1
#=GS L7R9J6_HBV/1-341      AC L7R9J6.1
#=GS Q80MQ8_HBV/1-352      AC Q80MQ8.1
#=GS L8AYS0_HBV/1-341      AC L8AYS0.1
#=GS D2U630_HBV/1-351      AC D2U630.1
#=GS R9Q8T3_HBV/1-114      AC R9Q8T3.1
#=GS F5C1A9_HBV/1-354      AC F5C1A9.1
#=GS D0E6J6_HBV/1-352      AC D0E6J6.1
#=GS F5C1B0_HBV/1-354      AC F5C1B0.1
#=GS Q9IXA2_HBV/1-52       AC Q9IXA2.1
#=GS Q6T6J6_9HEPA/59-223   AC Q6T6J6.1
#=GS I0DE96_HBV/1-328      AC I0DE96.1
#=GS B5TF06_HBV/1-112      AC B5TF06.1
#=GS D0E5V6_HBV/1-352      AC D0E5V6.1
#=GS I0C8H5_HBV/1-354      AC I0C8H5.1
#=GS D0ESR5_HBV/1-352      AC D0ESR5.1
#=GS G9G8R7_HBV/1-341      AC G9G8R7.1
#=GS D5LCS2_HBV/1-352      AC D5LCS2.1
#=GS D5MSH7_HBV/1-343      AC D5MSH7.1
#=GS Q76B05_HBV/1-352      AC Q76B05.1
#=GS E5CYZ7_HBV/1-352      AC E5CYZ7.1
#=GS Q6X7Z6_9HEPA/60-340   AC Q6X7Z6.1
#=GS G1C973_HBV/1-341      AC G1C973.1
#=GS B4YT95_HBV/1-352      AC B4YT95.1
#=GS T2HR91_HBV/1-50       AC T2HR91.1
#=GS I0C924_HBV/1-354      AC I0C924.1
#=GS Q1RN63_HBV/1-352      AC Q1RN63.1
#=GS F5C156_HBV/1-354      AC F5C156.1
#=GS D2U626_HBV/1-351      AC D2U626.1
#=GS M1G280_9HEPA/72-375   AC M1G280.1
#=GS H9XRG2_HBV/1-91       AC H9XRG2.1
#=GS B5M4Y1_HBV/1-334      AC B5M4Y1.1
#=GS B5TF69_HBV/1-112      AC B5TF69.1
#=GS C1K227_HBV/1-289      AC C1K227.1
#=GS D3GE28_HBV/1-352      AC D3GE28.1
#=GS I0DDR1_HBV/1-251      AC I0DDR1.1
#=GS E9L2K4_HBV/1-171      AC E9L2K4.1
#=GS G4XHY4_HBV/1-160      AC G4XHY4.1
#=GS B2WSP5_HBV/1-352      AC B2WSP5.1
#=GS B7TV47_HBV/1-352      AC B7TV47.1
#=GS X4YYK8_HBV/1-352      AC X4YYK8.1
#=GS B5BPN3_HBV/1-341      AC B5BPN3.1
#=GS A6YK00_HBV/136-218    AC A6YK00.1
#=GS S6A0D9_HBV/1-337      AC S6A0D9.1
#=GS O91565_HBV/1-352      AC O91565.1
#=GS I1UYU5_HBV/1-166      AC I1UYU5.1
#=GS I0C8X3_HBV/1-354      AC I0C8X3.1
#=GS E0ZRL3_HBV/1-351      AC E0ZRL3.1
#=GS F5C143_HBV/1-354      AC F5C143.1
#=GS D6QW18_HBV/1-352      AC D6QW18.1
#=GS E3Q0E8_HBV/1-352      AC E3Q0E8.1
#=GS S5ZSW4_HBV/1-317      AC S5ZSW4.1
#=GS E0ZRP0_HBV/1-351      AC E0ZRP0.1
#=GS I0DGB8_HBV/1-352      AC I0DGB8.1
#=GS D0E6F6_HBV/1-352      AC D0E6F6.1
#=GS B0FD67_HBV/1-346      AC B0FD67.1
#=GS U3KUC8_HBV/1-171      AC U3KUC8.1
#=GS D3GIK5_HBV/1-352      AC D3GIK5.1
#=GS Q918N3_9HEPA/222-393  AC Q918N3.1
#=GS E5RD45_HBV/1-352      AC E5RD45.1
#=GS I0DGE9_HBV/1-342      AC I0DGE9.1
#=GS S5ZFP2_HBV/1-340      AC S5ZFP2.1
#=GS L0BDC5_HBV/1-210      AC L0BDC5.1
#=GS F5C121_HBV/1-284      AC F5C121.1
#=GS DPOL_HBVC8/1-347      AC Q81165.1
#=GS G4XIB2_HBV/1-130      AC G4XIB2.1
#=GS F5C114_HBV/281-320    AC F5C114.1
#=GS D5LBM0_HBV/1-352      AC D5LBM0.1
#=GS S6A702_HBV/1-342      AC S6A702.1
#=GS T2HR06_HBV/1-50       AC T2HR06.1
#=GS D9U1R4_HBV/1-352      AC D9U1R4.1
#=GS B2WSS3_HBV/1-352      AC B2WSS3.1
#=GS H2ERI7_HBV/272-303    AC H2ERI7.1
#=GS E5RPR1_HBV/1-332      AC E5RPR1.1
#=GS O09505_HBV/1-214      AC O09505.1
#=GS D0E5U1_HBV/1-352      AC D0E5U1.1
#=GS B7TTH5_HBV/1-352      AC B7TTH5.1
#=GS D0E633_HBV/1-352      AC D0E633.1
#=GS D3YGQ8_HBV/1-341      AC D3YGQ8.1
#=GS L0BDY4_HBV/1-210      AC L0BDY4.1
#=GS I3XMV1_HBV/1-354      AC I3XMV1.1
#=GS I4CJU8_HBV/1-30       AC I4CJU8.1
#=GS D0E6D6_HBV/1-352      AC D0E6D6.1
#=GS D7NKV9_HBV/1-341      AC D7NKV9.1
#=GS H6UN76_HBV/1-341      AC H6UN76.1
#=GS Q9DKP6_HBV/1-19       AC Q9DKP6.1
#=GS Q5U7R5_HBV/1-341      AC Q5U7R5.1
#=GS D2U646_HBV/1-351      AC D2U646.1
#=GS I1UYV1_HBV/1-166      AC I1UYV1.1
#=GS D5LE55_HBV/1-352      AC D5LE55.1
#=GS G4XHX1_HBV/1-160      AC G4XHX1.1
#=GS Q2V2L2_HBV/1-352      AC Q2V2L2.1
#=GS B2CY09_HBV/1-352      AC B2CY09.1
#=GS I0C885_HBV/1-354      AC I0C885.1
#=GS Q8AYU1_HBV/1-341      AC Q8AYU1.1
#=GS D0E5K3_HBV/1-352      AC D0E5K3.1
#=GS H2ERJ8_HBV/1-352      AC H2ERJ8.1
#=GS K0FH17_HBV/1-352      AC K0FH17.1
#=GS L0BC90_HBV/1-210      AC L0BC90.1
#=GS X4ZF66_HBV/1-352      AC X4ZF66.1
#=GS A5JID9_HBV/1-106      AC A5JID9.1
#=GS D2X4X8_HBV/1-172      AC D2X4X8.1
#=GS I0C9D3_HBV/1-334      AC I0C9D3.1
#=GS B5B4G4_HBV/1-352      AC B5B4G4.1
#=GS B2WSQ2_HBV/1-352      AC B2WSQ2.1
#=GS O09505_HBV/212-310    AC O09505.1
#=GS I3XMV8_HBV/1-354      AC I3XMV8.1
#=GS D3TK04_HBV/1-240      AC D3TK04.1
#=GS R9Q8K6_HBV/1-114      AC R9Q8K6.1
#=GS Q9YQ43_HBV/1-167      AC Q9YQ43.1
#=GS Q9YKI7_HBV/1-352      AC Q9YKI7.1
#=GS B7TTE7_HBV/1-352      AC B7TTE7.1
#=GS A5JJ26_HBV/70-125     AC A5JJ26.1
#=GS R9Q7X4_HBV/40-85      AC R9Q7X4.1
#=GS I0C8N9_HBV/1-341      AC I0C8N9.1
#=GS B7TTR9_HBV/1-352      AC B7TTR9.1
#=GS A4F242_HBV/1-352      AC A4F242.1
#=GS I0DGJ8_HBV/1-352      AC I0DGJ8.1
#=GS B5M591_HBV/1-346      AC B5M591.1
#=GS X4ZE65_HBV/1-352      AC X4ZE65.1
#=GS D2U654_HBV/1-351      AC D2U654.1
#=GS I0C968_HBV/1-351      AC I0C968.1
#=GS Q4FDM6_HBV/1-352      AC Q4FDM6.1
#=GS E3Q0K1_HBV/1-352      AC E3Q0K1.1
#=GS Q70B61_HBV/1-109      AC Q70B61.1
#=GS I7LSS8_HBV/1-354      AC I7LSS8.1
#=GS M1G275_9HEPA/71-358   AC M1G275.1
#=GS I0DDI1_HBV/1-317      AC I0DDI1.1
#=GS B5M5H4_HBV/1-352      AC B5M5H4.1
#=GS G0YVN9_HBV/1-341      AC G0YVN9.1
#=GS L0HBY4_HBV/1-342      AC L0HBY4.1
#=GS R9Q841_HBV/1-114      AC R9Q841.1
#=GS F5C113_HBV/1-284      AC F5C113.1
#=GS DPOL_HBVA7/1-354      AC O91533.1
#=GS L0BC81_HBV/1-210      AC L0BC81.1
#=GS S5ZDU8_HBV/1-340      AC S5ZDU8.1
#=GS F5C0J7_HBV/1-354      AC F5C0J7.1
#=GS H2ERG2_HBV/1-275      AC H2ERG2.1
#=GS S5ZEH5_HBV/1-326      AC S5ZEH5.1
#=GS Q2L4N8_HBV/1-341      AC Q2L4N8.1
#=GS C1K1D1_HBV/1-179      AC C1K1D1.1
#=GS A0A023NLN4_HBV/1-341  AC A0A023NLN4.1
#=GS R9Q7W9_HBV/1-114      AC R9Q7W9.1
#=GS R9Q8P1_HBV/1-98       AC R9Q8P1.1
#=GS A7L374_HBV/1-30       AC A7L374.1
#=GS A8J4E6_HBV/1-352      AC A8J4E6.1
#=GS S5ZKS7_HBV/1-341      AC S5ZKS7.1
#=GS A8IEU6_HBV/1-52       AC A8IEU6.1
#=GS H6UNE0_HBV/1-338      AC H6UNE0.1
#=GS Q8B4C2_HBV/228-322    AC Q8B4C2.1
#=GS F5C108_HBV/1-354      AC F5C108.1
#=GS Q004A1_HBV/1-352      AC Q004A1.1
#=GS U3RJW8_HBV/1-218      AC U3RJW8.1
#=GS Q20BY9_HBV/1-57       AC Q20BY9.1
#=GS G9HNQ9_HBV/1-159      AC G9HNQ9.1
#=GS H9XR66_HBV/1-91       AC H9XR66.1
#=GS H2ERC4_HBV/1-352      AC H2ERC4.1
#=GS A9CM82_HBV/1-352      AC A9CM82.1
#=GS Q9YPV5_HBV/1-341      AC Q9YPV5.1
#=GS Q67882_HBV/1-341      AC Q67882.1
#=GS I0C9H3_HBV/1-352      AC I0C9H3.1
#=GS B1ABL8_HBV/1-238      AC B1ABL8.1
#=GS D0UE44_HBV/1-352      AC D0UE44.1
#=GS F5C0W9_HBV/1-354      AC F5C0W9.1
#=GS Q20C24_HBV/1-50       AC Q20C24.1
#=GS L0H7S8_HBV/1-352      AC L0H7S8.1
#=GS C6F4G2_HBV/1-354      AC C6F4G2.1
#=GS E5RPL1_HBV/1-352      AC E5RPL1.1
#=GS Q8V1H9_HBV/1-350      AC Q8V1H9.1
#=GS D0UEA7_HBV/1-347      AC D0UEA7.1
#=GS D0E5J7_HBV/1-352      AC D0E5J7.1
#=GS G1E877_HBV/1-341      AC G1E877.1
#=GS B1ABM6_HBV/1-352      AC B1ABM6.1
#=GS G1E7R5_HBV/1-341      AC G1E7R5.1
#=GS I0C9F6_HBV/1-338      AC I0C9F6.1
#=GS Q20C12_HBV/1-56       AC Q20C12.1
#=GS G9G9E6_HBV/1-341      AC G9G9E6.1
#=GS B2LW98_HBV/194-286    AC B2LW98.1
#=GS B5M5S6_HBV/1-352      AC B5M5S6.1
#=GS B5TF45_HBV/1-112      AC B5TF45.1
#=GS M4Q7W4_HBV/1-171      AC M4Q7W4.1
#=GS N0DKS0_HBV/1-352      AC N0DKS0.1
#=GS I0C8D6_HBV/1-354      AC I0C8D6.1
#=GS X2GCT1_HBV/1-351      AC X2GCT1.1
#=GS I0DDA5_HBV/1-328      AC I0DDA5.1
#=GS S6A0D1_HBV/1-336      AC S6A0D1.1
#=GS B3VLM8_HBV/1-176      AC B3VLM8.1
#=GS C7DQS2_HBV/1-352      AC C7DQS2.1
#=GS I0C8J3_HBV/1-350      AC I0C8J3.1
#=GS G4XI67_HBV/1-160      AC G4XI67.1
#=GS Q99HS9_HBV/1-352      AC Q99HS9.1
#=GS B7TUA9_HBV/1-352      AC B7TUA9.1
#=GS I0C8A8_HBV/1-354      AC I0C8A8.1
#=GS Q0PVA6_HBV/1-352      AC Q0PVA6.1
#=GS G3XLE4_HBV/1-352      AC G3XLE4.1
#=GS F5C158_HBV/1-354      AC F5C158.1
#=GS S5ZJW2_HBV/1-337      AC S5ZJW2.1
#=GS K9MC22_HBV/1-24       AC K9MC22.1
#=GS B9W3Y5_HBV/1-354      AC B9W3Y5.1
#=GS F5C0W5_HBV/1-354      AC F5C0W5.1
#=GS Q80GU0_HBV/2-353      AC Q80GU0.1
#=GS X4Y472_HBV/1-352      AC X4Y472.1
#=GS B4YLB7_HBV/1-341      AC B4YLB7.1
#=GS B7TUI9_HBV/1-352      AC B7TUI9.1
#=GS M9PMV1_HBV/1-253      AC M9PMV1.1
#=GS E5RPL9_HBV/1-352      AC E5RPL9.1
#=GS C6F528_HBV/1-354      AC C6F528.1
#=GS S5ZLM3_HBV/1-336      AC S5ZLM3.1
#=GS Q9WDD4_HBV/50-103     AC Q9WDD4.1
#=GS H6UGG1_HBV/1-341      AC H6UGG1.1
#=GS G1E7I5_HBV/269-317    AC G1E7I5.1
#=GS U5K5W2_HBV/108-171    AC U5K5W2.1
#=GS T2HR96_HBV/1-50       AC T2HR96.1
#=GS I0DCC9_HBV/1-317      AC I0DCC9.1
#=GS I0C900_HBV/1-354      AC I0C900.1
#=GS I0DCJ1_HBV/1-328      AC I0DCJ1.1
#=GS G1E889_HBV/1-341      AC G1E889.1
#=GS F5C103_HBV/1-354      AC F5C103.1
#=GS K7QH46_HBV/1-352      AC K7QH46.1
#=GS D3TIH5_HBV/1-342      AC D3TIH5.1
#=GS D5LF78_HBV/1-352      AC D5LF78.1
#=GS S5ZTN1_HBV/1-332      AC S5ZTN1.1
#=GS I0DD64_HBV/1-328      AC I0DD64.1
#=GS D5LD53_HBV/1-352      AC D5LD53.1
#=GS G9G9I0_HBV/1-341      AC G9G9I0.1
#=GS D7R7X4_9HEPA/59-223   AC D7R7X4.1
#=GS I0C871_HBV/1-354      AC I0C871.1
#=GS H6V5P4_HBV/1-341      AC H6V5P4.1
#=GS S6A6W4_HBV/1-341      AC S6A6W4.1
#=GS I0C863_HBV/1-354      AC I0C863.1
#=GS H9XRM4_HBV/1-91       AC H9XRM4.1
#=GS E0ZRD4_HBV/1-351      AC E0ZRD4.1
#=GS S5ZL73_HBV/1-336      AC S5ZL73.1
#=GS I0DGC8_HBV/1-352      AC I0DGC8.1
#=GS D0E5I0_HBV/1-352      AC D0E5I0.1
#=GS V5JEQ5_HBV/1-341      AC V5JEQ5.1
#=GS H9XR07_HBV/1-91       AC H9XR07.1
#=GS D3TKB6_HBV/1-352      AC D3TKB6.1
#=GS X4YJ88_HBV/1-341      AC X4YJ88.1
#=GS G9G943_HBV/254-304    AC G9G943.2
#=GS D0E6H6_HBV/1-352      AC D0E6H6.1
#=GS I0DGD6_HBV/1-352      AC I0DGD6.1
#=GS D0UE07_HBV/1-352      AC D0UE07.1
#=GS M4QAC6_HBV/1-171      AC M4QAC6.1
#=GS B9VKD3_HBV/1-291      AC B9VKD3.1
#=GS C7AY66_HBV/1-354      AC C7AY66.1
#=GS B0FD60_HBV/1-352      AC B0FD60.1
#=GS I0DCE0_HBV/240-285    AC I0DCE0.1
#=GS H9XRB8_HBV/1-91       AC H9XRB8.1
#=GS F5C0L1_HBV/1-354      AC F5C0L1.1
#=GS W6HVZ2_HBV/1-315      AC W6HVZ2.1
#=GS Q68RR7_HBV/1-352      AC Q68RR7.1
#=GS E5F0W1_HBV/1-49       AC E5F0W1.1
#=GS Q2EIE7_HBV/1-346      AC Q2EIE7.1
#=GS D5LEE7_HBV/1-352      AC D5LEE7.1
#=GS C7DMA6_HBV/1-351      AC C7DMA6.1
#=GS S5ZL40_HBV/1-341      AC S5ZL40.1
#=GS Q6XGR9_HBV/1-354      AC Q6XGR9.1
#=GS S5ZE68_HBV/1-335      AC S5ZE68.1
#=GS G4XIA8_HBV/1-130      AC G4XIA8.1
#=GS D0U3X8_HBV/1-354      AC D0U3X8.1
#=GS D2JMA1_HBV/1-352      AC D2JMA1.1
#=GS A9QQ05_HBV/1-351      AC A9QQ05.1
#=GS D5LCU3_HBV/1-352      AC D5LCU3.1
#=GS W8NZ80_HBV/1-352      AC W8NZ80.1
#=GS Q5EDR9_HBV/1-341      AC Q5EDR9.1
#=GS X4ZDS6_HBV/1-352      AC X4ZDS6.1
#=GS S6A6S9_HBV/1-337      AC S6A6S9.1
#=GS C9WDK8_HBV/1-341      AC C9WDK8.1
#=GS A5JI59_HBV/1-112      AC A5JI59.1
#=GS S6A083_HBV/1-336      AC S6A083.1
#=GS B9VKW8_HBV/1-352      AC B9VKW8.1
#=GS S5ZZQ0_HBV/1-329      AC S5ZZQ0.1
#=GS I0C997_HBV/1-341      AC I0C997.1
#=GS G1E7T9_HBV/1-341      AC G1E7T9.1
#=GS Q8B460_HBV/17-108     AC Q8B460.1
#=GS B9VKM8_HBV/1-352      AC B9VKM8.1
#=GS Q77BF5_HBV/1-167      AC Q77BF5.1
#=GS S6A6Z5_HBV/1-341      AC S6A6Z5.1
#=GS O91561_HBV/1-352      AC O91561.1
#=GS B0FCE6_HBV/1-352      AC B0FCE6.1
#=GS Q91C43_HBV/1-330      AC Q91C43.1
#=GS I0C892_HBV/1-354      AC I0C892.1
#=GS I0DGB5_HBV/1-352      AC I0DGB5.1
#=GS F5C0S1_HBV/1-333      AC F5C0S1.1
#=GS K9MC18_HBV/1-24       AC K9MC18.1
#=GS I0DG99_HBV/1-352      AC I0DG99.1
#=GS B0FCH3_HBV/1-352      AC B0FCH3.1
#=GS I0DCK7_HBV/1-328      AC I0DCK7.1
#=GS H9XQE6_HBV/1-91       AC H9XQE6.1
#=GS A0FDK9_HBV/1-100      AC A0FDK9.1
#=GS Q80SD0_HBV/1-341      AC Q80SD0.1
#=GS S6A6W7_HBV/1-314      AC S6A6W7.1
#=GS D3YFZ7_HBV/1-341      AC D3YFZ7.1
#=GS R9Q7U5_HBV/1-104      AC R9Q7U5.1
#=GS K4N095_HBV/1-352      AC K4N095.1
#=GS H9XQH0_HBV/1-91       AC H9XQH0.1
#=GS B5TFG1_HBV/1-112      AC B5TFG1.1
#=GS B5M5U8_HBV/1-352      AC B5M5U8.1
#=GS Q6X802_9HEPA/59-340   AC Q6X802.1
#=GS G1C952_HBV/1-341      AC G1C952.1
#=GS F5C132_HBV/1-354      AC F5C132.1
#=GS W8P7K5_HBV/1-352      AC W8P7K5.1
#=GS A6MG91_HBV/1-352      AC A6MG91.1
#=GS D9U5J3_HBV/1-183      AC D9U5J3.1
#=GS B5TFL3_HBV/1-112      AC B5TFL3.1
#=GS S5ZSH9_HBV/1-336      AC S5ZSH9.1
#=GS B5BPW2_HBV/1-334      AC B5BPW2.1
#=GS Q91IN8_HBV/202-320    AC Q91IN8.1
#=GS A5LG54_HBV/1-352      AC A5LG54.1
#=GS I6YZ02_HBV/1-352      AC I6YZ02.1
#=GS DPOL_HBVH3/1-352      AC Q8JMZ7.1
#=GS Q9E9A5_HBV/1-352      AC Q9E9A5.1
#=GS H2ER83_HBV/1-352      AC H2ER83.1
#=GS I4CJT9_HBV/1-30       AC I4CJT9.1
#=GS H6V5K4_HBV/1-352      AC H6V5K4.1
#=GS D5LCG6_HBV/1-352      AC D5LCG6.1
#=GS I3XMQ3_HBV/1-354      AC I3XMQ3.1
#=GS I0C8D0_HBV/1-354      AC I0C8D0.1
#=GS D0UDR9_HBV/1-352      AC D0UDR9.1
#=GS R9Q8J6_HBV/1-114      AC R9Q8J6.1
#=GS Q6XGM7_HBV/1-354      AC Q6XGM7.1
#=GS B9VKR5_HBV/1-352      AC B9VKR5.1
#=GS S5ZSG4_HBV/1-273      AC S5ZSG4.1
#=GS Q2ABY6_HBV/1-352      AC Q2ABY6.1
#=GS U3KUD3_HBV/1-171      AC U3KUD3.1
#=GS Q00K92_HBV/1-352      AC Q00K92.1
#=GS B4YLD1_HBV/1-341      AC B4YLD1.1
#=GS B4ZYX9_HBV/1-341      AC B4ZYX9.1
#=GS Q9IXC9_HBV/1-52       AC Q9IXC9.1
#=GS H6UN56_HBV/1-341      AC H6UN56.1
#=GS H6V5T8_HBV/1-352      AC H6V5T8.1
#=GS B7TV93_HBV/1-352      AC B7TV93.1
#=GS B9VKI0_HBV/1-352      AC B9VKI0.1
#=GS A7YEU1_HBV/1-352      AC A7YEU1.1
#=GS Q5R2M3_HBV/1-352      AC Q5R2M3.1
#=GS D6QW32_HBV/244-308    AC D6QW32.1
#=GS C8CK47_HBV/1-354      AC C8CK47.1
#=GS F5C129_HBV/1-354      AC F5C129.1
#=GS G9BMP5_HBV/1-338      AC G9BMP5.1
#=GS T2AZB0_HBV/1-352      AC T2AZB0.1
#=GS C6F534_HBV/1-354      AC C6F534.1
#=GS B7TUZ6_HBV/1-352      AC B7TUZ6.1
#=GS I0DDK5_HBV/1-328      AC I0DDK5.1
#=GS Q80MR1_HBV/1-352      AC Q80MR1.1
#=GS D3TK31_HBV/1-352      AC D3TK31.1
#=GS DPOL_HBVB1/1-352      AC P17394.1
#=GS Q404F0_HBV/1-341      AC Q404F0.1
#=GS D0EEB9_HBV/1-354      AC D0EEB9.1
#=GS X4ZFU6_HBV/1-352      AC X4ZFU6.1
#=GS B7TUY4_HBV/1-352      AC B7TUY4.1
#=GS D2U618_HBV/1-351      AC D2U618.1
#=GS G1C8A7_HBV/1-341      AC G1C8A7.1
#=GS A5LGB8_HBV/1-352      AC A5LGB8.1
#=GS H6V5K8_HBV/1-352      AC H6V5K8.1
#=GS G3XH12_HBV/1-332      AC G3XH12.1
#=GS I0DE04_HBV/1-328      AC I0DE04.1
#=GS I0C923_HBV/1-354      AC I0C923.1
#=GS D2U670_HBV/1-351      AC D2U670.1
#=GS S5ZS54_HBV/1-93       AC S5ZS54.1
#=GS D3YN74_HBV/1-352      AC D3YN74.1
#=GS C1K1G3_HBV/1-352      AC C1K1G3.1
#=GS D0E5K9_HBV/1-352      AC D0E5K9.1
#=GS X4YSN0_HBV/1-352      AC X4YSN0.1
#=GS M1G271_9HEPA/72-309   AC M1G271.1
#=GS I0DDX0_HBV/1-328      AC I0DDX0.1
#=GS G9G8P6_HBV/1-341      AC G9G8P6.1
#=GS B5B4I2_HBV/236-291    AC B5B4I2.1
#=GS L8EC25_HBV/1-334      AC L8EC25.1
#=GS G1C8A0_HBV/1-341      AC G1C8A0.1
#=GS F2WS76_HBV/1-352      AC F2WS76.1
#=GS T1YVL3_HBV/1-352      AC T1YVL3.1
#=GS A1BLQ9_HBV/1-52       AC A1BLQ9.1
#=GS E5F0X2_HBV/1-48       AC E5F0X2.1
#=GS G4XI55_HBV/1-119      AC G4XI55.1
#=GS V5NT00_HBV/1-351      AC V5NT00.1
#=GS X4Z0W1_HBV/1-352      AC X4Z0W1.1
#=GS A9CM62_HBV/1-352      AC A9CM62.1
#=GS B1B609_HBV/1-352      AC B1B609.1
#=GS I0DGC5_HBV/1-352      AC I0DGC5.1
#=GS Q19SV8_HBV/1-339      AC Q19SV8.1
#=GS F5C0Z5_HBV/1-354      AC F5C0Z5.1
#=GS S5ZZS6_HBV/1-334      AC S5ZZS6.1
#=GS G3XH08_HBV/1-343      AC G3XH08.1
#=GS D0E686_HBV/1-352      AC D0E686.1
#=GS S5ZKJ2_HBV/1-341      AC S5ZKJ2.1
#=GS I4CJU7_HBV/1-30       AC I4CJU7.1
#=GS I4CJV0_HBV/1-30       AC I4CJV0.1
#=GS H6UGG7_HBV/1-341      AC H6UGG7.1
#=GS Q4FDB9_HBV/1-352      AC Q4FDB9.1
#=GS K7QGA9_HBV/1-329      AC K7QGA9.1
#=GS I0DE88_HBV/1-317      AC I0DE88.1
#=GS F5C122_HBV/281-320    AC F5C122.1
#=GS B6CIY6_HBV/1-341      AC B6CIY6.1
#=GS S6A078_HBV/1-336      AC S6A078.1
#=GS B5M530_HBV/243-330    AC B5M530.1
#=GS Q7T7Y5_HBV/1-341      AC Q7T7Y5.1
#=GS S5ZT79_HBV/1-336      AC S5ZT79.1
#=GS G1C913_HBV/1-336      AC G1C913.1
#=GS I0DDA1_HBV/1-328      AC I0DDA1.1
#=GS I0C897_HBV/1-354      AC I0C897.1
#=GS I1UYT3_HBV/1-166      AC I1UYT3.1
#=GS Q5U7S7_HBV/1-341      AC Q5U7S7.1
#=GS H6UND6_HBV/1-343      AC H6UND6.1
#=GS Q8B6N0_HBV/1-352      AC Q8B6N0.1
#=GS C7DSQ3_HBV/1-341      AC C7DSQ3.1
#=GS M9WR70_HBV/236-295    AC M9WR70.1
#=GS B0YGH4_HBV/1-341      AC B0YGH4.1
#=GS K4N0Y5_HBV/1-352      AC K4N0Y5.1
#=GS Q81127_HBV/1-352      AC Q81127.1
#=GS Q5KR23_HBV/1-352      AC Q5KR23.1
#=GS D0E5J4_HBV/1-352      AC D0E5J4.1
#=GS H9XQK8_HBV/1-91       AC H9XQK8.1
#=GS I0DCK4_HBV/1-322      AC I0DCK4.1
#=GS S5ZE81_HBV/1-341      AC S5ZE81.1
#=GS K7QH42_HBV/219-302    AC K7QH42.1
#=GS E7CT95_HBV/1-352      AC E7CT95.1
#=GS S5ZL91_HBV/1-338      AC S5ZL91.1
#=GS B5ASX2_HBV/1-352      AC B5ASX2.1
#=GS X4ZET7_HBV/1-238      AC X4ZET7.1
#=GS H2ER44_HBV/1-352      AC H2ER44.1
#=GS U3RCF4_HBV/1-218      AC U3RCF4.1
#=GS X4Y1H5_HBV/1-352      AC X4Y1H5.1
#=GS X4ZDC4_HBV/1-352      AC X4ZDC4.1
#=GS T2HR01_HBV/1-50       AC T2HR01.1
#=GS I0C8W1_HBV/1-354      AC I0C8W1.1
#=GS Q20BN7_HBV/1-57       AC Q20BN7.1
#=GS C7DMG4_HBV/1-351      AC C7DMG4.1
#=GS A6MGA2_HBV/1-352      AC A6MGA2.1
#=GS S6A6W9_HBV/1-352      AC S6A6W9.1
#=GS G4XI90_HBV/1-54       AC G4XI90.1
#=GS S5ZJT8_HBV/1-341      AC S5ZJT8.1
#=GS B9VL72_HBV/1-218      AC B9VL72.1
#=GS T2AXG6_HBV/1-352      AC T2AXG6.1
#=GS Q81116_HBV/1-352      AC Q81116.1
#=GS B5AT80_HBV/1-352      AC B5AT80.1
#=GS I0DGC4_HBV/1-352      AC I0DGC4.1
#=GS B5B474_HBV/1-352      AC B5B474.1
#=GS Q8JXB1_HBV/1-352      AC Q8JXB1.1
#=GS U3KUE5_HBV/1-171      AC U3KUE5.1
#=GS S5MVM8_HBV/1-352      AC S5MVM8.1
#=GS I0C962_HBV/1-354      AC I0C962.1
#=GS W8NZQ1_HBV/1-352      AC W8NZQ1.1
#=GS C7DM85_HBV/1-351      AC C7DM85.1
#=GS C7DY88_HBV/1-347      AC C7DY88.1
#=GS C7DM24_HBV/1-351      AC C7DM24.1
#=GS H6UN68_HBV/1-341      AC H6UN68.1
#=GS B7TUZ0_HBV/1-352      AC B7TUZ0.1
#=GS G9HNR0_HBV/1-159      AC G9HNR0.1
#=GS A9CM66_HBV/1-185      AC A9CM66.1
#=GS B0FCG8_HBV/1-352      AC B0FCG8.1
#=GS C7AYR2_HBV/1-354      AC C7AYR2.2
#=GS S6A0D3_HBV/1-352      AC S6A0D3.1
#=GS C5WJV8_HBV/1-352      AC C5WJV8.1
#=GS Q4FDC3_HBV/1-352      AC Q4FDC3.1
#=GS Q404G2_HBV/1-341      AC Q404G2.1
#=GS M9PM96_HBV/1-31       AC M9PM96.1
#=GS B5AT13_HBV/1-352      AC B5AT13.1
#=GS C3W4H5_HBV/1-341      AC C3W4H5.1
#=GS G4XI51_HBV/1-160      AC G4XI51.1
#=GS S5ZZW4_HBV/1-309      AC S5ZZW4.1
#=GS Q5DW02_HBV/1-352      AC Q5DW02.1
#=GS R9Q8L2_HBV/1-114      AC R9Q8L2.1
#=GS S6A018_HBV/1-340      AC S6A018.1
#=GS Q0PML2_HBV/1-352      AC Q0PML2.1
#=GS I0C8Y4_HBV/1-354      AC I0C8Y4.1
#=GS F5C0M9_HBV/1-354      AC F5C0M9.1
#=GS X4YZ84_HBV/1-352      AC X4YZ84.1
#=GS Q2AC04_HBV/1-352      AC Q2AC04.1
#=GS D5LEA0_HBV/1-352      AC D5LEA0.1
#=GS S5ZTI2_HBV/1-342      AC S5ZTI2.1
#=GS S6A0E5_HBV/1-340      AC S6A0E5.1
#=GS Q4W6F2_HBV/1-351      AC Q4W6F2.1
#=GS S5MH63_HBV/1-352      AC S5MH63.1
#=GS R9Q8M3_HBV/1-114      AC R9Q8M3.1
#=GS X2G9P1_HBV/1-351      AC X2G9P1.1
#=GS S6A6Z0_HBV/1-352      AC S6A6Z0.1
#=GS I0C972_HBV/1-354      AC I0C972.1
#=GS I0C9F9_HBV/1-338      AC I0C9F9.1
#=GS S6A066_HBV/1-336      AC S6A066.1
#=GS B1ABL0_HBV/1-238      AC B1ABL0.1
#=GS E0ZRB3_HBV/1-351      AC E0ZRB3.1
#=GS G1C8Y5_HBV/1-341      AC G1C8Y5.1
#=GS M9PMV0_HBV/1-93       AC M9PMV0.1
#=GS A5JIL9_HBV/1-112      AC A5JIL9.1
#=GS D3TK44_HBV/1-352      AC D3TK44.1
#=GS L7X6M5_HBV/1-354      AC L7X6M5.1
#=GS H9XQP8_HBV/1-91       AC H9XQP8.1
#=GS Q764Q1_HBV/1-341      AC Q764Q1.1
#=GS Q2L4L9_HBV/1-341      AC Q2L4L9.1
#=GS B5M530_HBV/1-246      AC B5M530.1
#=GS X4Y449_HBV/1-341      AC X4Y449.1
#=GS D5LC14_HBV/1-352      AC D5LC14.1
#=GS Q4KR93_HBV/1-354      AC Q4KR93.1
#=GS I0C9A1_HBV/1-341      AC I0C9A1.1
#=GS Q20BW1_HBV/1-56       AC Q20BW1.1
#=GS O91563_HBV/1-352      AC O91563.1
#=GS D0E6F2_HBV/1-352      AC D0E6F2.1
#=GS E5RD33_HBV/1-352      AC E5RD33.1
#=GS H9XQW8_HBV/1-91       AC H9XQW8.1
#=GS Q91ID1_HBV/1-52       AC Q91ID1.1
#=GS I0DG88_HBV/1-352      AC I0DG88.1
#=GS C3W3X2_HBV/1-341      AC C3W3X2.1
#=GS E5CYX2_HBV/1-352      AC E5CYX2.1
#=GS C1K159_HBV/235-291    AC C1K159.1
#=GS B5TXN1_HBV/1-352      AC B5TXN1.1
#=GS S5ZJY5_HBV/1-313      AC S5ZJY5.1
#=GS X2G2V2_HBV/1-351      AC X2G2V2.1
#=GS H6UGT4_HBV/1-341      AC H6UGT4.1
#=GS S5ZFS8_HBV/1-336      AC S5ZFS8.1
#=GS Q58W09_HBV/1-352      AC Q58W09.1
#=GS A5JI40_HBV/1-112      AC A5JI40.1
#=GS I0C9G4_HBV/1-338      AC I0C9G4.1
#=GS D5LFJ0_HBV/1-352      AC D5LFJ0.1
#=GS S6A6V3_HBV/1-335      AC S6A6V3.1
#=GS B9VL56_HBV/1-352      AC B9VL56.1
#=GS T2HS41_HBV/1-50       AC T2HS41.1
#=GS H9XQR7_HBV/1-91       AC H9XQR7.1
#=GS I0DEA0_HBV/206-281    AC I0DEA0.1
#=GS X4YY07_HBV/1-352      AC X4YY07.1
#=GS D2U660_HBV/1-351      AC D2U660.1
#=GS Q5Q0T5_HBV/1-352      AC Q5Q0T5.1
#=GS I0DDJ7_HBV/1-317      AC I0DDJ7.1
#=GS I0C963_HBV/1-354      AC I0C963.1
#=GS X4ZFF0_HBV/1-352      AC X4ZFF0.1
#=GS B1A0B8_HBV/1-352      AC B1A0B8.1
#=GS G3GDQ8_HBV/1-352      AC G3GDQ8.1
#=GS R9Q8P9_HBV/1-114      AC R9Q8P9.1
#=GS R4P3C3_HBV/1-352      AC R4P3C3.1
#=GS D0E5Z4_HBV/1-352      AC D0E5Z4.1
#=GS C1K200_HBV/236-291    AC C1K200.1
#=GS C6F4Q3_HBV/1-354      AC C6F4Q3.1
#=GS L0H803_HBV/1-352      AC L0H803.1
#=GS S5ZSL3_HBV/1-337      AC S5ZSL3.1
#=GS I0C911_HBV/1-354      AC I0C911.1
#=GS B9VL41_HBV/241-290    AC B9VL41.1
#=GS G9G9S5_HBV/1-341      AC G9G9S5.1
#=GS Q77BG2_HBV/1-167      AC Q77BG2.1
#=GS M4QA92_HBV/1-171      AC M4QA92.1
#=GS W6HVX1_HBV/1-315      AC W6HVX1.1
#=GS H9XRT7_HBV/1-91       AC H9XRT7.1
#=GS D7NKX1_HBV/1-341      AC D7NKX1.1
#=GS I0C9E0_HBV/1-334      AC I0C9E0.1
#=GS Q2L4L0_HBV/1-341      AC Q2L4L0.1
#=GS Q2MLR6_HBV/1-341      AC Q2MLR6.1
#=GS L0HCL5_HBV/1-352      AC L0HCL5.1
#=GS B5TFE9_HBV/1-112      AC B5TFE9.1
#=GS B1A0A5_HBV/1-352      AC B1A0A5.1
#=GS H9XRW9_HBV/1-91       AC H9XRW9.1
#=GS F1AEZ3_HBV/1-354      AC F1AEZ3.1
#=GS Q2ABE2_HBV/1-352      AC Q2ABE2.1
#=GS E0ZRL9_HBV/1-351      AC E0ZRL9.1
#=GS I0DDR3_HBV/1-328      AC I0DDR3.1
#=GS D4P3S8_HBV/1-351      AC D4P3S8.1
#=GS D0EE29_HBV/1-354      AC D0EE29.1
#=GS F5C1C0_HBV/1-354      AC F5C1C0.1
#=GS E5RD89_HBV/1-352      AC E5RD89.1
#=GS B5B4A7_HBV/1-238      AC B5B4A7.1
#=GS K4Q398_HBV/1-145      AC K4Q398.1
#=GS I0C917_HBV/1-354      AC I0C917.1
#=GS I0C9H9_HBV/1-315      AC I0C9H9.1
#=GS B5B4C0_HBV/1-238      AC B5B4C0.1
#=GS B9VL29_HBV/1-352      AC B9VL29.1
#=GS H9XRP4_HBV/1-91       AC H9XRP4.1
#=GS D0EE15_HBV/1-354      AC D0EE15.1
#=GS D3TK24_HBV/1-352      AC D3TK24.1
#=GS D5LCV7_HBV/1-352      AC D5LCV7.1
#=GS G9G9N6_HBV/1-341      AC G9G9N6.1
#=GS B5ATC8_HBV/1-275      AC B5ATC8.1
#=GS M1G282_9HEPA/72-359   AC M1G282.1
#=GS C1K198_HBV/1-352      AC C1K198.1
#=GS S5ZEA5_HBV/1-340      AC S5ZEA5.1
#=GS I4CJR0_HBV/1-183      AC I4CJR0.1
#=GS F5C0H5_HBV/1-341      AC F5C0H5.1
#=GS L0HCD2_HBV/1-238      AC L0HCD2.1
#=GS S5ZSN6_HBV/1-341      AC S5ZSN6.1
#=GS I0DGC6_HBV/1-352      AC I0DGC6.1
#=GS I6UJH3_HBV/1-48       AC I6UJH3.1
#=GS S6A6X1_HBV/1-352      AC S6A6X1.1
#=GS G0VSF6_HBV/1-354      AC G0VSF6.1
#=GS A5GZG8_HBV/1-352      AC A5GZG8.1
#=GS S6A0D6_HBV/1-341      AC S6A0D6.1
#=GS D0EEE6_HBV/1-354      AC D0EEE6.1
#=GS C6F4B3_HBV/1-354      AC C6F4B3.1
#=GS K7QGC3_HBV/1-352      AC K7QGC3.1
#=GS I0C8Q0_HBV/1-227      AC I0C8Q0.1
#=GS Q9YKJ3_HBV/1-352      AC Q9YKJ3.1
#=GS C9WDU4_HBV/1-352      AC C9WDU4.1
#=GS M9PNG8_HBV/1-21       AC M9PNG8.1
#=GS I0C864_HBV/1-354      AC I0C864.1
#=GS E9L5I4_HBV/1-352      AC E9L5I4.1
#=GS A5JJ30_HBV/1-54       AC A5JJ30.1
#=GS Q03765_9HEPA/59-339   AC Q03765.1
#=GS B0YGJ0_HBV/1-341      AC B0YGJ0.1
#=GS B0FCL2_HBV/1-352      AC B0FCL2.1
#=GS Q9WFA2_9HEPA/62-343   AC Q9WFA2.1
#=GS S5ZK44_HBV/1-335      AC S5ZK44.1
#=GS B5M5I1_HBV/1-224      AC B5M5I1.1
#=GS A8J4G9_HBV/1-344      AC A8J4G9.1
#=GS Q2L4K5_HBV/1-352      AC Q2L4K5.1
#=GS Q5U7R0_HBV/1-341      AC Q5U7R0.1
#=GS Q4KRD5_HBV/1-354      AC Q4KRD5.1
#=GS R4NVB7_HBV/1-352      AC R4NVB7.1
#=GS D0EEP5_HBV/1-354      AC D0EEP5.1
#=GS D0EE08_HBV/1-354      AC D0EE08.1
#=GS A0FDM5_HBV/1-341      AC A0FDM5.1
#=GS T1YSZ6_HBV/1-352      AC T1YSZ6.1
#=GS D3YGD7_HBV/1-336      AC D3YGD7.1
#=GS B5TFH7_HBV/1-112      AC B5TFH7.1
#=GS D5LCK7_HBV/1-352      AC D5LCK7.1
#=GS B5U729_HBV/1-341      AC B5U729.1
#=GS B4YLD8_HBV/1-341      AC B4YLD8.1
#=GS M4QA74_HBV/1-171      AC M4QA74.1
#=GS D2JMG0_HBV/1-352      AC D2JMG0.1
#=GS X4ZDJ3_HBV/1-352      AC X4ZDJ3.1
#=GS S6A6V5_HBV/1-352      AC S6A6V5.1
#=GS Q5SDK5_HBV/1-352      AC Q5SDK5.1
#=GS C7AY90_HBV/1-354      AC C7AY90.1
#=GS B5TF18_HBV/1-112      AC B5TF18.1
#=GS F5C179_HBV/1-354      AC F5C179.1
#=GS Q2PWX3_HBV/1-354      AC Q2PWX3.1
#=GS I0C866_HBV/1-354      AC I0C866.1
#=GS B5LXY6_HBV/1-341      AC B5LXY6.1
#=GS A9CM25_HBV/1-352      AC A9CM25.1
#=GS A5JIR6_HBV/1-112      AC A5JIR6.1
#=GS S5ZLX9_HBV/1-318      AC S5ZLX9.1
#=GS C7AYY1_HBV/1-354      AC C7AYY1.1
#=GS G3XH30_HBV/223-309    AC G3XH30.1
#=GS Q8B5Q1_HBV/1-200      AC Q8B5Q1.1
#=GS D5LB89_HBV/1-352      AC D5LB89.1
#=GS G3XH24_HBV/1-332      AC G3XH24.1
#=GS H9XRE2_HBV/1-91       AC H9XRE2.1
#=GS O91559_HBV/1-352      AC O91559.1
#=GS D0E5P9_HBV/1-352      AC D0E5P9.1
#=GS A5JIB5_HBV/1-112      AC A5JIB5.1
#=GS D0E672_HBV/1-352      AC D0E672.1
#=GS G3E538_HBV/1-342      AC G3E538.1
#=GS B3VLL4_HBV/1-176      AC B3VLL4.1
#=GS D6QVV6_HBV/1-352      AC D6QVV6.1
#=GS L0BE79_HBV/1-210      AC L0BE79.1
#=GS I0C8P7_HBV/1-341      AC I0C8P7.1
#=GS H2ERE5_HBV/1-352      AC H2ERE5.1
#=GS D3YG51_HBV/1-341      AC D3YG51.1
#=GS I0DG98_HBV/1-352      AC I0DG98.1
#=GS Q9E934_HBV/1-352      AC Q9E934.1
#=GS F5C0R0_HBV/1-351      AC F5C0R0.1
#=GS G3E566_HBV/1-341      AC G3E566.1
#=GS Q91HP6_9HEPA/61-348   AC Q91HP6.1
#=GS H2ERG2_HBV/265-313    AC H2ERG2.1
#=GS U5QB39_HBV/1-352      AC U5QB39.1
#=GS M4QJ99_HBV/1-171      AC M4QJ99.1
#=GS I0DGD9_HBV/1-352      AC I0DGD9.1
#=GS S6A0A1_HBV/1-340      AC S6A0A1.1
#=GS H9XQP4_HBV/1-91       AC H9XQP4.1
#=GS Q0KG44_HBV/1-354      AC Q0KG44.1
#=GS C7DM72_HBV/1-351      AC C7DM72.1
#=GS H9XR54_HBV/1-91       AC H9XR54.1
#=GS Q6XGV4_HBV/1-354      AC Q6XGV4.1
#=GS Q2F501_HBV/1-276      AC Q2F501.1
#=GS S5ZT01_HBV/1-340      AC S5ZT01.1
#=GS D0E6H2_HBV/1-352      AC D0E6H2.1
#=GS E9L2J8_HBV/1-171      AC E9L2J8.1
#=GS D3XGH2_HBV/1-352      AC D3XGH2.1
#=GS I0C9H5_HBV/1-352      AC I0C9H5.1
#=GS S5ZFI6_HBV/1-342      AC S5ZFI6.1
#=GS C9WDB4_HBV/1-329      AC C9WDB4.1
#=GS F5C0Q1_HBV/1-354      AC F5C0Q1.1
#=GS B5ASR8_HBV/1-352      AC B5ASR8.1
#=GS O91556_HBV/1-352      AC O91556.1
#=GS L7R7X6_HBV/1-341      AC L7R7X6.1
#=GS W6HYA9_HBV/1-315      AC W6HYA9.1
#=GS D6QVF5_HBV/1-352      AC D6QVF5.1
#=GS I0C9C5_HBV/1-334      AC I0C9C5.1
#=GS A5JIP2_HBV/1-112      AC A5JIP2.1
#=GS C1K1U3_HBV/1-350      AC C1K1U3.1
#=GS R9Q8L7_HBV/1-114      AC R9Q8L7.1
#=GS F5C1S8_HBV/1-348      AC F5C1S8.1
#=GS I0C8F1_HBV/1-354      AC I0C8F1.1
#=GS H2ERI7_HBV/1-273      AC H2ERI7.1
#=GS G9G8V6_HBV/1-341      AC G9G8V6.1
#=GS Q58W05_HBV/1-352      AC Q58W05.1
#=GS H6WFB8_HBV/1-112      AC H6WFB8.1
#=GS S5ZT72_HBV/1-339      AC S5ZT72.1
#=GS S5ZF39_HBV/1-337      AC S5ZF39.1
#=GS Q5R2M7_HBV/1-340      AC Q5R2M7.1
#=GS G4XMN1_HBV/1-352      AC G4XMN1.1
#=GS H9XR70_HBV/1-91       AC H9XR70.1
#=GS Q9QN49_HBV/1-352      AC Q9QN49.1
#=GS W0SLM7_HBV/1-352      AC W0SLM7.1
#=GS A5JI25_HBV/1-112      AC A5JI25.1
#=GS L0HC78_HBV/247-323    AC L0HC78.1
#=GS B7TTC4_HBV/1-352      AC B7TTC4.1
#=GS D0EDZ4_HBV/1-354      AC D0EDZ4.1
#=GS S5ZZS3_HBV/1-341      AC S5ZZS3.1
#=GS C3W4A0_HBV/1-336      AC C3W4A0.1
#=GS S6A069_HBV/1-341      AC S6A069.1
#=GS Q1PD00_HBV/1-352      AC Q1PD00.1
#=GS H6UGL5_HBV/1-341      AC H6UGL5.1
#=GS B7TTZ9_HBV/1-352      AC B7TTZ9.1
#=GS W8PAQ6_HBV/1-352      AC W8PAQ6.1
#=GS Q8B4D5_HBV/1-341      AC Q8B4D5.1
#=GS O91522_HBV/183-315    AC O91522.1
#=GS Q81141_HBV/1-352      AC Q81141.1
#=GS B5M4Z5_HBV/1-352      AC B5M4Z5.1
#=GS I0DGA9_HBV/1-352      AC I0DGA9.1
#=GS C9WDL5_HBV/1-341      AC C9WDL5.1
#=GS B9VL21_HBV/1-341      AC B9VL21.1
#=GS Q50JU2_HBV/1-346      AC Q50JU2.1
#=GS A0A023NKB9_HBV/1-341  AC A0A023NKB9.1
#=GS F5C116_HBV/1-284      AC F5C116.1
#=GS H6WF94_HBV/1-112      AC H6WF94.1
#=GS V5JE43_HBV/1-342      AC V5JE43.1
#=GS B9VK35_HBV/1-352      AC B9VK35.1
#=GS E5CZ41_HBV/1-352      AC E5CZ41.1
#=GS Q9E6T9_HBV/1-352      AC Q9E6T9.1
#=GS D3YGB9_HBV/1-341      AC D3YGB9.1
#=GS I0C883_HBV/1-354      AC I0C883.1
#=GS D0E5S1_HBV/1-352      AC D0E5S1.1
#=GS B5M5D3_HBV/1-352      AC B5M5D3.1
#=GS B0FC52_HBV/1-352      AC B0FC52.1
#=GS V9TI13_HBV/1-341      AC V9TI13.1
#=GS S6A6T2_HBV/1-318      AC S6A6T2.1
#=GS C1K1U7_HBV/1-352      AC C1K1U7.1
#=GS B9VKI8_HBV/1-352      AC B9VKI8.1
#=GS I0C890_HBV/1-354      AC I0C890.1
#=GS H9XQC2_HBV/1-91       AC H9XQC2.1
#=GS I0DDC1_HBV/1-328      AC I0DDC1.1
#=GS L0BCD9_HBV/1-210      AC L0BCD9.1
#=GS Q2EIF1_HBV/1-346      AC Q2EIF1.1
#=GS X2G834_HBV/1-351      AC X2G834.1
#=GS D0E5R4_HBV/1-352      AC D0E5R4.1
#=GS S5ZZN7_HBV/1-336      AC S5ZZN7.1
#=GS C5WJX4_HBV/1-352      AC C5WJX4.1
#=GS R9Q895_HBV/1-114      AC R9Q895.1
#=GS A6MG45_HBV/1-352      AC A6MG45.1
#=GS B5TFM1_HBV/1-112      AC B5TFM1.1
#=GS E5RPV9_HBV/1-343      AC E5RPV9.1
#=GS R9Q8V8_HBV/1-114      AC R9Q8V8.1
#=GS L8B230_HBV/1-341      AC L8B230.1
#=GS C3W403_HBV/1-341      AC C3W403.1
#=GS Q9QMP1_HBV/1-352      AC Q9QMP1.1
#=GS M1G257_9HEPA/65-219   AC M1G257.1
#=GS D6QW05_HBV/1-352      AC D6QW05.1
#=GS S5ZDQ8_HBV/1-334      AC S5ZDQ8.1
#=GS D3YG21_HBV/1-341      AC D3YG21.1
#=GS S6A6S5_HBV/1-313      AC S6A6S5.1
#=GS A4UBL7_HBV/1-341      AC A4UBL7.2
#=GS B1NYB6_HBV/1-341      AC B1NYB6.1
#=GS Q68RQ6_HBV/1-352      AC Q68RQ6.1
#=GS Q3ZKN7_HBV/1-351      AC Q3ZKN7.1
#=GS S6A728_HBV/1-337      AC S6A728.1
#=GS S5ZL29_HBV/1-330      AC S5ZL29.1
#=GS H6UN96_HBV/1-341      AC H6UN96.1
#=GS Q9DTC9_HBV/1-352      AC Q9DTC9.1
#=GS M4QIW0_HBV/1-171      AC M4QIW0.1
#=GS S6A072_HBV/1-335      AC S6A072.1
#=GS E0ZRA0_HBV/1-351      AC E0ZRA0.1
#=GS I0DDZ4_HBV/236-281    AC I0DDZ4.1
#=GS S5ZL12_HBV/1-340      AC S5ZL12.1
#=GS S5ZFL4_HBV/1-352      AC S5ZFL4.1
#=GS C0IR93_HBV/1-352      AC C0IR93.1
#=GS Q5UFT9_HBV/1-341      AC Q5UFT9.1
#=GS Q80J78_HBV/1-352      AC Q80J78.1
#=GS I0C9G0_HBV/1-338      AC I0C9G0.1
#=GS D0UDY2_HBV/1-336      AC D0UDY2.1
#=GS A5JHS8_HBV/1-112      AC A5JHS8.1
#=GS X4Z180_HBV/1-352      AC X4Z180.1
#=GS Q20BV5_HBV/1-57       AC Q20BV5.1
#=GS H1ACY4_HBV/1-352      AC H1ACY4.1
#=GS Q67937_HBV/1-352      AC Q67937.1
#=GS F5C0X5_HBV/1-354      AC F5C0X5.1
#=GS E0ZRU1_HBV/1-351      AC E0ZRU1.1
#=GS D5LD72_HBV/1-352      AC D5LD72.1
#=GS S5ZE08_HBV/1-336      AC S5ZE08.1
#=GS B7TUC4_HBV/1-352      AC B7TUC4.1
#=GS Q20BT1_HBV/1-57       AC Q20BT1.1
#=GS F1KLU1_HBV/1-352      AC F1KLU1.1
#=GS Q9E9A0_HBV/1-352      AC Q9E9A0.1
#=GS B5BPR5_HBV/1-352      AC B5BPR5.1
#=GS DPOL_WHV6/20-65       AC P11292.1
#=GS K4N360_HBV/1-352      AC K4N360.1
#=GS K7QGH4_HBV/1-352      AC K7QGH4.1
#=GS D0E6A2_HBV/1-352      AC D0E6A2.1
#=GS L0H9H2_HBV/1-352      AC L0H9H2.1
#=GS S5ZZN4_HBV/1-273      AC S5ZZN4.1
#=GS A5GZK2_HBV/1-352      AC A5GZK2.1
#=GS B0YGL6_HBV/1-341      AC B0YGL6.1
#=GS C1K1Q1_HBV/1-352      AC C1K1Q1.1
#=GS V9TI29_HBV/1-341      AC V9TI29.1
#=GS M9PN17_HBV/1-240      AC M9PN17.1
#=GS Q769J1_HBV/1-349      AC Q769J1.1
#=GS G4XMD5_HBV/1-341      AC G4XMD5.1
#=GS Q6XGR2_HBV/1-354      AC Q6XGR2.1
#=GS B0FCC4_HBV/1-352      AC B0FCC4.1
#=GS I4CJT3_HBV/1-30       AC I4CJT3.1
#=GS X4YSF5_HBV/1-346      AC X4YSF5.1
#=GS C1K1D9_HBV/1-352      AC C1K1D9.1
#=GS G3XH04_HBV/1-343      AC G3XH04.1
#=GS I0DGI4_HBV/1-172      AC I0DGI4.1
#=GS Q1HH99_HBV/1-341      AC Q1HH99.1
#=GS F5C0Q6_HBV/1-351      AC F5C0Q6.1
#=GS J7IKM8_HBV/1-341      AC J7IKM8.1
#=GS I1UYV4_HBV/1-166      AC I1UYV4.1
#=GS S6A713_HBV/1-337      AC S6A713.1
#=GS C7AYX6_HBV/1-354      AC C7AYX6.1
#=GS S5ZZT8_HBV/1-338      AC S5ZZT8.1
#=GS Q9E8L0_HBV/1-352      AC Q9E8L0.1
#=GS A5LG18_HBV/1-352      AC A5LG18.1
#=GS H9XQV6_HBV/1-91       AC H9XQV6.1
#=GS F5C0U7_HBV/1-354      AC F5C0U7.1
#=GS I0C8J2_HBV/1-350      AC I0C8J2.1
#=GS F5C0I7_HBV/1-341      AC F5C0I7.1
#=GS A5JIA7_HBV/1-112      AC A5JIA7.1
#=GS Q67832_HBV/1-83       AC Q67832.1
#=GS D5LF39_HBV/1-352      AC D5LF39.1
#=GS Q20BT3_HBV/1-52       AC Q20BT3.1
#=GS Q8B5Q4_HBV/1-190      AC Q8B5Q4.1
#=GS I0C888_HBV/1-354      AC I0C888.1
#=GS G3E5A8_HBV/1-341      AC G3E5A8.1
#=GS I0C8A4_HBV/1-354      AC I0C8A4.1
#=GS G4XI59_HBV/1-160      AC G4XI59.1
#=GS D0QP51_HBV/1-352      AC D0QP51.2
#=GS B5M644_HBV/1-352      AC B5M644.1
#=GS I0DE84_HBV/1-317      AC I0DE84.1
#=GS D5LC55_HBV/1-352      AC D5LC55.1
#=GS B2Y6Y8_HBV/1-341      AC B2Y6Y8.1
#=GS G1E7C3_HBV/1-341      AC G1E7C3.1
#=GS C9WDB9_HBV/1-341      AC C9WDB9.1
#=GS S5ZTR3_HBV/1-337      AC S5ZTR3.1
#=GS C7AYE9_HBV/1-354      AC C7AYE9.1
#=GS G4XMN5_HBV/1-352      AC G4XMN5.1
#=GS A5GZL4_HBV/1-352      AC A5GZL4.1
#=GS E5RPS1_HBV/1-332      AC E5RPS1.1
#=GS Q8V1I6_HBV/1-352      AC Q8V1I6.1
#=GS C3W470_HBV/1-341      AC C3W470.1
#=GS B4YLI1_HBV/1-341      AC B4YLI1.1
#=GS F4ZCA1_HBV/1-49       AC F4ZCA1.1
#=GS L7R8S5_HBV/1-341      AC L7R8S5.1
#=GS M4Q8A8_HBV/1-171      AC M4Q8A8.1
#=GS F5C0Z6_HBV/1-354      AC F5C0Z6.1
#=GS Q05HA7_HBV/1-340      AC Q05HA7.1
#=GS D5LE61_HBV/1-352      AC D5LE61.1
#=GS L8B1X6_HBV/223-280    AC L8B1X6.1
#=GS F5C0U8_HBV/1-354      AC F5C0U8.1
#=GS B4YL73_HBV/1-341      AC B4YL73.1
#=GS C5WJV0_HBV/1-352      AC C5WJV0.1
#=GS S5ZKQ7_HBV/1-340      AC S5ZKQ7.1
#=GS I0C896_HBV/1-354      AC I0C896.1
#=GS F1AEX3_HBV/1-351      AC F1AEX3.1
#=GS S5ZKG4_HBV/1-352      AC S5ZKG4.1
#=GS X4ZEN7_HBV/1-352      AC X4ZEN7.1
#=GS S5ZFK8_HBV/1-332      AC S5ZFK8.1
#=GS I0DGD7_HBV/1-352      AC I0DGD7.1
#=GS B5TF53_HBV/1-112      AC B5TF53.1
#=GS L0BDE6_HBV/1-210      AC L0BDE6.1
#=GS E5F0V8_HBV/1-34       AC E5F0V8.1
#=GS H9XR34_HBV/1-91       AC H9XR34.1
#=GS Q76B13_HBV/1-352      AC Q76B13.1
#=GS D3TKC3_HBV/1-352      AC D3TKC3.1
#=GS C6F5E6_HBV/1-354      AC C6F5E6.1
#=GS F5C172_HBV/1-176      AC F5C172.1
#=GS Q8QMM2_HBV/1-341      AC Q8QMM2.1
#=GS D0E5M4_HBV/1-352      AC D0E5M4.1
#=GS B5TZH4_HBV/1-59       AC B5TZH4.1
#=GS DPOL_DHBVQ/59-342     AC Q66403.1
#=GS I0DGB9_HBV/1-352      AC I0DGB9.1
#=GS H6WFE6_HBV/1-112      AC H6WFE6.1
#=GS E0ZR74_HBV/1-351      AC E0ZR74.1
#=GS B7TUB3_HBV/1-352      AC B7TUB3.1
#=GS E3Q0G2_HBV/1-352      AC E3Q0G2.1
#=GS K4PXJ5_HBV/1-352      AC K4PXJ5.1
#=GS O91545_HBV/1-337      AC O91545.1
#=GS B5M650_HBV/1-352      AC B5M650.1
#=GS B4ZYZ3_HBV/1-341      AC B4ZYZ3.1
#=GS Q9QMJ7_HBV/1-352      AC Q9QMJ7.1
#=GS I0C994_HBV/1-341      AC I0C994.1
#=GS Q5SDL2_HBV/1-352      AC Q5SDL2.1
#=GS B5TF30_HBV/1-112      AC B5TF30.1
#=GS C6F4C7_HBV/1-354      AC C6F4C7.1
#=GS Q5Q0Y1_HBV/1-341      AC Q5Q0Y1.1
#=GS B9VK01_HBV/1-352      AC B9VK01.1
#=GS I0DCL9_HBV/1-328      AC I0DCL9.1
#=GS B3VLL1_HBV/1-175      AC B3VLL1.1
#=GS I0DCS8_HBV/1-328      AC I0DCS8.1
#=GS E5RPY9_HBV/1-325      AC E5RPY9.1
#=GS I0DEA9_HBV/1-328      AC I0DEA9.1
#=GS B4YKM3_HBV/1-354      AC B4YKM3.1
#=GS Q20BW5_HBV/1-56       AC Q20BW5.1
#=GS D0EEQ2_HBV/1-354      AC D0EEQ2.1
#=GS Q2PWW9_HBV/1-354      AC Q2PWW9.1
#=GS Q8AZ40_HBV/1-352      AC Q8AZ40.1
#=GS F1AET2_HBV/1-354      AC F1AET2.1
#=GS Q9WP64_HBV/1-264      AC Q9WP64.1
#=GS R4NTL0_HBV/1-352      AC R4NTL0.1
#=GS I0C914_HBV/1-354      AC I0C914.1
#=GS L8AYK5_HBV/1-233      AC L8AYK5.1
#=GS G1E7L6_HBV/1-341      AC G1E7L6.1
#=GS K4PX17_HBV/1-84       AC K4PX17.1
#=GS W6IBH8_HBV/1-315      AC W6IBH8.1
#=GS I0C8A1_HBV/1-354      AC I0C8A1.1
#=GS L0HCN3_HBV/1-352      AC L0HCN3.1
#=GS S5ZEG0_HBV/1-340      AC S5ZEG0.1
#=GS Q68RQ2_HBV/1-352      AC Q68RQ2.1
#=GS B1ABK3_HBV/188-516    AC B1ABK3.1
#=GS DPOL_HBVG2/1-351      AC Q8QZQ2.1
#=GS F5C183_HBV/1-354      AC F5C183.1
#=GS Q8QTL9_HBV/1-351      AC Q8QTL9.1
#=GS S5ZEC2_HBV/1-352      AC S5ZEC2.1
#=GS Q1XHG5_HBV/1-354      AC Q1XHG5.1
#=GS E5RPS9_HBV/1-343      AC E5RPS9.1
#=GS B4YL37_HBV/1-341      AC B4YL37.1
#=GS Q99HV0_HBV/1-352      AC Q99HV0.1
#=GS I0DDP8_HBV/1-317      AC I0DDP8.1
#=GS C6F4V2_HBV/1-354      AC C6F4V2.1
#=GS B2CZV6_HBV/1-352      AC B2CZV6.1
#=GS B2LW98_HBV/1-196      AC B2LW98.1
#=GS G3XGZ0_HBV/1-327      AC G3XGZ0.1
#=GS E5F0V3_HBV/1-49       AC E5F0V3.1
#=GS E3Q0P1_HBV/1-352      AC E3Q0P1.1
#=GS B5M513_HBV/1-352      AC B5M513.1
#=GS I0DD13_HBV/1-328      AC I0DD13.1
#=GS A9CM86_HBV/1-352      AC A9CM86.1
#=GS B5TFF7_HBV/1-112      AC B5TFF7.1
#=GS DPOL_WHV2/3-392       AC P06275.1
#=GS K9MCC3_HBV/1-351      AC K9MCC3.1
#=GS W6HVX7_HBV/1-315      AC W6HVX7.1
#=GS D0EYY4_HBV/1-341      AC D0EYY4.1
#=GS A8J4B7_HBV/1-354      AC A8J4B7.1
#=GS E5RPT7_HBV/1-343      AC E5RPT7.1
#=GS C1K217_HBV/1-335      AC C1K217.1
#=GS L7R846_HBV/1-341      AC L7R846.1
#=GS A8J4F6_HBV/301-333    AC A8J4F6.1
#=GS S5ZK39_HBV/1-318      AC S5ZK39.1
#=GS B5TXQ6_HBV/1-352      AC B5TXQ6.1
#=GS Q8JXH1_HBV/1-351      AC Q8JXH1.1
#=GS Q9QAE0_HBV/1-352      AC Q9QAE0.1
#=GS Q8JNW7_HBV/1-354      AC Q8JNW7.1
#=GS M4Q843_HBV/1-171      AC M4Q843.1
#=GS C9WD82_HBV/1-341      AC C9WD82.1
#=GS G9HVE0_HBV/1-352      AC G9HVE0.1
#=GS L7R7C4_HBV/1-341      AC L7R7C4.1
#=GS B0FC66_HBV/1-352      AC B0FC66.1
#=GS J7IRX3_HBV/1-352      AC J7IRX3.1
#=GS Q5UFT5_HBV/1-341      AC Q5UFT5.1
#=GS S6A075_HBV/1-341      AC S6A075.1
#=GS B7TTF4_HBV/1-352      AC B7TTF4.1
#=GS I0C8Z7_HBV/1-354      AC I0C8Z7.1
#=GS B5A2H8_HBV/1-352      AC B5A2H8.1
#=GS S6A714_HBV/1-336      AC S6A714.1
#=GS G4XI45_HBV/1-160      AC G4XI45.1
#=GS G9G9S0_HBV/1-326      AC G9G9S0.1
#=GS A6MG51_HBV/1-352      AC A6MG51.1
#=GS L0BC44_HBV/1-210      AC L0BC44.1
#=GS E0ZRR7_HBV/1-351      AC E0ZRR7.1
#=GS G4XI19_HBV/1-160      AC G4XI19.1
#=GS S5ZZX6_HBV/1-332      AC S5ZZX6.1
#=GS B2NI16_HBV/1-352      AC B2NI16.1
#=GS I0DCY2_HBV/1-319      AC I0DCY2.1
#=GS Q8B5Q8_HBV/1-190      AC Q8B5Q8.1
#=GS Q8B4I2_HBV/1-354      AC Q8B4I2.1
#=GS X4ZF43_HBV/1-352      AC X4ZF43.1
#=GS F5C0J9_HBV/1-354      AC F5C0J9.1
#=GS B1ABN0_HBV/1-352      AC B1ABN0.1
#=GS M4Q7P8_HBV/1-171      AC M4Q7P8.1
#=GS Q9WP59_HBV/1-272      AC Q9WP59.1
#=GS B7TUV5_HBV/1-347      AC B7TUV5.1
#=GS D5MSG7_HBV/1-343      AC D5MSG7.1
#=GS C1K1V3_HBV/1-352      AC C1K1V3.1
#=GS Q2L4P8_HBV/1-341      AC Q2L4P8.1
#=GS D0UE91_HBV/1-352      AC D0UE91.1
#=GS C7AY78_HBV/1-354      AC C7AY78.1
#=GS Q9QBE7_HBV/1-352      AC Q9QBE7.1
#=GS S5ZZM9_HBV/1-336      AC S5ZZM9.1
#=GS A9CM45_HBV/1-352      AC A9CM45.1
#=GS B5M5Y1_HBV/1-352      AC B5M5Y1.1
#=GS S5ZFC5_HBV/1-339      AC S5ZFC5.1
#=GS H9XR30_HBV/1-91       AC H9XR30.1
#=GS H9XRY9_HBV/1-91       AC H9XRY9.1
#=GS Q1HHB5_HBV/1-341      AC Q1HHB5.1
#=GS K0FCM9_HBV/1-352      AC K0FCM9.1
#=GS H6UGM6_HBV/1-341      AC H6UGM6.1
#=GS V5JE37_HBV/1-329      AC V5JE37.1
#=GS I0C980_HBV/1-354      AC I0C980.1
#=GS I0DD90_HBV/1-328      AC I0DD90.1
#=GS W8P6Y9_HBV/1-352      AC W8P6Y9.1
#=GS H2ER57_HBV/1-352      AC H2ER57.1
#=GS B4YL84_HBV/1-341      AC B4YL84.1
#=GS B5M5G2_HBV/1-352      AC B5M5G2.1
#=GS B5M5Q5_HBV/1-352      AC B5M5Q5.1
#=GS B9VKC2_HBV/1-352      AC B9VKC2.1
#=GS T1YUS5_HBV/1-352      AC T1YUS5.1
#=GS D3TJY3_HBV/1-352      AC D3TJY3.1
#=GS D5LB61_HBV/1-352      AC D5LB61.1
#=GS T1YT06_HBV/1-352      AC T1YT06.1
#=GS S5ZKB8_HBV/1-332      AC S5ZKB8.1
#=GS B9VKC6_HBV/1-352      AC B9VKC6.1
#=GS Q9IX75_HBV/1-52       AC Q9IX75.1
#=GS B7TUR8_HBV/1-352      AC B7TUR8.1
#=GS B9VKW1_HBV/1-352      AC B9VKW1.1
#=GS D3YG57_HBV/1-341      AC D3YG57.1
#=GS E5RD73_HBV/1-352      AC E5RD73.1
#=GS A5JI33_HBV/1-111      AC A5JI33.1
#=GS C0IRW3_HBV/1-352      AC C0IRW3.1
#=GS F5C1G6_HBV/1-341      AC F5C1G6.1
#=GS I0DE00_HBV/1-328      AC I0DE00.1
#=GS Q6UBJ8_HBV/1-323      AC Q6UBJ8.1
#=GS A5LG58_HBV/1-352      AC A5LG58.1
#=GS G9G997_HBV/1-341      AC G9G997.1
#=GS D5LE34_HBV/1-352      AC D5LE34.1
#=GS E5KUG3_9HEPA/59-342   AC E5KUG3.1
#=GS H9XRA6_HBV/1-91       AC H9XRA6.1
#=GS Q1PCZ6_HBV/1-352      AC Q1PCZ6.1
#=GS B5M5V8_HBV/1-246      AC B5M5V8.1
#=GS R9Q8L3_HBV/1-114      AC R9Q8L3.1
#=GS I0DGC3_HBV/1-352      AC I0DGC3.1
#=GS B5A2G4_HBV/1-352      AC B5A2G4.1
#=GS Q67952_HBV/1-352      AC Q67952.1
#=GS K4PYN3_HBV/1-80       AC K4PYN3.1
#=GS A7YEW2_HBV/1-352      AC A7YEW2.1
#=GS F5C142_HBV/1-354      AC F5C142.1
#=GS B8PTF9_HBV/1-341      AC B8PTF9.1
#=GS S6A6U2_HBV/1-352      AC S6A6U2.1
#=GS D2U5Z4_HBV/1-351      AC D2U5Z4.1
#=GS I0DGC9_HBV/1-352      AC I0DGC9.1
#=GS B7TTE0_HBV/1-352      AC B7TTE0.1
#=GS V5NSJ5_HBV/1-350      AC V5NSJ5.1
#=GS H6UGC4_HBV/1-341      AC H6UGC4.1
#=GS C6F590_HBV/1-354      AC C6F590.1
#=GS E5RPP9_HBV/1-343      AC E5RPP9.1
#=GS F5C0Z9_HBV/1-354      AC F5C0Z9.1
#=GS B5BPK1_HBV/1-352      AC B5BPK1.1
#=GS C7DN75_HBV/1-351      AC C7DN75.1
#=GS F5C0X4_HBV/1-354      AC F5C0X4.1
#=GS L0HA39_HBV/1-347      AC L0HA39.1
#=GS G4XI86_HBV/1-54       AC G4XI86.1
#=GS D0E6E4_HBV/1-341      AC D0E6E4.1
#=GS D5LEJ6_HBV/1-352      AC D5LEJ6.1
#=GS Q2L4K0_HBV/1-351      AC Q2L4K0.1
#=GS E5CZ07_HBV/1-352      AC E5CZ07.1
#=GS K9MDL7_HBV/1-24       AC K9MDL7.1
#=GS Q6BCP3_HBV/7-121      AC Q6BCP3.1
#=GS F5C1B8_HBV/1-354      AC F5C1B8.1
#=GS G1C8L0_HBV/1-341      AC G1C8L0.1
#=GS DPOL_HBVA8/1-354      AC Q4R1S7.1
#=GS C7DSN9_HBV/1-341      AC C7DSN9.1
#=GS D0E629_HBV/1-352      AC D0E629.1
#=GS X4YYN5_HBV/1-352      AC X4YYN5.1
#=GS Q91GX2_HBV/1-352      AC Q91GX2.1
#=GS K9MDN3_HBV/1-24       AC K9MDN3.1
#=GS B5M4Y7_HBV/1-352      AC B5M4Y7.1
#=GS L7R7V9_HBV/1-352      AC L7R7V9.1
#=GS B0FCP4_HBV/1-352      AC B0FCP4.1
#=GS C7AYE3_HBV/1-354      AC C7AYE3.1
#=GS I3XMM7_HBV/1-354      AC I3XMM7.1
#=GS I0DD29_HBV/1-328      AC I0DD29.1
#=GS C5WK14_HBV/1-352      AC C5WK14.1
#=GS I0DC59_HBV/1-328      AC I0DC59.1
#=GS L7R8D1_HBV/1-341      AC L7R8D1.1
#=GS D0E5U5_HBV/1-352      AC D0E5U5.1
#=GS D5LE41_HBV/1-352      AC D5LE41.1
#=GS I0DGH8_HBV/1-352      AC I0DGH8.1
#=GS D5LFJ6_HBV/1-352      AC D5LFJ6.1
#=GS H6V5N2_HBV/1-341      AC H6V5N2.1
#=GS Q81107_HBV/1-352      AC Q81107.1
#=GS L0HA93_HBV/1-352      AC L0HA93.1
#=GS D0UDS4_HBV/1-352      AC D0UDS4.1
#=GS X4YRG0_HBV/1-352      AC X4YRG0.1
#=GS E9L2H7_HBV/1-171      AC E9L2H7.1
#=GS P88802_HBV/1-347      AC P88802.1
#=GS B5M5D6_HBV/1-352      AC B5M5D6.1
#=GS D3YG39_HBV/1-341      AC D3YG39.1
#=GS D5LF18_HBV/1-352      AC D5LF18.1
#=GS A5GZI4_HBV/1-352      AC A5GZI4.1
#=GS K7QH32_HBV/1-352      AC K7QH32.1
#=GS I0C942_HBV/1-354      AC I0C942.1
#=GS S5ZSD0_HBV/1-340      AC S5ZSD0.1
#=GS S5ZE88_HBV/1-336      AC S5ZE88.1
#=GS F5C0V2_HBV/1-354      AC F5C0V2.1
#=GS D3TII8_HBV/1-345      AC D3TII8.1
#=GS B5B492_HBV/236-291    AC B5B492.1
#=GS U3KUE7_HBV/1-171      AC U3KUE7.1
#=GS S5ZE01_HBV/1-341      AC S5ZE01.1
#=GS S5ZTN7_HBV/1-340      AC S5ZTN7.1
#=GS X4Y455_HBV/1-341      AC X4Y455.1
#=GS H9N883_HBV/1-341      AC H9N883.1
#=GS G9G8T6_HBV/1-341      AC G9G8T6.2
#=GS Q5KR39_HBV/1-352      AC Q5KR39.1
#=GS R9Q882_HBV/1-114      AC R9Q882.1
#=GS G3XGW6_HBV/1-343      AC G3XGW6.1
#=GS W6HWH3_HBV/1-315      AC W6HWH3.1
#=GS L0BCD3_HBV/1-210      AC L0BCD3.1
#=GS S6A6W3_HBV/1-341      AC S6A6W3.1
#=GS G9G937_HBV/1-342      AC G9G937.2
#=GS B5M543_HBV/1-342      AC B5M543.1
#=GS B0FD97_HBV/1-346      AC B0FD97.1
#=GS D0EDT5_HBV/1-341      AC D0EDT5.1
#=GS O91580_HBV/1-352      AC O91580.1
#=GS F5C0V4_HBV/1-354      AC F5C0V4.1
#=GS Q1XHF8_HBV/1-341      AC Q1XHF8.1
#=GS G4XI09_HBV/1-160      AC G4XI09.1
#=GS S6A704_HBV/1-352      AC S6A704.1
#=GS D0EEL1_HBV/1-354      AC D0EEL1.1
#=GS I0DE36_HBV/1-328      AC I0DE36.1
#=GS B0FCI6_HBV/1-352      AC B0FCI6.1
#=GS B5L575_HBV/1-354      AC B5L575.1
#=GS B9VJY9_HBV/1-352      AC B9VJY9.1
#=GS H9XRH3_HBV/1-91       AC H9XRH3.1
#=GS D5LE87_HBV/1-352      AC D5LE87.1
#=GS B7TTB7_HBV/1-352      AC B7TTB7.1
#=GS I0C8L0_HBV/1-350      AC I0C8L0.1
#=GS D2JMH8_HBV/1-352      AC D2JMH8.1
#=GS Q7THS2_HBV/1-352      AC Q7THS2.1
#=GS F2WS72_HBV/1-352      AC F2WS72.1
#=GS F5C0H6_HBV/1-341      AC F5C0H6.1
#=GS C5WJZ8_HBV/1-352      AC C5WJZ8.1
#=GS H6V5Q6_HBV/1-350      AC H6V5Q6.1
#=GS C7DN29_HBV/1-351      AC C7DN29.1
#=GS S5ZS90_HBV/1-321      AC S5ZS90.1
#=GS K4PYM3_HBV/1-81       AC K4PYM3.1
#=GS S5ZTM0_HBV/1-332      AC S5ZTM0.1
#=GS O56654_HBV/1-337      AC O56654.1
#=GS D0EDR5_HBV/1-341      AC D0EDR5.1
#=GS S5ZL34_HBV/1-340      AC S5ZL34.1
#=GS E8Z617_HBV/1-352      AC E8Z617.1
#=GS DPOL_HBVB4/1-352      AC P17395.1
#=GS A5JI04_HBV/1-112      AC A5JI04.1
#=GS Q1JUR0_HBV/1-352      AC Q1JUR0.1
#=GS M4Q841_HBV/1-171      AC M4Q841.1
#=GS D5MSI9_HBV/1-343      AC D5MSI9.1
#=GS L7R9K7_HBV/1-352      AC L7R9K7.1
#=GS B2LWB8_HBV/1-337      AC B2LWB8.1
#=GS K4N0E5_HBV/1-352      AC K4N0E5.1
#=GS S5ZSA5_HBV/1-341      AC S5ZSA5.1
#=GS D3TIP9_HBV/1-352      AC D3TIP9.1
#=GS W0SLI6_HBV/1-352      AC W0SLI6.1
#=GS D5LBV0_HBV/1-352      AC D5LBV0.1
#=GS I0C8J8_HBV/1-350      AC I0C8J8.1
#=GS R9Q8R7_HBV/1-114      AC R9Q8R7.1
#=GS D5LCK1_HBV/1-352      AC D5LCK1.1
#=GS F5C0R8_HBV/1-351      AC F5C0R8.1
#=GS E5RPW9_HBV/1-343      AC E5RPW9.1
#=GS X4YHU5_HBV/1-341      AC X4YHU5.1
#=GS A0FDV5_HBV/1-342      AC A0FDV5.1
#=GS B7SXU7_HBV/1-352      AC B7SXU7.1
#=GS Q4KRB4_HBV/1-354      AC Q4KRB4.1
#=GS F5C137_HBV/1-354      AC F5C137.1
#=GS R9Q8S9_HBV/1-114      AC R9Q8S9.1
#=GS H6UNA8_HBV/1-341      AC H6UNA8.1
#=GS Q00K56_HBV/1-352      AC Q00K56.1
#=GS E5RPW1_HBV/1-343      AC E5RPW1.1
#=GS D0E5G5_HBV/1-352      AC D0E5G5.1
#=GS G4XMH5_HBV/1-352      AC G4XMH5.1
#=GS A6MGB4_HBV/1-352      AC A6MGB4.1
#=GS M1FT39_HBV/1-352      AC M1FT39.1
#=GS C6F5F3_HBV/1-354      AC C6F5F3.1
#=GS Q598S1_HBV/1-352      AC Q598S1.1
#=GS A5YKK0_HBV/1-167      AC A5YKK0.1
#=GS A5JJ36_HBV/1-73       AC A5JJ36.1
#=GS J7H606_HBV/1-224      AC J7H606.1
#=GS I0C8N2_HBV/1-335      AC I0C8N2.1
#=GS H6WFH0_HBV/1-112      AC H6WFH0.1
#=GS B3VLG9_HBV/1-175      AC B3VLG9.1
#=GS L7R9D9_HBV/1-341      AC L7R9D9.1
#=GS L8E6U7_HBV/1-325      AC L8E6U7.1
#=GS Q4AC34_HBV/1-352      AC Q4AC34.1
#=GS B5BPM9_HBV/1-352      AC B5BPM9.1
#=GS D0EEJ7_HBV/1-354      AC D0EEJ7.1
#=GS A5JIS4_HBV/1-112      AC A5JIS4.1
#=GS B0YGI6_HBV/1-354      AC B0YGI6.1
#=GS B5B4I9_HBV/1-347      AC B5B4I9.1
#=GS B9VKU7_HBV/1-352      AC B9VKU7.1
#=GS E5RPL5_HBV/1-352      AC E5RPL5.1
#=GS I0C979_HBV/1-351      AC I0C979.1
#=GS V9TH83_HBV/1-329      AC V9TH83.1
#=GS K7QGC4_HBV/278-309    AC K7QGC4.1
#=GS U3KUD1_HBV/1-171      AC U3KUD1.1
#=GS D0E5D3_HBV/1-352      AC D0E5D3.1
#=GS L0HA92_HBV/1-352      AC L0HA92.1
#=GS I6YYW1_HBV/1-352      AC I6YYW1.1
#=GS D7NKS9_HBV/1-341      AC D7NKS9.1
#=GS B5BPK9_HBV/1-352      AC B5BPK9.1
#=GS S5ZLD0_HBV/1-341      AC S5ZLD0.1
#=GS S5ZZY7_HBV/1-332      AC S5ZZY7.1
#=GS D0E5E0_HBV/1-352      AC D0E5E0.1
#=GS I0C925_HBV/1-354      AC I0C925.1
#=GS Q5DWM7_HBV/1-352      AC Q5DWM7.1
#=GS B8PTE5_HBV/1-341      AC B8PTE5.1
#=GS S6A6W2_HBV/1-340      AC S6A6W2.1
#=GS I3XMR0_HBV/1-354      AC I3XMR0.1
#=GS K4N2M7_HBV/1-352      AC K4N2M7.1
#=GS I0DGJ1_HBV/1-352      AC I0DGJ1.1
#=GS Q4FDC7_HBV/1-352      AC Q4FDC7.1
#=GS G3XLD8_HBV/1-352      AC G3XLD8.1
#=GS Q8B5R3_HBV/1-203      AC Q8B5R3.1
#=GS B3VLK5_HBV/1-176      AC B3VLK5.1
#=GS B5TF37_HBV/1-112      AC B5TF37.1
#=GS B5TXY1_HBV/1-352      AC B5TXY1.1
#=GS E5RD81_HBV/1-352      AC E5RD81.1
#=GS V9TI57_HBV/1-341      AC V9TI57.1
#=GS H6UG76_HBV/1-341      AC H6UG76.1
#=GS I0C8N4_HBV/1-341      AC I0C8N4.1
#=GS D2X3T8_HBV/2-171      AC D2X3T8.1
#=GS B9VAY5_HBV/1-262      AC B9VAY5.1
#=GS I0DGB2_HBV/1-352      AC I0DGB2.1
#=GS I0C9E8_HBV/1-352      AC I0C9E8.1
#=GS D9U548_HBV/1-352      AC D9U548.1
#=GS S5ZJX0_HBV/1-341      AC S5ZJX0.1
#=GS S6A6Y7_HBV/1-337      AC S6A6Y7.1
#=GS Q4FD95_HBV/1-352      AC Q4FD95.1
#=GS C9WDQ4_HBV/1-341      AC C9WDQ4.1
#=GS H9XRN6_HBV/1-91       AC H9XRN6.1
#=GS Q9YPV1_HBV/1-341      AC Q9YPV1.1
#=GS B9VKV5_HBV/1-352      AC B9VKV5.1
#=GS L7PDA0_HBV/1-352      AC L7PDA0.1
#=GS B1ABJ9_HBV/1-346      AC B1ABJ9.1
#=GS C1K180_HBV/1-352      AC C1K180.1
#=GS G3XH20_HBV/1-332      AC G3XH20.1
#=GS B4YLA0_HBV/1-341      AC B4YLA0.1
#=GS U5JJT4_HBV/131-171    AC U5JJT4.1
#=GS H1ZN37_HBV/1-341      AC H1ZN37.1
#=GS S5ZS44_HBV/1-352      AC S5ZS44.1
#=GS I0C862_HBV/1-354      AC I0C862.1
#=GS W0SLK7_HBV/1-352      AC W0SLK7.1
#=GS B5AT06_HBV/1-352      AC B5AT06.1
#=GS H2ERB7_HBV/1-352      AC H2ERB7.1
#=GS B5B4B4_HBV/236-291    AC B5B4B4.1
#=GS G4XMF9_HBV/1-352      AC G4XMF9.1
#=GS H9XRG5_HBV/1-91       AC H9XRG5.1
#=GS L7R7N9_HBV/1-352      AC L7R7N9.1
#=GS A5JHR2_HBV/1-112      AC A5JHR2.1
#=GS C7DM51_HBV/1-351      AC C7DM51.1
#=GS G4XI78_HBV/1-54       AC G4XI78.1
#=GS S5ZSV8_HBV/1-336      AC S5ZSV8.1
#=GS C1K1F3_HBV/1-352      AC C1K1F3.1
#=GS C7DMH1_HBV/1-351      AC C7DMH1.1
#=GS S5ZLY6_HBV/1-337      AC S5ZLY6.1
#=GS H6W4F2_HBV/1-148      AC H6W4F2.1
#=GS B7TUI3_HBV/1-343      AC B7TUI3.1
#=GS H9XRS9_HBV/1-91       AC H9XRS9.1
#=GS H6UG70_HBV/1-341      AC H6UG70.1
#=GS L7R6T3_HBV/1-341      AC L7R6T3.1
#=GS Q9IGW1_HBV/1-341      AC Q9IGW1.1
#=GS E9L2R5_HBV/1-171      AC E9L2R5.1
#=GS S5ZK03_HBV/1-336      AC S5ZK03.1
#=GS E5L514_9HEPA/54-236   AC E5L514.1
#=GS X4Y460_HBV/1-340      AC X4Y460.1
#=GS S6A015_HBV/1-334      AC S6A015.1
#=GS G9G9U3_HBV/1-334      AC G9G9U3.2
#=GS E5RPV5_HBV/1-343      AC E5RPV5.1
#=GS B3VLI4_HBV/1-175      AC B3VLI4.1
#=GS L0HC20_HBV/1-352      AC L0HC20.1
#=GS C9WDD8_HBV/1-341      AC C9WDD8.1
#=GS L0CND4_HBV/1-341      AC L0CND4.1
#=GS B5M5F6_HBV/1-352      AC B5M5F6.1
#=GS H6WFK6_HBV/1-112      AC H6WFK6.1
#=GS H9XQR3_HBV/1-91       AC H9XQR3.1
#=GS Q9YQ44_HBV/1-167      AC Q9YQ44.1
#=GS I0DCD2_HBV/1-328      AC I0DCD2.1
#=GS I0DGH2_HBV/1-352      AC I0DGH2.1
#=GS I2DB75_HBV/1-341      AC I2DB75.1
#=GS A8J4A7_HBV/1-352      AC A8J4A7.1
#=GS I0C9B5_HBV/1-334      AC I0C9B5.1
#=GS D9U5B2_HBV/1-352      AC D9U5B2.1
#=GS I0C955_HBV/1-354      AC I0C955.1
#=GS Q7T4U8_HBV/1-341      AC Q7T4U8.1
#=GS B2LSK4_HBV/1-352      AC B2LSK4.1
#=GS I0DGK0_HBV/1-352      AC I0DGK0.1
#=GS G4XI85_HBV/1-160      AC G4XI85.1
#=GS J7ING9_HBV/1-352      AC J7ING9.1
#=GS M4QJ20_HBV/1-171      AC M4QJ20.1
#=GS Q8B4C0_HBV/228-322    AC Q8B4C0.1
#=GS DPOL_ASHV/3-223       AC Q64898.1
#=GS A5LGB0_HBV/1-352      AC A5LGB0.1
#=GS I0DCL1_HBV/1-317      AC I0DCL1.1
#=GS Q003Z7_HBV/1-352      AC Q003Z7.1
#=GS E5RPX1_HBV/1-343      AC E5RPX1.1
#=GS B2Y6U8_HBV/1-341      AC B2Y6U8.1
#=GS D0EE93_HBV/1-354      AC D0EE93.1
#=GS Q9QMH7_HBV/1-341      AC Q9QMH7.1
#=GS S6A6V9_HBV/1-341      AC S6A6V9.1
#=GS B5U731_HBV/1-341      AC B5U731.1
#=GS G1E7I5_HBV/1-272      AC G1E7I5.1
#=GS A5JI99_HBV/1-112      AC A5JI99.1
#=GS I0C9A7_HBV/1-341      AC I0C9A7.1
#=GS B1ABP5_HBV/1-352      AC B1ABP5.1
#=GS Q1XHD8_HBV/1-352      AC Q1XHD8.1
#=GS F5C1H3_HBV/1-341      AC F5C1H3.1
#=GS C3W3H8_HBV/1-124      AC C3W3H8.1
#=GS D3XGD6_HBV/1-352      AC D3XGD6.1
#=GS G9G9K8_HBV/1-341      AC G9G9K8.1
#=GS B3VLN1_HBV/1-175      AC B3VLN1.1
#=GS F5C175_HBV/1-354      AC F5C175.1
#=GS G3XGV6_HBV/1-352      AC G3XGV6.1
#=GS C5WJZ0_HBV/1-352      AC C5WJZ0.1
#=GS A5JHY4_HBV/1-112      AC A5JHY4.1
#=GS A5LG42_HBV/1-352      AC A5LG42.1
#=GS H6UGR6_HBV/1-341      AC H6UGR6.1
#=GS K4N2Q2_HBV/1-352      AC K4N2Q2.1
#=GS E5RPR5_HBV/1-343      AC E5RPR5.1
#=GS D6QW12_HBV/1-352      AC D6QW12.1
#=GS Q4W6E4_HBV/1-351      AC Q4W6E4.1
#=GS T1YUR8_HBV/1-352      AC T1YUR8.1
#=GS S6A0B5_HBV/1-341      AC S6A0B5.1
#=GS S6A6Y9_HBV/1-341      AC S6A6Y9.1
#=GS B6CEV9_HBV/1-352      AC B6CEV9.1
#=GS S5ZTD0_HBV/1-341      AC S5ZTD0.1
#=GS O09517_HBV/212-310    AC O09517.1
#=GS B7TTX5_HBV/1-352      AC B7TTX5.1
#=GS S6A708_HBV/1-340      AC S6A708.1
#=GS E1U7N5_HBV/1-341      AC E1U7N5.1
#=GS I0C8J7_HBV/1-350      AC I0C8J7.1
#=GS C7DMW0_HBV/1-351      AC C7DMW0.1
#=GS B5TXR1_HBV/1-352      AC B5TXR1.1
#=GS F5C171_HBV/1-354      AC F5C171.1
#=GS D5MSG5_HBV/1-343      AC D5MSG5.1
#=GS Q8B4F0_HBV/226-282    AC Q8B4F0.1
#=GS H6WFP0_HBV/1-112      AC H6WFP0.1
#=GS I0C8P1_HBV/1-341      AC I0C8P1.1
#=GS E5RPQ7_HBV/1-343      AC E5RPQ7.1
#=GS I0DDH4_HBV/1-328      AC I0DDH4.1
#=GS DPOL_HBVOR/1-341      AC Q9J5S2.1
#=GS E3Q0M8_HBV/1-352      AC E3Q0M8.1
#=GS M4Q8Y8_HBV/1-352      AC M4Q8Y8.1
#=GS C1K1A5_HBV/1-352      AC C1K1A5.1
#=GS X4YRM8_HBV/1-352      AC X4YRM8.1
#=GS G1E814_HBV/1-341      AC G1E814.1
#=GS D0QP35_HBV/1-352      AC D0QP35.2
#=GS S5ZEP0_HBV/1-341      AC S5ZEP0.1
#=GS D0EE79_HBV/1-354      AC D0EE79.1
#=GS H6WF74_HBV/1-112      AC H6WF74.1
#=GS E3Q0G9_HBV/1-352      AC E3Q0G9.1
#=GS C7AYA2_HBV/1-354      AC C7AYA2.1
#=GS O91549_HBV/1-352      AC O91549.1
#=GS H6WFC6_HBV/1-112      AC H6WFC6.1
#=GS G1C8Z2_HBV/1-336      AC G1C8Z2.1
#=GS I0DCC5_HBV/1-328      AC I0DCC5.1
#=GS Q9IX72_HBV/1-52       AC Q9IX72.1
#=GS S5ZE72_HBV/1-340      AC S5ZE72.1
#=GS L0HCA1_HBV/1-352      AC L0HCA1.1
#=GS I0DDX4_HBV/1-328      AC I0DDX4.1
#=GS S5ZTB5_HBV/1-341      AC S5ZTB5.1
#=GS Q4FDF1_HBV/1-352      AC Q4FDF1.1
#=GS B9VKY2_HBV/1-352      AC B9VKY2.1
#=GS Q91S89_HBV/1-341      AC Q91S89.1
#=GS H6WFI2_HBV/1-112      AC H6WFI2.1
#=GS D5LDL5_HBV/1-352      AC D5LDL5.1
#=GS H6WF90_HBV/1-112      AC H6WF90.1
#=GS D0E5B3_HBV/1-352      AC D0E5B3.1
#=GS D5LDH3_HBV/1-352      AC D5LDH3.1
#=GS C9WDP7_HBV/1-341      AC C9WDP7.1
#=GS D5LDI0_HBV/1-352      AC D5LDI0.1
#=GS Q2HXJ0_HBV/1-352      AC Q2HXJ0.1
#=GS D0E5M0_HBV/1-352      AC D0E5M0.1
#=GS D3YG15_HBV/1-238      AC D3YG15.1
#=GS Q2F512_HBV/229-312    AC Q2F512.1
#=GS C1K1Q7_HBV/1-352      AC C1K1Q7.1
#=GS B9VK31_HBV/1-352      AC B9VK31.1
#=GS F5C0K8_HBV/1-354      AC F5C0K8.1
#=GS Q402B4_HBV/1-352      AC Q402B4.1
#=GS C4RU84_HBV/1-341      AC C4RU84.1
#=GS B5B4H1_HBV/1-239      AC B5B4H1.1
#=GS G9G9P3_HBV/1-233      AC G9G9P3.1
#=GS S6A6S0_HBV/1-332      AC S6A6S0.1
#=GS G0YVP3_HBV/1-341      AC G0YVP3.1
#=GS Q2LCB6_HBV/1-341      AC Q2LCB6.1
#=GS D5LDA0_HBV/1-352      AC D5LDA0.1
#=GS Q80GX5_HBV/247-278    AC Q80GX5.1
#=GS H6WF54_HBV/1-112      AC H6WF54.1
#=GS G1C8C7_HBV/1-341      AC G1C8C7.1
#=GS D0E5Y7_HBV/1-352      AC D0E5Y7.1
#=GS A5GZL0_HBV/1-352      AC A5GZL0.1
#=GS G3XGV2_HBV/1-335      AC G3XGV2.1
#=GS B0FD24_HBV/1-346      AC B0FD24.1
#=GS Q80GX0_HBV/1-345      AC Q80GX0.1
#=GS R9Q7X8_HBV/1-114      AC R9Q7X8.1
#=GS C5WJX0_HBV/1-352      AC C5WJX0.1
#=GS I0DCQ8_HBV/1-328      AC I0DCQ8.1
#=GS G1E8E7_HBV/1-341      AC G1E8E7.1
#=GS W6HYC5_HBV/1-315      AC W6HYC5.1
#=GS G1E8Q9_HBV/1-341      AC G1E8Q9.1
#=GS L8B204_HBV/1-337      AC L8B204.1
#=GS D5LEW9_HBV/1-352      AC D5LEW9.1
#=GS D0VXK1_HBV/1-341      AC D0VXK1.1
#=GS W6IBG9_HBV/1-315      AC W6IBG9.1
#=GS B0FCT5_HBV/1-352      AC B0FCT5.1
#=GS B5BPX0_HBV/1-348      AC B5BPX0.1
#=GS H9XQZ5_HBV/1-91       AC H9XQZ5.1
#=GS X4ZEK6_HBV/1-352      AC X4ZEK6.1
#=GS B5M5W4_HBV/1-241      AC B5M5W4.1
#=GS A5JII3_HBV/1-112      AC A5JII3.1
#=GS B9VK15_HBV/1-352      AC B9VK15.1
#=GS D3TJE1_HBV/1-212      AC D3TJE1.1
#=GS I0DEA5_HBV/1-317      AC I0DEA5.1
#=GS D7NKN1_HBV/1-341      AC D7NKN1.1
#=GS K4N0G2_HBV/1-352      AC K4N0G2.1
#=GS S5ZT17_HBV/1-336      AC S5ZT17.1
#=GS C7DNM2_HBV/1-352      AC C7DNM2.1
#=GS I0DDR7_HBV/1-328      AC I0DDR7.1
#=GS D2X410_HBV/1-78       AC D2X410.1
#=GS D2JN03_HBV/1-352      AC D2JN03.1
#=GS D0E5W4_HBV/1-352      AC D0E5W4.1
#=GS X4ZCV7_HBV/1-352      AC X4ZCV7.1
#=GS R9Q8H0_HBV/1-114      AC R9Q8H0.1
#=GS L0H829_HBV/1-338      AC L0H829.1
#=GS J7H0E3_HBV/1-293      AC J7H0E3.1
#=GS I0CF24_HBV/1-280      AC I0CF24.1
#=GS B5M5C4_HBV/1-352      AC B5M5C4.1
#=GS D0EE01_HBV/1-354      AC D0EE01.1
#=GS K7QG23_HBV/1-352      AC K7QG23.1
#=GS D3YG89_HBV/1-341      AC D3YG89.1
#=GS I0C8W9_HBV/1-354      AC I0C8W9.1
#=GS S6A6T7_HBV/1-336      AC S6A6T7.1
#=GS G9G9G0_HBV/1-340      AC G9G9G0.1
#=GS Q4FD91_HBV/1-352      AC Q4FD91.1
#=GS A5HKQ7_HBV/1-352      AC A5HKQ7.1
#=GS Q6JWV7_HBV/1-352      AC Q6JWV7.1
#=GS S5ZZQ3_HBV/1-320      AC S5ZZQ3.1
#=GS G1E7F2_HBV/1-341      AC G1E7F2.1
#=GS Q9IX90_HBV/1-52       AC Q9IX90.1
#=GS E9L2P9_HBV/1-171      AC E9L2P9.1
#=GS Q2LCE0_HBV/1-333      AC Q2LCE0.1
#=GS I0C8H9_HBV/1-335      AC I0C8H9.1
#=GS B5AT57_HBV/1-352      AC B5AT57.1
#=GS Q8B4E5_HBV/93-169     AC Q8B4E5.1
#=GS C7DND6_HBV/1-350      AC C7DND6.1
#=GS G4XMJ5_HBV/1-352      AC G4XMJ5.1
#=GS I0DDU1_HBV/1-317      AC I0DDU1.1
#=GS Q918N6_9HEPA/222-391  AC Q918N6.1
#=GS Q68RP8_HBV/1-352      AC Q68RP8.1
#=GS I0DGD3_HBV/1-352      AC I0DGD3.1
#=GS B3VLF4_HBV/1-176      AC B3VLF4.1
#=GS H9XQH8_HBV/1-91       AC H9XQH8.1
#=GS B1ABL0_HBV/236-291    AC B1ABL0.1
#=GS K7QG22_HBV/1-347      AC K7QG22.1
#=GS B4YKW9_HBV/1-341      AC B4YKW9.1
#=GS B5M5C7_HBV/1-352      AC B5M5C7.1
#=GS X4ZCQ9_HBV/1-352      AC X4ZCQ9.1
#=GS F5C0S7_HBV/1-333      AC F5C0S7.1
#=GS E9L5F6_HBV/1-352      AC E9L5F6.1
#=GS I6YUV9_HBV/1-334      AC I6YUV9.1
#=GS G4XMC7_HBV/1-341      AC G4XMC7.1
#=GS D5LEZ7_HBV/1-352      AC D5LEZ7.1
#=GS Q00K52_HBV/1-352      AC Q00K52.1
#=GS I0C8R9_HBV/224-280    AC I0C8R9.1
#=GS H6V5M8_HBV/1-341      AC H6V5M8.1
#=GS M9PNG3_HBV/1-243      AC M9PNG3.1
#=GS D3TJD5_HBV/1-219      AC D3TJD5.1
#=GS E9L2L0_HBV/1-171      AC E9L2L0.1
#=GS Q992I7_HBV/1-352      AC Q992I7.1
#=GS I0DCE7_HBV/1-328      AC I0DCE7.1
#=GS C6F597_HBV/1-354      AC C6F597.1
#=GS S6A6S3_HBV/1-332      AC S6A6S3.1
#=GS Q2EIF5_HBV/1-346      AC Q2EIF5.1
#=GS L8B212_HBV/1-341      AC L8B212.1
#=GS U3RJV8_HBV/1-218      AC U3RJV8.1
#=GS I0C857_HBV/1-354      AC I0C857.1
#=GS W0SM71_HBV/1-352      AC W0SM71.1
#=GS R9Q7U6_HBV/1-114      AC R9Q7U6.1
#=GS T2HTP3_HBV/1-50       AC T2HTP3.1
#=GS D2X599_HBV/4-171      AC D2X599.1
#=GS D5LFD3_HBV/1-352      AC D5LFD3.1
#=GS D0E5J0_HBV/1-352      AC D0E5J0.1
#=GS G3E5H1_HBV/1-341      AC G3E5H1.1
#=GS D0E578_HBV/1-352      AC D0E578.1
#=GS K7QZZ0_HBV/1-352      AC K7QZZ0.1
#=GS D0UEB0_HBV/1-352      AC D0UEB0.1
#=GS B5BPG9_HBV/1-352      AC B5BPG9.1
#=GS B5ASW6_HBV/1-352      AC B5ASW6.1
#=GS F5C181_HBV/1-354      AC F5C181.1
#=GS Q89244_9HEPA/1-94     AC Q89244.1
#=GS H9XRQ2_HBV/1-91       AC H9XRQ2.1
#=GS Q9QAE8_HBV/1-352      AC Q9QAE8.1
#=GS F5C0U5_HBV/1-351      AC F5C0U5.1
#=GS S5ZSS0_HBV/1-341      AC S5ZSS0.1
#=GS D5LBG5_HBV/1-352      AC D5LBG5.1
#=GS G1C8V0_HBV/1-341      AC G1C8V0.1
#=GS E0ZS03_HBV/1-351      AC E0ZS03.1
#=GS E5F0Y2_HBV/1-49       AC E5F0Y2.1
#=GS F5C127_HBV/1-354      AC F5C127.1
#=GS Q7THQ4_HBV/1-346      AC Q7THQ4.1
#=GS G1C8Z9_HBV/1-341      AC G1C8Z9.1
#=GS D6QVM1_HBV/1-352      AC D6QVM1.1
#=GS B5TXV4_HBV/1-352      AC B5TXV4.1
#=GS A5JI91_HBV/1-112      AC A5JI91.1
#=GS I0C8L7_HBV/1-335      AC I0C8L7.1
#=GS Q8JMZ0_HBV/1-352      AC Q8JMZ0.1
#=GS G3XLF1_HBV/1-352      AC G3XLF1.1
#=GS C7DY82_HBV/1-347      AC C7DY82.1
#=GS E7CU09_HBV/1-352      AC E7CU09.1
#=GS D7NL68_HBV/1-341      AC D7NL68.1
#=GS L0CN38_HBV/1-341      AC L0CN38.1
#=GS O91584_HBV/1-352      AC O91584.1
#=GS B9VK74_HBV/1-352      AC B9VK74.1
#=GS D0E5Y3_HBV/1-352      AC D0E5Y3.1
#=GS S5ZZP1_HBV/1-352      AC S5ZZP1.1
#=GS I0C8Q5_HBV/1-341      AC I0C8Q5.1
#=GS A0A023NKL5_HBV/1-334  AC A0A023NKL5.1
#=GS F5C0H3_HBV/1-341      AC F5C0H3.1
#=GS H1ACW0_HBV/1-352      AC H1ACW0.1
#=GS G9G917_HBV/1-341      AC G9G917.1
#=GS T2HR10_HBV/1-50       AC T2HR10.1
#=GS H2ER77_HBV/1-352      AC H2ER77.1
#=GS F1AEX9_HBV/1-341      AC F1AEX9.1
#=GS X4YR81_HBV/1-352      AC X4YR81.1
#=GS H9XRA2_HBV/1-91       AC H9XRA2.1
#=GS B3VLH2_HBV/1-176      AC B3VLH2.1
#=GS S5ZKI3_HBV/1-352      AC S5ZKI3.1
#=GS L0HAS0_HBV/1-352      AC L0HAS0.1
#=GS B1A0C5_HBV/1-354      AC B1A0C5.1
#=GS Q81137_HBV/1-352      AC Q81137.1
#=GS B7TUP3_HBV/1-352      AC B7TUP3.1
#=GS Q80GX5_HBV/1-198      AC Q80GX5.1
#=GS F5C117_HBV/281-320    AC F5C117.1
#=GS Q00K84_HBV/1-352      AC Q00K84.1
#=GS H9XQU1_HBV/1-91       AC H9XQU1.1
#=GS E9L2M7_HBV/1-171      AC E9L2M7.1
#=GS D7NKK7_HBV/1-341      AC D7NKK7.1
#=GS F5C112_HBV/1-352      AC F5C112.1
#=GS F5C0L3_HBV/1-354      AC F5C0L3.1
#=GS B5BPX8_HBV/1-352      AC B5BPX8.1
#=GS I0DD72_HBV/1-328      AC I0DD72.1
#=GS E9L2E5_HBV/1-171      AC E9L2E5.1
#=GS I3XMK9_HBV/1-354      AC I3XMK9.1
#=GS D5LBW4_HBV/1-352      AC D5LBW4.1
#=GS S6A706_HBV/1-341      AC S6A706.1
#=GS I0DGD1_HBV/1-352      AC I0DGD1.1
#=GS F5C170_HBV/1-354      AC F5C170.1
#=GS B9VK11_HBV/1-352      AC B9VK11.1
#=GS H3K3D0_HBV/1-354      AC H3K3D0.1
#=GS I0C8M0_HBV/1-335      AC I0C8M0.1
#=GS S5ZLB7_HBV/1-339      AC S5ZLB7.1
#=GS B0YGL1_HBV/1-341      AC B0YGL1.1
#=GS D3TIG8_HBV/1-352      AC D3TIG8.1
#=GS D2U610_HBV/1-351      AC D2U610.1
#=GS G4XML1_HBV/1-352      AC G4XML1.1
#=GS Q20BU1_HBV/1-42       AC Q20BU1.1
#=GS Q7TDR5_HBV/1-352      AC Q7TDR5.1
#=GS D5LCF2_HBV/1-352      AC D5LCF2.1
#=GS D0UE35_HBV/1-352      AC D0UE35.1
#=GS E3Q0F5_HBV/1-352      AC E3Q0F5.1
#=GS I0DGF2_HBV/1-352      AC I0DGF2.1
#=GS X4Z021_HBV/1-352      AC X4Z021.1
#=GS Q2EX70_HBV/1-342      AC Q2EX70.1
#=GS A4F509_HBV/1-354      AC A4F509.1
#=GS J7INE0_HBV/1-352      AC J7INE0.1
#=GS B0YGI2_HBV/1-341      AC B0YGI2.1
#=GS W8P000_HBV/1-352      AC W8P000.1
#=GS L8B296_HBV/1-341      AC L8B296.1
#=GS A5JIH5_HBV/1-112      AC A5JIH5.1
#=GS DPOL_DHBV3/61-343     AC P0C691.1
#=GS R4NVG6_HBV/1-352      AC R4NVG6.1
#=GS A4F535_HBV/30-360     AC A4F535.1
#=GS F5C1B7_HBV/1-354      AC F5C1B7.1
#=GS U3RJW3_HBV/1-218      AC U3RJW3.1
#=GS Q9YV47_HBV/1-352      AC Q9YV47.1
#=GS G3E594_HBV/1-341      AC G3E594.1
#=GS B1PI59_9HEPA/105-264  AC B1PI59.1
#=GS E0ZRV8_HBV/1-351      AC E0ZRV8.1
#=GS H1ZN31_HBV/1-341      AC H1ZN31.1
#=GS I0DCU4_HBV/1-328      AC I0DCU4.1
#=GS Q2F4X8_HBV/1-353      AC Q2F4X8.1
#=GS D5MSI5_HBV/1-343      AC D5MSI5.1
#=GS I0C886_HBV/1-354      AC I0C886.1
#=GS H6UN25_HBV/1-341      AC H6UN25.1
#=GS H6UNB2_HBV/1-341      AC H6UNB2.1
#=GS B4ZZ04_HBV/1-341      AC B4ZZ04.1
#=GS C7DNB5_HBV/1-351      AC C7DNB5.1
#=GS H2ERI0_HBV/1-352      AC H2ERI0.1
#=GS R9Q868_HBV/1-114      AC R9Q868.1
#=GS I0DD80_HBV/1-328      AC I0DD80.1
#=GS X4YS41_HBV/1-352      AC X4YS41.1
#=GS Q8B4C2_HBV/1-230      AC Q8B4C2.1
#=GS S5ZM03_HBV/1-350      AC S5ZM03.1
#=GS A5LG98_HBV/1-352      AC A5LG98.1
#=GS Q913B1_HBV/1-352      AC Q913B1.1
#=GS Q5EDT1_HBV/1-341      AC Q5EDT1.1
#=GS I0C8N5_HBV/1-227      AC I0C8N5.1
#=GS Q8B4E2_HBV/1-354      AC Q8B4E2.1
#=GS M4Q7Y5_HBV/1-171      AC M4Q7Y5.1
#=GS D3YGN4_HBV/1-341      AC D3YGN4.1
#=GS G3E5F7_HBV/1-341      AC G3E5F7.1
#=GS H6WF42_HBV/1-112      AC H6WF42.1
#=GS Q6XGU0_HBV/1-354      AC Q6XGU0.1
#=GS S5ZZJ0_HBV/1-336      AC S5ZZJ0.1
#=GS Q91HD7_HBV/1-354      AC Q91HD7.1
#=GS I0DGH6_HBV/1-352      AC I0DGH6.1
#=GS I0C8C6_HBV/1-354      AC I0C8C6.1
#=GS B5M637_HBV/1-352      AC B5M637.1
#=GS Q6X5G7_HBV/28-84      AC Q6X5G7.1
#=GS S6A721_HBV/1-338      AC S6A721.1
#=GS H2ERD8_HBV/1-352      AC H2ERD8.1
#=GS L0HAC9_HBV/1-287      AC L0HAC9.1
#=GS Q19SY5_HBV/1-341      AC Q19SY5.1
#=GS K4Q390_HBV/1-84       AC K4Q390.1
#=GS S5ZTA9_HBV/1-341      AC S5ZTA9.1
#=GS S5ZZQ8_HBV/1-334      AC S5ZZQ8.1
#=GS I0DCR2_HBV/1-317      AC I0DCR2.1
#=GS L8B2F6_HBV/1-341      AC L8B2F6.1
#=GS A8J490_HBV/1-352      AC A8J490.1
#=GS B3VLI7_HBV/1-176      AC B3VLI7.1
#=GS K0FCH8_HBV/1-352      AC K0FCH8.1
#=GS X4YZW3_HBV/1-352      AC X4YZW3.1
#=GS H9XRC6_HBV/1-91       AC H9XRC6.1
#=GS K4PWY8_HBV/1-81       AC K4PWY8.1
#=GS B4ZYV6_HBV/1-341      AC B4ZYV6.1
#=GS H6UNB6_HBV/1-341      AC H6UNB6.1
#=GS E5CZ70_HBV/1-352      AC E5CZ70.1
#=GS G9G963_HBV/1-341      AC G9G963.1
#=GS X4YRC2_HBV/1-352      AC X4YRC2.1
#=GS C7AYU7_HBV/1-354      AC C7AYU7.1
#=GS Q80J72_HBV/1-352      AC Q80J72.1
#=GS I0DGG0_HBV/1-352      AC I0DGG0.1
#=GS H3K3N4_HBV/1-352      AC H3K3N4.1
#=GS B0FCC9_HBV/1-352      AC B0FCC9.1
#=GS B5TY02_HBV/1-352      AC B5TY02.1
#=GS M4QBJ3_HBV/1-171      AC M4QBJ3.1
#=GS A5JHW4_HBV/1-112      AC A5JHW4.1
#=GS F5C0I1_HBV/1-341      AC F5C0I1.1
#=GS B5BPR9_HBV/1-352      AC B5BPR9.1
#=GS S5ZS78_HBV/1-332      AC S5ZS78.1
#=GS M1G277_9HEPA/78-305   AC M1G277.1
#=GS I7KJK0_HBV/1-354      AC I7KJK0.1
#=GS U3RJU1_HBV/1-218      AC U3RJU1.1
#=GS A5JIB9_HBV/1-112      AC A5JIB9.1
#=GS I0DGF9_HBV/1-352      AC I0DGF9.1
#=GS B2LWA2_HBV/1-196      AC B2LWA2.1
#=GS I0C881_HBV/1-354      AC I0C881.1
#=GS G1E7J1_HBV/1-341      AC G1E7J1.1
#=GS D2X3V8_HBV/96-130     AC D2X3V8.1
#=GS I0C8F9_HBV/1-354      AC I0C8F9.1
#=GS I0DG92_HBV/1-352      AC I0DG92.1
#=GS G3E587_HBV/1-341      AC G3E587.1
#=GS D0E625_HBV/1-352      AC D0E625.1
#=GS B9VK39_HBV/1-352      AC B9VK39.1
#=GS D0E6B8_HBV/1-352      AC D0E6B8.1
#=GS S5ZSH0_HBV/1-332      AC S5ZSH0.1
#=GS S5ZFE8_HBV/1-341      AC S5ZFE8.1
#=GS Q7T4V7_HBV/1-341      AC Q7T4V7.1
#=GS D7NL15_HBV/1-341      AC D7NL15.1
#=GS DPOL_HPBDW/60-347     AC P17193.1
#=GS L7R6W8_HBV/1-341      AC L7R6W8.1
#=GS D2JMT7_HBV/1-352      AC D2JMT7.1
#=GS L8B2N3_HBV/1-341      AC L8B2N3.1
#=GS X4YHQ0_HBV/1-352      AC X4YHQ0.1
#=GS D3YGA7_HBV/1-341      AC D3YGA7.1
#=GS S6B554_HBV/1-354      AC S6B554.1
#=GS Q80H00_HBV/1-352      AC Q80H00.1
#=GS I4CJS2_HBV/1-172      AC I4CJS2.1
#=GS G4XI07_HBV/1-160      AC G4XI07.1
#=GS G4XMI3_HBV/1-352      AC G4XMI3.1
#=GS B7TVA0_HBV/1-352      AC B7TVA0.1
#=GS B5ATA9_HBV/1-346      AC B5ATA9.1
#=GS C3W439_HBV/1-341      AC C3W439.1
#=GS A4F2U8_HBV/1-352      AC A4F2U8.1
#=GS I0C8H3_HBV/1-354      AC I0C8H3.1
#=GS Q9YL91_HBV/1-352      AC Q9YL91.1
#=GS S5ZLL6_HBV/1-337      AC S5ZLL6.1
#=GS M9PM95_HBV/1-49       AC M9PM95.1
#=GS F5C166_HBV/1-354      AC F5C166.1
#=GS F5C0I5_HBV/1-341      AC F5C0I5.1
#=GS B3VLG0_HBV/1-176      AC B3VLG0.1
#=GS B5U710_HBV/1-341      AC B5U710.1
#=GS B5TF73_HBV/1-112      AC B5TF73.1
#=GS C3W4G2_HBV/1-341      AC C3W4G2.1
#=GS S5ZTQ9_HBV/1-341      AC S5ZTQ9.1
#=GS D5LDP8_HBV/1-352      AC D5LDP8.1
#=GS E5RPX7_HBV/1-343      AC E5RPX7.1
#=GS A5LGC2_HBV/1-352      AC A5LGC2.1
#=GS C1K163_HBV/1-352      AC C1K163.1
#=GS Q4FDJ8_HBV/1-352      AC Q4FDJ8.1
#=GS L0BE19_HBV/1-210      AC L0BE19.1
#=GS C3W4B2_HBV/1-341      AC C3W4B2.1
#=GS D3TKB0_HBV/1-352      AC D3TKB0.1
#=GS Q81112_HBV/1-49       AC Q81112.1
#=GS F5C119_HBV/1-284      AC F5C119.1
#=GS D5MSI3_HBV/1-343      AC D5MSI3.1
#=GS B9VK98_HBV/1-352      AC B9VK98.1
#=GS I0DD09_HBV/1-317      AC I0DD09.1
#=GS Q80BT5_HBV/1-303      AC Q80BT5.1
#=GS E9L2T0_HBV/1-171      AC E9L2T0.1
#=GS D5LEY3_HBV/1-352      AC D5LEY3.1
#=GS B7TTV0_HBV/1-352      AC B7TTV0.1
#=GS X4Z081_HBV/236-291    AC X4Z081.1
#=GS D3TIP3_HBV/1-349      AC D3TIP3.1
#=GS G1E7Q2_HBV/1-341      AC G1E7Q2.1
#=GS Q9E6U2_HBV/1-352      AC Q9E6U2.1
#=GS W0SPJ6_HBV/1-352      AC W0SPJ6.1
#=GS L7R810_HBV/1-341      AC L7R810.1
#=GS L0BDB7_HBV/1-210      AC L0BDB7.1
#=GS Q58VZ7_HBV/1-352      AC Q58VZ7.1
#=GS C7DMK6_HBV/1-351      AC C7DMK6.1
#=GS K7QGU1_HBV/1-352      AC K7QGU1.1
#=GS F5C151_HBV/1-53       AC F5C151.1
#=GS S6BWE4_HBV/1-352      AC S6BWE4.1
#=GS O91516_HBV/1-352      AC O91516.1
#=GS D3YGL6_HBV/1-341      AC D3YGL6.1
#=GS Q4FDG3_HBV/1-352      AC Q4FDG3.1
#=GS A8R7F6_HBV/1-352      AC A8R7F6.1
#=GS H3K3I6_HBV/1-354      AC H3K3I6.1
#=GS C6F4E1_HBV/1-354      AC C6F4E1.1
#=GS C7DMQ1_HBV/1-303      AC C7DMQ1.1
#=GS R9Q848_HBV/1-114      AC R9Q848.1
#=GS S6A707_HBV/1-337      AC S6A707.1
#=GS S5ZFV0_HBV/1-335      AC S5ZFV0.1
#=GS B5B4N7_HBV/1-352      AC B5B4N7.1
#=GS C1K1H0_HBV/1-352      AC C1K1H0.1
#=GS C7DN36_HBV/1-351      AC C7DN36.1
#=GS Q20BS9_HBV/1-52       AC Q20BS9.1
#=GS U3KUE3_HBV/1-171      AC U3KUE3.1
#=GS F1CFB6_HBV/1-341      AC F1CFB6.1
#=GS W8PA40_HBV/1-354      AC W8PA40.1
#=GS C1K1L5_HBV/274-323    AC C1K1L5.1
#=GS H9XRF0_HBV/1-91       AC H9XRF0.1
#=GS C1K1L0_HBV/1-238      AC C1K1L0.1
#=GS B5M5W8_HBV/1-352      AC B5M5W8.1
#=GS A5JIA3_HBV/1-112      AC A5JIA3.1
#=GS I0C8C7_HBV/1-354      AC I0C8C7.1
#=GS Q2LCD2_HBV/1-333      AC Q2LCD2.1
#=GS S5ZSX3_HBV/1-336      AC S5ZSX3.1
#=GS I0C8T1_HBV/1-341      AC I0C8T1.1
#=GS I0DC55_HBV/1-317      AC I0DC55.1
#=GS M9PN18_HBV/1-248      AC M9PN18.1
#=GS B7TTJ4_HBV/1-352      AC B7TTJ4.1
#=GS H9XQQ2_HBV/1-91       AC H9XQQ2.1
#=GS H9XR94_HBV/1-91       AC H9XR94.1
#=GS B9VK63_HBV/1-352      AC B9VK63.1
#=GS S5ZKL2_HBV/1-341      AC S5ZKL2.1
#=GS Q8B464_HBV/17-108     AC Q8B464.1
#=GS D0EE40_HBV/1-354      AC D0EE40.1
#=GS L8B293_HBV/1-341      AC L8B293.1
#=GS D2JMK1_HBV/1-352      AC D2JMK1.1
#=GS D3TK17_HBV/1-352      AC D3TK17.1
#=GS D0UE63_HBV/1-341      AC D0UE63.1
#=GS C3W4F0_HBV/1-341      AC C3W4F0.1
#=GS I0C951_HBV/1-354      AC I0C951.1
#=GS A8J498_HBV/1-352      AC A8J498.1
#=GS U3RGX4_HBV/1-218      AC U3RGX4.1
#=GS K4PYM5_HBV/1-81       AC K4PYM5.1
#=GS Q918J2_HBV/1-343      AC Q918J2.1
#=GS D0UE31_HBV/1-352      AC D0UE31.1
#=GS R9Q7V5_HBV/1-114      AC R9Q7V5.1
#=GS A5GZK7_HBV/1-352      AC A5GZK7.1
#=GS Q2LCC0_HBV/1-341      AC Q2LCC0.1
#=GS B7TU63_HBV/1-352      AC B7TU63.1
#=GS W6IBE7_HBV/1-315      AC W6IBE7.1
#=GS D6QVR7_HBV/1-352      AC D6QVR7.1
#=GS Q2EX74_HBV/1-345      AC Q2EX74.1
#=GS L7R9D8_HBV/1-352      AC L7R9D8.1
#=GS W6HYA5_HBV/1-315      AC W6HYA5.1
#=GS I0C988_HBV/1-351      AC I0C988.1
#=GS C3W4J4_HBV/1-341      AC C3W4J4.1
#=GS G9G984_HBV/240-291    AC G9G984.1
#=GS H6UGQ6_HBV/1-341      AC H6UGQ6.1
#=GS B4Y4H7_HBV/1-352      AC B4Y4H7.1
#=GS E9L2Q5_HBV/1-171      AC E9L2Q5.1
#=GS C7DMT2_HBV/1-351      AC C7DMT2.1
#=GS D9U5L4_HBV/1-352      AC D9U5L4.1
#=GS E5F0V6_HBV/1-49       AC E5F0V6.1
#=GS D0E6C5_HBV/1-352      AC D0E6C5.1
#=GS B0YGK6_HBV/1-341      AC B0YGK6.1
#=GS Q80J92_HBV/1-352      AC Q80J92.1
#=GS I0C8Q0_HBV/224-280    AC I0C8Q0.1
#=GS D5LFI5_HBV/1-352      AC D5LFI5.1
#=GS G3XGZ8_HBV/1-343      AC G3XGZ8.1
#=GS G9G8J8_HBV/1-341      AC G9G8J8.1
#=GS I0C8E9_HBV/1-354      AC I0C8E9.1
#=GS B5BPP9_HBV/1-352      AC B5BPP9.1
#=GS Q5KR27_HBV/1-352      AC Q5KR27.1
#=GS D6QW32_HBV/1-246      AC D6QW32.1
#=GS I0DD83_HBV/1-328      AC I0DD83.1
#=GS I0C922_HBV/1-354      AC I0C922.1
#=GS S5ZZM2_HBV/1-352      AC S5ZZM2.1
#=GS F5C1E1_HBV/1-341      AC F5C1E1.1
#=GS Q9IXD2_HBV/1-52       AC Q9IXD2.1
#=GS L7R9F1_HBV/1-341      AC L7R9F1.1
#=GS B7TU76_HBV/1-352      AC B7TU76.1
#=GS B0FD46_HBV/1-352      AC B0FD46.1
#=GS Q8B4F8_HBV/259-304    AC Q8B4F8.1
#=GS D2U622_HBV/1-346      AC D2U622.1
#=GS G9G8T0_HBV/1-335      AC G9G8T0.2
#=GS X4Z097_HBV/1-352      AC X4Z097.1
#=GS B7TUG9_HBV/1-334      AC B7TUG9.1
#=GS C7DNC4_HBV/1-348      AC C7DNC4.1
#=GS K0FCA5_HBV/1-352      AC K0FCA5.1
#=GS L0HBW1_HBV/1-352      AC L0HBW1.1
#=GS S5ZL22_HBV/1-337      AC S5ZL22.1
#=GS S6A043_HBV/1-340      AC S6A043.1
#=GS H6UGP4_HBV/1-341      AC H6UGP4.1
#=GS H6UN52_HBV/1-341      AC H6UN52.1
#=GS F5C0R3_HBV/1-351      AC F5C0R3.1
#=GS A1YTM2_HBV/1-352      AC A1YTM2.1
#=GS Q68RR3_HBV/1-352      AC Q68RR3.1
#=GS F5C7K4_HBV/1-352      AC F5C7K4.1
#=GS S5ZEI2_HBV/1-332      AC S5ZEI2.1
#=GS A3F6H7_HBV/1-354      AC A3F6H7.1
#=GS B9VL68_HBV/1-341      AC B9VL68.1
#=GS D0E5B7_HBV/1-352      AC D0E5B7.1
#=GS X4YZV2_HBV/1-352      AC X4YZV2.1
#=GS U3KUB9_HBV/1-171      AC U3KUB9.1
#=GS B9W411_HBV/1-354      AC B9W411.1
#=GS G4XI53_HBV/1-160      AC G4XI53.1
#=GS A0A024F8C5_HBV/1-352  AC A0A024F8C5.1
#=GS B0FCW3_HBV/1-352      AC B0FCW3.1
#=GS I0C9E1_HBV/1-334      AC I0C9E1.1
#=GS B5BPT5_HBV/1-352      AC B5BPT5.1
#=GS B5AST1_HBV/1-352      AC B5AST1.1
#=GS A5JHT2_HBV/1-112      AC A5JHT2.1
#=GS S5ZLX3_HBV/1-341      AC S5ZLX3.1
#=GS U3REL4_HBV/1-221      AC U3REL4.1
#=GS E9L5B4_HBV/1-352      AC E9L5B4.1
#=GS G4XHZ2_HBV/1-160      AC G4XHZ2.1
#=GS Q45V29_HBV/1-341      AC Q45V29.1
#=GS D2K7P1_HBV/1-77       AC D2K7P1.1
#=GS B5TY08_HBV/1-352      AC B5TY08.1
#=GS M4QJ78_HBV/1-171      AC M4QJ78.1
#=GS C7DN04_HBV/1-351      AC C7DN04.1
#=GS L7R776_HBV/1-341      AC L7R776.1
#=GS F5C1P9_HBV/1-341      AC F5C1P9.1
#=GS F5C167_HBV/1-354      AC F5C167.1
#=GS F5C0H7_HBV/1-341      AC F5C0H7.1
#=GS B6VA73_HBV/1-352      AC B6VA73.1
#=GS C7AY84_HBV/1-354      AC C7AY84.1
#=GS I0C946_HBV/1-354      AC I0C946.1
#=GS D0E6I4_HBV/1-352      AC D0E6I4.1
#=GS Q77BH2_HBV/1-167      AC Q77BH2.1
#=GS I0C9H0_HBV/1-352      AC I0C9H0.1
#=GS G8DC36_HBV/1-352      AC G8DC36.1
#=GS O09513_HBV/1-212      AC O09513.1
#=GS F5C163_HBV/1-75       AC F5C163.1
#=GS D2U662_HBV/1-351      AC D2U662.1
#=GS G1C8G9_HBV/1-341      AC G1C8G9.1
#=GS F5C0S2_HBV/1-333      AC F5C0S2.1
#=GS U3RCF9_HBV/1-218      AC U3RCF9.1
#=GS U5K852_HBV/3-52       AC U5K852.1
#=GS Q4FDD5_HBV/1-352      AC Q4FDD5.1
#=GS L7R7F0_HBV/1-341      AC L7R7F0.1
#=GS S6A6Y2_HBV/1-337      AC S6A6Y2.1
#=GS E7FK73_HBV/1-352      AC E7FK73.1
#=GS L7X2F1_HBV/1-354      AC L7X2F1.1
#=GS S5ZJX9_HBV/1-332      AC S5ZJX9.1
#=GS H9XRM8_HBV/1-91       AC H9XRM8.1
#=GS D3K2D2_HBV/1-352      AC D3K2D2.1
#=GS M4QIU4_HBV/1-171      AC M4QIU4.1
#=GS Q4FDK2_HBV/1-352      AC Q4FDK2.1
#=GS K9MDL4_HBV/1-24       AC K9MDL4.1
#=GS B5M528_HBV/1-343      AC B5M528.1
#=GS S5ZKH5_HBV/1-326      AC S5ZKH5.1
#=GS Q7T7W6_HBV/1-343      AC Q7T7W6.1
#=GS D3TII1_HBV/1-352      AC D3TII1.1
#=GS Q8V0M9_HBV/1-352      AC Q8V0M9.1
#=GS B5TFK1_HBV/1-112      AC B5TFK1.1
#=GS I0DE48_HBV/1-328      AC I0DE48.1
#=GS O09511_HBV/212-310    AC O09511.1
#=GS B0FCE0_HBV/1-352      AC B0FCE0.1
#=GS I0C882_HBV/1-354      AC I0C882.1
#=GS Q00K48_HBV/1-352      AC Q00K48.1
#=GS D0E621_HBV/1-352      AC D0E621.1
#=GS Q7TDR3_HBV/1-352      AC Q7TDR3.1
#=GS A0A023NLM0_HBV/1-341  AC A0A023NLM0.1
#=GS S5ZZL5_HBV/1-325      AC S5ZZL5.1
#=GS D0E5G9_HBV/1-352      AC D0E5G9.1
#=GS H9XQS1_HBV/1-91       AC H9XQS1.1
#=GS A5JIH9_HBV/1-112      AC A5JIH9.1
#=GS I0DD76_HBV/1-328      AC I0DD76.1
#=GS I0C943_HBV/1-354      AC I0C943.1
#=GS I0DGG1_HBV/1-352      AC I0DGG1.1
#=GS I0DDW6_HBV/1-328      AC I0DDW6.1
#=GS I0DGF3_HBV/1-352      AC I0DGF3.1
#=GS I0C8U0_HBV/1-354      AC I0C8U0.1
#=GS R4P333_HBV/1-352      AC R4P333.1
#=GS H9XRS2_HBV/1-91       AC H9XRS2.1
#=GS A5JI21_HBV/1-112      AC A5JI21.1
#=GS Q8JXA7_HBV/1-352      AC Q8JXA7.1
#=GS I0DD86_HBV/1-328      AC I0DD86.1
#=GS B4YL04_HBV/1-341      AC B4YL04.1
#=GS Q5KR11_HBV/1-352      AC Q5KR11.1
#=GS U3KUF3_HBV/1-171      AC U3KUF3.1
#=GS O91547_HBV/1-352      AC O91547.1
#=GS B5BPW7_HBV/1-339      AC B5BPW7.1
#=GS S6A6U9_HBV/1-352      AC S6A6U9.1
#=GS D0UDW4_HBV/1-352      AC D0UDW4.1
#=GS C5WJU2_HBV/1-352      AC C5WJU2.1
#=GS Q2LCE4_HBV/1-333      AC Q2LCE4.1
#=GS Q97975_HBV/1-49       AC Q97975.1
#=GS D0E5M8_HBV/1-352      AC D0E5M8.1
#=GS D0UE87_HBV/1-352      AC D0UE87.1
#=GS R9Q808_HBV/1-114      AC R9Q808.1
#=GS F5C195_HBV/1-354      AC F5C195.1
#=GS E5RPU3_HBV/1-343      AC E5RPU3.1
#=GS K7QGB0_HBV/1-352      AC K7QGB0.1
#=GS C7DSJ2_HBV/1-341      AC C7DSJ2.1
#=GS I1VGT2_HBV/1-164      AC I1VGT2.1
#=GS I0DCT2_HBV/1-327      AC I0DCT2.1
#=GS Q50JU5_HBV/1-352      AC Q50JU5.1
#=GS G4XI03_HBV/1-160      AC G4XI03.1
#=GS Q461B6_HBV/1-351      AC Q461B6.1
#=GS U3RC61_HBV/1-218      AC U3RC61.1
#=GS M9PNG4_HBV/1-252      AC M9PNG4.1
#=GS W8P7B8_HBV/1-352      AC W8P7B8.1
#=GS B5M634_HBV/1-352      AC B5M634.1
#=GS I0C8D5_HBV/1-354      AC I0C8D5.1
#=GS U5K7A1_HBV/3-50       AC U5K7A1.1
#=GS G4XI69_HBV/1-160      AC G4XI69.1
#=GS L0H7U6_HBV/1-352      AC L0H7U6.1
#=GS F5C157_HBV/1-354      AC F5C157.1
#=GS B2LRV6_HBV/1-352      AC B2LRV6.1
#=GS W6HZP8_HBV/1-315      AC W6HZP8.1
#=GS A5LG46_HBV/1-352      AC A5LG46.1
#=GS B5AT25_HBV/1-352      AC B5AT25.1
#=GS D9U553_HBV/1-352      AC D9U553.1
#=GS Q8V1H4_HBV/1-275      AC Q8V1H4.1
#=GS S6A6X3_HBV/1-350      AC S6A6X3.1
#=GS F5C0J4_HBV/1-341      AC F5C0J4.1
#=GS Q20BT7_HBV/1-57       AC Q20BT7.1
#=GS C6F507_HBV/1-354      AC C6F507.1
#=GS K9MDK6_HBV/1-24       AC K9MDK6.1
#=GS S5ZZI8_HBV/1-329      AC S5ZZI8.1
#=GS S5ZKK3_HBV/1-336      AC S5ZKK3.1
#=GS G9G9B8_HBV/1-341      AC G9G9B8.1
#=GS B7TUS4_HBV/1-352      AC B7TUS4.1
#=GS F5C0I4_HBV/1-341      AC F5C0I4.1
#=GS A7J8K4_HBV/1-336      AC A7J8K4.1
#=GS G1C8J7_HBV/1-341      AC G1C8J7.1
#=GS F5C176_HBV/1-354      AC F5C176.1
#=GS U3KUC6_HBV/1-171      AC U3KUC6.1
#=GS D2X580_HBV/7-172      AC D2X580.1
#=GS H3K3M1_HBV/1-352      AC H3K3M1.1
#=GS K9MC27_HBV/1-24       AC K9MC27.1
#=GS Q2LCD6_HBV/1-333      AC Q2LCD6.1
#=GS Q5R2R9_HBV/1-341      AC Q5R2R9.1
#=GS S5ZF79_HBV/1-334      AC S5ZF79.1
#=GS B0FCY4_HBV/1-352      AC B0FCY4.1
#=GS R4P308_HBV/1-352      AC R4P308.1
#=GS D0EEA0_HBV/1-354      AC D0EEA0.1
#=GS D5LED3_HBV/1-352      AC D5LED3.1
#=GS S5ZZZ5_HBV/1-340      AC S5ZZZ5.1
#=GS T2HTN4_HBV/1-50       AC T2HTN4.1
#=GS I0DC62_HBV/1-328      AC I0DC62.1
#=GS B5TFA1_HBV/1-112      AC B5TFA1.1
#=GS L7R9N0_HBV/1-341      AC L7R9N0.1
#=GS B5M5I3_HBV/1-352      AC B5M5I3.1
#=GS B3VLH8_HBV/1-176      AC B3VLH8.1
#=GS D2N0Z2_HBV/1-354      AC D2N0Z2.1
#=GS D5LEV5_HBV/1-352      AC D5LEV5.1
#=GS Q91EI6_HBV/1-354      AC Q91EI6.1
#=GS S6A6S1_HBV/1-337      AC S6A6S1.1
#=GS A5GZJ4_HBV/1-352      AC A5GZJ4.1
#=GS Q9YL94_HBV/1-352      AC Q9YL94.1
#=GS Q6W5D0_HBV/1-352      AC Q6W5D0.1
#=GS B5MEW1_HBV/1-337      AC B5MEW1.1
#=GS B5M5C1_HBV/1-352      AC B5M5C1.1
#=GS K9MD14_HBV/1-24       AC K9MD14.1
#=GS L7R797_HBV/1-341      AC L7R797.1
#=GS Q9WP68_HBV/302-333    AC Q9WP68.1
#=GS H6WFJ7_HBV/1-112      AC H6WFJ7.1
#=GS C9WDG7_HBV/1-341      AC C9WDG7.1
#=GS B5BUS5_HBV/1-354      AC B5BUS5.1
#=GS Q20BZ4_HBV/1-55       AC Q20BZ4.1
#=GS Q4KRC8_HBV/1-354      AC Q4KRC8.1
#=GS S5ZF01_HBV/1-340      AC S5ZF01.1
#=GS B0YGH8_HBV/1-341      AC B0YGH8.1
#=GS S5ZEZ1_HBV/1-318      AC S5ZEZ1.1
#=GS D7NL02_HBV/1-341      AC D7NL02.1
#=GS S5ZKZ5_HBV/1-342      AC S5ZKZ5.1
#=GS B9VL13_HBV/1-352      AC B9VL13.1
#=GS B5U703_HBV/1-341      AC B5U703.1
#=GS B9VJZ3_HBV/1-352      AC B9VJZ3.1
#=GS F5C0M0_HBV/1-354      AC F5C0M0.1
#=GS E5RPN5_HBV/1-341      AC E5RPN5.1
#=GS R9Q8U1_HBV/1-114      AC R9Q8U1.1
#=GS W8PB15_HBV/1-352      AC W8PB15.1
#=GS K0F4T9_HBV/1-352      AC K0F4T9.1
#=GS I0C8D8_HBV/1-354      AC I0C8D8.1
#=GS Q9QN54_HBV/1-352      AC Q9QN54.1
#=GS A0A023NLP9_HBV/1-341  AC A0A023NLP9.1
#=GS Q20BZ0_HBV/1-47       AC Q20BZ0.1
#=GS E5CZ21_HBV/1-352      AC E5CZ21.1
#=GS R9Q8H3_HBV/1-114      AC R9Q8H3.1
#=GS B9VKF2_HBV/1-352      AC B9VKF2.1
#=GS B9W403_HBV/1-354      AC B9W403.1
#=GS Q8V1F0_HBV/1-354      AC Q8V1F0.1
#=GS S5ZLA4_HBV/1-337      AC S5ZLA4.1
#=GS Q5EDN8_HBV/1-341      AC Q5EDN8.1
#=GS B5ASN2_HBV/1-352      AC B5ASN2.1
#=GS A7M684_HBV/1-352      AC A7M684.1
#=GS H6WFJ8_HBV/1-112      AC H6WFJ8.1
#=GS D5LE20_HBV/1-352      AC D5LE20.1
#=GS H9XSY7_HBV/38-69      AC H9XSY7.1
#=GS Q7T7X9_HBV/1-341      AC Q7T7X9.1
#=GS S5ZLW8_HBV/165-302    AC S5ZLW8.1
#=GS B9VKL1_HBV/1-352      AC B9VKL1.1
#=GS Q6XGI5_HBV/1-341      AC Q6XGI5.1
#=GS I0DGE4_HBV/1-352      AC I0DGE4.1
#=GS B7TTU3_HBV/1-352      AC B7TTU3.1
#=GS S5ZLF2_HBV/1-339      AC S5ZLF2.1
#=GS S5ZLM8_HBV/1-340      AC S5ZLM8.1
#=GS M4QBI1_HBV/1-171      AC M4QBI1.1
#=GS B5M4Z0_HBV/1-352      AC B5M4Z0.1
#=GS H2ERA3_HBV/1-342      AC H2ERA3.1
#=GS I0DGF8_HBV/1-352      AC I0DGF8.1
#=GS B3V8U9_HBV/1-346      AC B3V8U9.1
#=GS D0EEF8_HBV/1-354      AC D0EEF8.1
#=GS E3Q0K7_HBV/1-352      AC E3Q0K7.1
#=GS L7R890_HBV/1-341      AC L7R890.1
#=GS H3K3R9_HBV/1-354      AC H3K3R9.1
#=GS G3E5C2_HBV/1-341      AC G3E5C2.1
#=GS A6MFX3_HBV/1-352      AC A6MFX3.1
#=GS X4ZDA8_HBV/1-352      AC X4ZDA8.1
#=GS H6V5R8_HBV/1-352      AC H6V5R8.1
#=GS D3YG95_HBV/1-341      AC D3YG95.1
#=GS E1U7N9_HBV/1-341      AC E1U7N9.1
#=GS G4XMQ1_HBV/1-352      AC G4XMQ1.1
#=GS DPOL_HBVC1/1-352      AC P0C688.1
#=GS S5ZEN0_HBV/1-332      AC S5ZEN0.1
#=GS G9G9L5_HBV/1-341      AC G9G9L5.1
#=GS D9U5J4_HBV/1-352      AC D9U5J4.1
#=GS A5JHV6_HBV/1-112      AC A5JHV6.1
#=GS D7NL22_HBV/1-341      AC D7NL22.1
#=GS R9Q8F9_HBV/1-114      AC R9Q8F9.1
#=GS S5ZSJ4_HBV/1-341      AC S5ZSJ4.1
#=GS Q68RS2_HBV/1-352      AC Q68RS2.1
#=GS C1K1L5_HBV/1-276      AC C1K1L5.1
#=GS B5TXW0_HBV/1-352      AC B5TXW0.1
#=GS B9VL48_HBV/1-352      AC B9VL48.1
#=GS D3YG33_HBV/1-341      AC D3YG33.1
#=GS D7NKZ5_HBV/1-341      AC D7NKZ5.1
#=GS E5F0Y5_HBV/1-49       AC E5F0Y5.1
#=GS D3TIF6_HBV/1-284      AC D3TIF6.1
#=GS F5C123_HBV/1-354      AC F5C123.1
#=GS Q4FDH1_HBV/1-352      AC Q4FDH1.1
#=GS H6WF82_HBV/1-112      AC H6WF82.1
#=GS A5JIQ4_HBV/1-112      AC A5JIQ4.1
#=GS G1E807_HBV/1-341      AC G1E807.1
#=GS M4Q890_HBV/1-171      AC M4Q890.1
#=GS I0C8K4_HBV/1-350      AC I0C8K4.1
#=GS S5ZZV8_HBV/1-338      AC S5ZZV8.1
#=GS Q8B463_HBV/17-108     AC Q8B463.1
#=GS Q4FD87_HBV/1-352      AC Q4FD87.1
#=GS DPOL_HBVD1/1-341      AC P03155.1
#=GS S5ZZV2_HBV/1-341      AC S5ZZV2.1
#=GS B3V8V4_HBV/1-341      AC B3V8V4.1
#=GS I7LSR2_HBV/1-354      AC I7LSR2.1
#=GS D6QVE8_HBV/1-351      AC D6QVE8.1
#=GS I0DCG7_HBV/1-328      AC I0DCG7.1
#=GS B5M587_HBV/1-352      AC B5M587.1
#=GS V5JE46_HBV/1-342      AC V5JE46.1
#=GS F5C0Y2_HBV/1-354      AC F5C0Y2.1
#=GS B4YTA2_HBV/1-352      AC B4YTA2.1
#=GS B3V3R5_HBV/1-352      AC B3V3R5.1
#=GS A5JIB1_HBV/1-101      AC A5JIB1.1
#=GS B5M606_HBV/1-352      AC B5M606.1
#=GS D0E5N1_HBV/1-352      AC D0E5N1.1
#=GS B5TFF3_HBV/1-112      AC B5TFF3.1
#=GS L7R6S0_HBV/1-352      AC L7R6S0.1
#=GS C3W4E4_HBV/1-341      AC C3W4E4.1
#=GS H9XQN3_HBV/1-91       AC H9XQN3.1
#=GS I0C8E4_HBV/1-354      AC I0C8E4.1
#=GS Q8V1H4_HBV/273-304    AC Q8V1H4.1
#=GS U3RC51_HBV/1-218      AC U3RC51.1
#=GS Q9YKJ8_HBV/1-352      AC Q9YKJ8.1
#=GS E5F0V1_HBV/1-49       AC E5F0V1.1
#=GS I0DCI7_HBV/1-328      AC I0DCI7.1
#=GS D3GIJ3_HBV/1-352      AC D3GIJ3.1
#=GS Q9QMN7_HBV/1-352      AC Q9QMN7.2
#=GS Q9IX69_HBV/1-52       AC Q9IX69.1
#=GS L7R7B5_HBV/1-341      AC L7R7B5.1
#=GS E0ZRK7_HBV/1-351      AC E0ZRK7.1
#=GS B0FCX7_HBV/1-352      AC B0FCX7.1
#=GS D3YGL0_HBV/1-341      AC D3YGL0.1
#=GS G3XH14_HBV/1-332      AC G3XH14.1
#=GS Q9E9B4_HBV/1-352      AC Q9E9B4.1
#=GS I0C8N1_HBV/1-335      AC I0C8N1.1
#=GS K0FBL9_HBV/1-352      AC K0FBL9.1
#=GS D6R3W5_HBV/1-352      AC D6R3W5.1
#=GS I0C8F6_HBV/1-354      AC I0C8F6.1
#=GS D5LDX9_HBV/1-352      AC D5LDX9.1
#=GS Q0PMM8_HBV/1-354      AC Q0PMM8.1
#=GS B4YKX6_HBV/1-341      AC B4YKX6.1
#=GS B7TU82_HBV/1-344      AC B7TU82.1
#=GS E5RD61_HBV/1-352      AC E5RD61.1
#=GS I7LRB8_HBV/1-351      AC I7LRB8.1
#=GS D5MSH5_HBV/1-343      AC D5MSH5.1
#=GS Q4JQH4_HBV/1-354      AC Q4JQH4.1
#=GS D0QP39_HBV/1-352      AC D0QP39.2
#=GS D5LFA5_HBV/1-352      AC D5LFA5.1
#=GS B9VK55_HBV/1-352      AC B9VK55.1
#=GS H9XQV2_HBV/1-91       AC H9XQV2.1
#=GS S5ZEZ5_HBV/1-352      AC S5ZEZ5.1
#=GS A6MG32_HBV/1-352      AC A6MG32.1
#=GS B5M671_HBV/1-341      AC B5M671.1
#=GS Q9QMM9_HBV/1-352      AC Q9QMM9.1
#=GS L0HC98_HBV/1-324      AC L0HC98.1
#=GS D9U590_HBV/1-176      AC D9U590.1
#=GS I0C8D1_HBV/1-354      AC I0C8D1.1
#=GS I0C8Y9_HBV/1-354      AC I0C8Y9.1
#=GS A8J4C6_HBV/1-354      AC A8J4C6.1
#=GS Q4KR79_HBV/1-354      AC Q4KR79.1
#=GS B5B4H6_HBV/236-291    AC B5B4H6.1
#=GS D3TIK4_HBV/1-352      AC D3TIK4.1
#=GS Q3HM64_HBV/1-350      AC Q3HM64.1
#=GS C6F5A4_HBV/1-354      AC C6F5A4.1
#=GS B9VKY5_HBV/1-352      AC B9VKY5.1
#=GS B5TF77_HBV/1-112      AC B5TF77.1
#=GS T1YSZ1_HBV/1-352      AC T1YSZ1.1
#=GS B0FD74_HBV/1-346      AC B0FD74.1
#=GS H9XRV3_HBV/1-91       AC H9XRV3.1
#=GS B9VKV9_HBV/1-341      AC B9VKV9.1
#=GS B9VJX0_HBV/1-238      AC B9VJX0.1
#=GS G1E8C6_HBV/1-341      AC G1E8C6.1
#=GS D5LBR8_HBV/1-352      AC D5LBR8.1
#=GS L0BE72_HBV/1-210      AC L0BE72.1
#=GS B2LXP0_HBV/1-352      AC B2LXP0.1
#=GS Q2PWW5_HBV/1-354      AC Q2PWW5.1
#=GS D0E6B0_HBV/1-352      AC D0E6B0.1
#=GS S6A701_HBV/1-350      AC S6A701.1
#=GS H6UN01_HBV/1-341      AC H6UN01.1
#=GS C3W3Q1_HBV/1-341      AC C3W3Q1.1
#=GS Q67913_HBV/1-341      AC Q67913.1
#=GS F5C0U2_HBV/1-351      AC F5C0U2.1
#=GS I0C8A5_HBV/1-354      AC I0C8A5.1
#=GS B0FD17_HBV/1-346      AC B0FD17.1
#=GS I0DGA2_HBV/1-352      AC I0DGA2.1
#=GS R9Q7Z1_HBV/1-114      AC R9Q7Z1.1
#=GS Q20BZ2_HBV/1-57       AC Q20BZ2.1
#=GS I0DDP0_HBV/1-328      AC I0DDP0.1
#=GS D3XGC6_HBV/1-352      AC D3XGC6.1
#=GS B5BPR1_HBV/1-352      AC B5BPR1.1
#=GS Q9QAW4_HBV/1-341      AC Q9QAW4.1
#=GS B5M571_HBV/1-352      AC B5M571.1
#=GS D2U606_HBV/1-346      AC D2U606.1
#=GS T1YUD4_HBV/1-352      AC T1YUD4.1
#=GS I0C8K5_HBV/1-350      AC I0C8K5.1
#=GS B7TV14_HBV/1-352      AC B7TV14.1
#=GS I0C861_HBV/1-354      AC I0C861.1
#=GS D0EDQ8_HBV/1-341      AC D0EDQ8.1
#=GS S5ZDU3_HBV/1-332      AC S5ZDU3.1
#=GS B9VK51_HBV/1-352      AC B9VK51.1
#=GS D3TK62_HBV/1-352      AC D3TK62.1
#=GS F5C0I3_HBV/1-341      AC F5C0I3.1
#=GS H9XQF0_HBV/1-91       AC H9XQF0.1
#=GS I0DDN2_HBV/1-317      AC I0DDN2.1
#=GS C7DMS5_HBV/1-351      AC C7DMS5.1
#=GS B9VAY5_HBV/269-325    AC B9VAY5.1
#=GS D9U1M9_HBV/1-352      AC D9U1M9.1
#=GS I0DCN4_HBV/1-328      AC I0DCN4.1
#=GS I0DGH0_HBV/1-352      AC I0DGH0.1
#=GS Q69590_HBV/1-49       AC Q69590.1
#=GS B7TTK1_HBV/1-341      AC B7TTK1.1
#=GS Q7T457_9HEPA/5-388    AC Q7T457.1
#=GS C7AY51_HBV/1-354      AC C7AY51.1
#=GS B4YL24_HBV/1-341      AC B4YL24.1
#=GS J7IGX4_HBV/1-341      AC J7IGX4.1
#=GS U3REP8_HBV/1-218      AC U3REP8.1
#=GS O09511_HBV/1-214      AC O09511.1
#=GS E5F0X1_HBV/1-49       AC E5F0X1.1
#=GS Q9QAC4_HBV/1-352      AC Q9QAC4.1
#=GS B5M4Y5_HBV/1-352      AC B5M4Y5.1
#=GS Q9IXB7_HBV/1-52       AC Q9IXB7.1
#=GS W8NZY5_HBV/1-352      AC W8NZY5.1
#=GS Q9YZT9_HBV/1-346      AC Q9YZT9.1
#=GS A4GUD9_HBV/42-121     AC A4GUD9.1
#=GS T2HS35_HBV/1-50       AC T2HS35.1
#=GS I0C902_HBV/1-354      AC I0C902.1
#=GS Q4R1S3_HBV/1-354      AC Q4R1S3.1
#=GS F5C0S5_HBV/1-333      AC F5C0S5.1
#=GS L7X7D9_HBV/1-354      AC L7X7D9.1
#=GS S5ZSE7_HBV/1-340      AC S5ZSE7.1
#=GS S5ZL51_HBV/1-341      AC S5ZL51.1
#=GS DPOL_HBVE2/1-351      AC Q80IU7.1
#=GS I0C8Z0_HBV/1-354      AC I0C8Z0.1
#=GS S5ZLU3_HBV/1-341      AC S5ZLU3.1
#=GS L0HBM8_HBV/1-301      AC L0HBM8.1
#=GS B5A2F7_HBV/1-352      AC B5A2F7.1
#=GS H3K3G5_HBV/1-354      AC H3K3G5.1
#=GS I7LSS4_HBV/1-341      AC I7LSS4.2
#=GS I0DGF5_HBV/1-352      AC I0DGF5.1
#=GS B5TY11_HBV/1-352      AC B5TY11.1
#=GS Q4FD99_HBV/1-352      AC Q4FD99.1
#=GS F5C0Q7_HBV/1-351      AC F5C0Q7.1
#=GS R9Q800_HBV/1-114      AC R9Q800.1
#=GS L0BCD2_HBV/1-210      AC L0BCD2.1
#=GS X2G4U3_HBV/1-350      AC X2G4U3.1
#=GS L0HBY7_HBV/1-352      AC L0HBY7.1
#=GS B5M603_HBV/1-352      AC B5M603.1
#=GS C9WDA1_HBV/1-341      AC C9WDA1.1
#=GS S5ZTA6_HBV/1-342      AC S5ZTA6.1
#=GS E9L2I5_HBV/1-171      AC E9L2I5.1
#=GS I0DGH4_HBV/1-352      AC I0DGH4.1
#=GS W6HYD6_HBV/1-315      AC W6HYD6.1
#=GS J7ID92_HBV/1-354      AC J7ID92.1
#=GS X4ZDE1_HBV/1-352      AC X4ZDE1.1
#=GS D0EEJ0_HBV/1-354      AC D0EEJ0.1
#=GS E0D3A9_HBV/1-352      AC E0D3A9.1
#=GS B5A2J0_HBV/1-352      AC B5A2J0.1
#=GS B5AT90_HBV/1-352      AC B5AT90.1
#=GS Q68RQ9_HBV/1-352      AC Q68RQ9.1
#=GS H6V5P8_HBV/1-341      AC H6V5P8.1
#=GS G1C8V7_HBV/1-341      AC G1C8V7.1
#=GS F5C1I0_HBV/1-341      AC F5C1I0.1
#=GS F5C139_HBV/1-354      AC F5C139.1
#=GS L0HAN2_HBV/1-333      AC L0HAN2.1
#=GS Q5SDK1_HBV/1-346      AC Q5SDK1.1
#=GS B7TV70_HBV/1-352      AC B7TV70.1
#=GS B5B4E3_HBV/1-352      AC B5B4E3.1
#=GS B7TTW8_HBV/1-352      AC B7TTW8.1
#=GS Q20BR1_HBV/1-57       AC Q20BR1.1
#=GS B7TTS5_HBV/1-352      AC B7TTS5.1
#=GS Q404F4_HBV/1-341      AC Q404F4.1
#=GS D2X530_HBV/3-171      AC D2X530.1
#=GS J7IF72_HBV/1-352      AC J7IF72.1
#=GS I0DDP4_HBV/1-328      AC I0DDP4.1
#=GS B9W3Z9_HBV/1-354      AC B9W3Z9.1
#=GS B3VLK2_HBV/1-165      AC B3VLK2.1
#=GS L0HBQ0_HBV/1-345      AC L0HBQ0.1
#=GS S5ZFM3_HBV/1-340      AC S5ZFM3.1
#=GS I0C8J1_HBV/1-350      AC I0C8J1.1
#=GS L7R9M1_HBV/1-347      AC L7R9M1.1
#=GS U3RCC9_HBV/1-218      AC U3RCC9.1
#=GS W6HVV5_HBV/1-315      AC W6HVV5.1
#=GS B5M5U1_HBV/1-352      AC B5M5U1.1
#=GS Q4AC37_HBV/1-352      AC Q4AC37.1
#=GS E5F0W8_HBV/1-49       AC E5F0W8.1
#=GS M1FSW5_HBV/1-352      AC M1FSW5.1
#=GS K0FBQ1_HBV/1-352      AC K0FBQ1.1
#=GS D0VXH3_HBV/1-352      AC D0VXH3.1
#=GS H6V5H6_HBV/1-352      AC H6V5H6.1
#=GS G4XMD1_HBV/1-341      AC G4XMD1.1
#=GS Q404E6_HBV/1-341      AC Q404E6.1
#=GS B7TTY2_HBV/1-352      AC B7TTY2.1
#=GS A5JHX2_HBV/1-112      AC A5JHX2.1
#=GS D5LFE0_HBV/1-352      AC D5LFE0.1
#=GS B9VKX9_HBV/1-352      AC B9VKX9.1
#=GS K7QGB5_HBV/1-352      AC K7QGB5.1
#=GS E5RD77_HBV/1-352      AC E5RD77.1
#=GS A4F517_HBV/235-311    AC A4F517.1
#=GS I0C8Y3_HBV/1-354      AC I0C8Y3.1
#=GS A7YET2_HBV/1-352      AC A7YET2.1
#=GS B5BUR7_HBV/1-354      AC B5BUR7.1
#=GS C7DMT9_HBV/1-351      AC C7DMT9.1
#=GS I0C8P5_HBV/1-341      AC I0C8P5.1
#=GS G9M9Q9_HBV/1-352      AC G9M9Q9.1
#=GS D3XGE1_HBV/1-352      AC D3XGE1.1
#=GS I0DGB0_HBV/1-352      AC I0DGB0.1
#=GS I0DD68_HBV/1-328      AC I0DD68.1
#=GS D5LEG8_HBV/1-352      AC D5LEG8.1
#=GS B6CIZ5_HBV/1-354      AC B6CIZ5.1
#=GS E0ZRF4_HBV/1-351      AC E0ZRF4.1
#=GS C6F5D2_HBV/1-354      AC C6F5D2.1
#=GS S5ZEJ7_HBV/1-341      AC S5ZEJ7.1
#=GS S5ZZJ8_HBV/1-340      AC S5ZZJ8.1
#=GS C1K1T4_HBV/1-352      AC C1K1T4.1
#=GS A9PLI9_HBV/3-43       AC A9PLI9.1
#=GS X4YRJ6_HBV/1-352      AC X4YRJ6.1
#=GS L7R8X9_HBV/1-341      AC L7R8X9.1
#=GS E5RPM3_HBV/1-352      AC E5RPM3.1
#=GS C7DNH5_HBV/1-347      AC C7DNH5.1
#=GS B5M5M1_HBV/1-352      AC B5M5M1.1
#=GS B5BUT6_HBV/1-354      AC B5BUT6.1
#=GS L7R7R6_HBV/1-352      AC L7R7R6.1
#=GS B5ATD7_HBV/270-318    AC B5ATD7.1
#=GS G3E5C9_HBV/1-341      AC G3E5C9.1
#=GS G4XI17_HBV/1-160      AC G4XI17.1
#=GS G4XI73_HBV/1-160      AC G4XI73.1
#=GS Q8B4F8_HBV/1-264      AC Q8B4F8.1
#=GS D0UDM9_HBV/1-352      AC D0UDM9.1
#=GS B5M5S1_HBV/1-352      AC B5M5S1.1
#=GS G9HNR3_HBV/1-159      AC G9HNR3.1
#=GS U3RJX8_HBV/1-218      AC U3RJX8.1
#=GS H9XSZ1_HBV/1-89       AC H9XSZ1.1
#=GS T2HS17_HBV/1-50       AC T2HS17.1
#=GS C3W3U2_HBV/1-341      AC C3W3U2.1
#=GS D5LCF9_HBV/1-352      AC D5LCF9.1
#=GS E9L2H3_HBV/1-171      AC E9L2H3.1
#=GS E0ZRG0_HBV/1-351      AC E0ZRG0.1
#=GS I0DGB3_HBV/1-352      AC I0DGB3.1
#=GS J7H013_HBV/1-152      AC J7H013.1
#=GS F5C0N6_HBV/1-354      AC F5C0N6.1
#=GS E0ZRR1_HBV/1-351      AC E0ZRR1.1
#=GS F5C075_HBV/1-352      AC F5C075.1
#=GS M4QA57_HBV/1-91       AC M4QA57.1
#=GS G1E7J7_HBV/1-341      AC G1E7J7.1
#=GS S5ZZP4_HBV/1-332      AC S5ZZP4.1
#=GS D0UE82_HBV/1-346      AC D0UE82.1
#=GS E5F0X5_HBV/1-49       AC E5F0X5.1
#=GS T1WNC6_HBV/1-341      AC T1WNC6.1
#=GS L0BE12_HBV/1-210      AC L0BE12.1
#=GS B2Y6Z5_HBV/1-341      AC B2Y6Z5.1
#=GS S5N105_HBV/1-352      AC S5N105.1
#=GS S5ZT98_HBV/1-341      AC S5ZT98.1
#=GS G3XH06_HBV/1-343      AC G3XH06.1
#=GS H1ZN40_HBV/1-341      AC H1ZN40.1
#=GS C5WK10_HBV/1-352      AC C5WK10.1
#=GS C1K1H7_HBV/1-352      AC C1K1H7.1
#=GS H9XRR0_HBV/1-91       AC H9XRR0.1
#=GS S5ZSC3_HBV/1-340      AC S5ZSC3.1
#=GS L8AYQ6_HBV/1-341      AC L8AYQ6.1
#=GS C7AYT5_HBV/1-354      AC C7AYT5.2
#=GS T1YU77_HBV/1-352      AC T1YU77.1
#=GS F5C0Q3_HBV/1-347      AC F5C0Q3.1
#=GS D2U5Z8_HBV/1-351      AC D2U5Z8.1
#=GS G1E828_HBV/1-341      AC G1E828.1
#=GS C9WDC5_HBV/1-341      AC C9WDC5.1
#=GS J7IJJ9_HBV/1-352      AC J7IJJ9.1
#=GS L0BCC1_HBV/1-210      AC L0BCC1.1
#=GS L0BC91_HBV/1-210      AC L0BC91.1
#=GS S5ZS87_HBV/1-340      AC S5ZS87.1
#=GS D0EE35_HBV/1-354      AC D0EE35.1
#=GS Q9WFB2_9HEPA/62-343   AC Q9WFB2.1
#=GS S5ZZR7_HBV/1-340      AC S5ZZR7.1
#=GS O39666_HBV/1-352      AC O39666.1
#=GS C1K174_HBV/1-352      AC C1K174.1
#=GS B5BUU4_HBV/1-354      AC B5BUU4.1
#=GS I0C8Z5_HBV/1-354      AC I0C8Z5.1
#=GS I0DG90_HBV/1-352      AC I0DG90.1
#=GS H9XR58_HBV/1-91       AC H9XR58.1
#=GS X2G9P5_HBV/1-351      AC X2G9P5.1
#=GS I7L968_HBV/1-341      AC I7L968.1
#=GS R4P3B3_HBV/1-352      AC R4P3B3.1
#=GS R9Q8G0_HBV/1-114      AC R9Q8G0.1
#=GS Q8BCB4_HBV/1-354      AC Q8BCB4.1
#=GS B9VKF6_HBV/1-352      AC B9VKF6.1
#=GS R9Q830_HBV/1-114      AC R9Q830.1
#=GS D0E5S9_HBV/1-352      AC D0E5S9.1
#=GS B2CFG3_HBV/1-274      AC B2CFG3.1
#=GS Q5DVZ0_HBV/1-341      AC Q5DVZ0.1
#=GS I0C8Q4_HBV/1-341      AC I0C8Q4.1
#=GS Q97976_HBV/1-49       AC Q97976.1
#=GS S6A6Y0_HBV/1-341      AC S6A6Y0.1
#=GS Q2EIE3_HBV/1-352      AC Q2EIE3.1
#=GS K0FBJ4_HBV/1-352      AC K0FBJ4.1
#=GS Q91S85_HBV/1-221      AC Q91S85.1
#=GS D2JMF6_HBV/1-352      AC D2JMF6.1
#=GS Q3ZKQ7_HBV/1-354      AC Q3ZKQ7.1
#=GS I7KJH9_HBV/1-354      AC I7KJH9.1
#=GS D0E606_HBV/1-352      AC D0E606.1
#=GS Q4FDJ0_HBV/1-352      AC Q4FDJ0.1
#=GS C6F521_HBV/1-354      AC C6F521.1
#=GS L0H7Q8_HBV/1-352      AC L0H7Q8.1
#=GS DPOL_HBVB6/1-352      AC Q67925.1
#=GS B4YKR4_HBV/1-354      AC B4YKR4.1
#=GS I7JHS7_HBV/1-341      AC I7JHS7.1
#=GS F5C147_HBV/1-354      AC F5C147.1
#=GS S6A0B2_HBV/1-340      AC S6A0B2.1
#=GS X4YZX4_HBV/1-352      AC X4YZX4.1
#=GS W6HWG9_HBV/1-315      AC W6HWG9.1
#=GS G9G9G6_HBV/1-341      AC G9G9G6.1
#=GS D0EEG5_HBV/1-354      AC D0EEG5.1
#=GS F5C165_HBV/1-354      AC F5C165.1
#=GS I0C8X0_HBV/1-354      AC I0C8X0.1
#=GS G3GDN7_HBV/1-352      AC G3GDN7.1
#=GS S5ZFH5_HBV/1-335      AC S5ZFH5.1
#=GS D9U5H6_HBV/1-352      AC D9U5H6.1
#=GS M4Q7T7_HBV/1-171      AC M4Q7T7.1
#=GS S5ZSR1_HBV/1-319      AC S5ZSR1.1
#=GS B9VK59_HBV/1-352      AC B9VK59.1
#=GS D6R6U2_HBV/1-352      AC D6R6U2.1
#=GS L7R9C6_HBV/1-341      AC L7R9C6.1
#=GS I0C884_HBV/1-354      AC I0C884.1
#=GS I7JHW2_HBV/1-351      AC I7JHW2.1
#=GS DPOL_HBVC4/1-352      AC P31870.1
#=GS W6HVW0_HBV/1-315      AC W6HVW0.1
#=GS Q91C50_HBV/1-347      AC Q91C50.1
#=GS B2CS99_HBV/1-341      AC B2CS99.1
#=GS B3IWV5_HBV/1-352      AC B3IWV5.1
#=GS E5RD69_HBV/1-352      AC E5RD69.1
#=GS B0FCZ1_HBV/1-352      AC B0FCZ1.1
#=GS B5M5S4_HBV/1-285      AC B5M5S4.1
#=GS B5BPP1_HBV/1-352      AC B5BPP1.1
#=GS Q2LCA8_HBV/1-341      AC Q2LCA8.1
#=GS S5ZLJ6_HBV/1-340      AC S5ZLJ6.1
#=GS Q09GP2_HBV/1-352      AC Q09GP2.1
#=GS A9PLI4_HBV/1-43       AC A9PLI4.1
#=GS S5ZEE6_HBV/1-336      AC S5ZEE6.1
#=GS C9WDD1_HBV/1-341      AC C9WDD1.1
#=GS H9XRU5_HBV/1-91       AC H9XRU5.1
#=GS I0C9B8_HBV/1-334      AC I0C9B8.1
#=GS B5BPM5_HBV/1-352      AC B5BPM5.1
#=GS B7TUN0_HBV/1-352      AC B7TUN0.1
#=GS W8PAM7_HBV/1-352      AC W8PAM7.1
#=GS I4CJT1_HBV/1-30       AC I4CJT1.1
#=GS I0DGF1_HBV/1-352      AC I0DGF1.1
#=GS B1ABP9_HBV/1-352      AC B1ABP9.1
#=GS H6WFB4_HBV/1-112      AC H6WFB4.1
#=GS I0C8R7_HBV/1-227      AC I0C8R7.1
#=GS R4NV76_HBV/1-352      AC R4NV76.1
#=GS A5LG90_HBV/1-344      AC A5LG90.1
#=GS B2CZU2_HBV/1-352      AC B2CZU2.1
#=GS Q2F4Z3_HBV/1-348      AC Q2F4Z3.1
#=GS B5ATD7_HBV/1-275      AC B5ATD7.1
#=GS R9Q8N3_HBV/1-114      AC R9Q8N3.1
#=GS Q6RSE2_9HEPA/70-395   AC Q6RSE2.1
#=GS B9VKG0_HBV/1-352      AC B9VKG0.1
#=GS B0FCU2_HBV/1-352      AC B0FCU2.1
#=GS S5ZZZ4_HBV/1-341      AC S5ZZZ4.1
#=GS K9MC14_HBV/1-24       AC K9MC14.1
#=GS F5C0T5_HBV/1-351      AC F5C0T5.1
#=GS G9G9V7_HBV/1-330      AC G9G9V7.1
#=GS Q9IX78_HBV/1-52       AC Q9IX78.1
#=GS R9Q865_HBV/1-114      AC R9Q865.1
#=GS L0BEF1_HBV/1-210      AC L0BEF1.1
#=GS K9MXP0_HBV/1-352      AC K9MXP0.1
#=GS G3GDP4_HBV/1-352      AC G3GDP4.1
#=GS Q8JXG0_HBV/1-352      AC Q8JXG0.1
#=GS B5BUU8_HBV/1-354      AC B5BUU8.1
#=GS Q6R6I9_HBV/1-352      AC Q6R6I9.1
#=GS B2LRV0_HBV/1-352      AC B2LRV0.1
#=GS Q67948_HBV/1-341      AC Q67948.1
#=GS D0VXJ3_HBV/1-352      AC D0VXJ3.1
#=GS B5TXR8_HBV/1-352      AC B5TXR8.1
#=GS H9XRD8_HBV/1-91       AC H9XRD8.1
#=GS D2JMN6_HBV/1-352      AC D2JMN6.1
#=GS U5JJL4_HBV/102-142    AC U5JJL4.1
#=GS L7PDK9_HBV/1-352      AC L7PDK9.1
#=GS B5M609_HBV/1-341      AC B5M609.1
#=GS W8PRX6_HBV/1-352      AC W8PRX6.1
#=GS L7R8Q0_HBV/1-352      AC L7R8Q0.1
#=GS G4XMI7_HBV/1-352      AC G4XMI7.1
#=GS Q67856_HBV/1-305      AC Q67856.1
#=GS S6A0A7_HBV/1-336      AC S6A0A7.1
#=GS B5ATB9_HBV/270-318    AC B5ATB9.1
#=GS X4YS04_HBV/1-352      AC X4YS04.1
#=GS D5LBD0_HBV/1-352      AC D5LBD0.1
#=GS B5BPQ7_HBV/1-352      AC B5BPQ7.1
#=GS A9QPY7_HBV/1-351      AC A9QPY7.1
#=GS Q8QZP4_HBV/262-306    AC Q8QZP4.1
#=GS I0C8N5_HBV/224-280    AC I0C8N5.1
#=GS S5ZT44_HBV/1-339      AC S5ZT44.1
#=GS H6WFL7_HBV/1-112      AC H6WFL7.1
#=GS Q9IR26_HBV/1-174      AC Q9IR26.1
#=GS B4YKN7_HBV/1-354      AC B4YKN7.1
#=GS Q5UAY3_HBV/1-352      AC Q5UAY3.1
#=GS Q20BR7_HBV/1-56       AC Q20BR7.1
#=GS B3V8U4_HBV/290-321    AC B3V8U4.1
#=GS Q5DVY2_HBV/1-341      AC Q5DVY2.1
#=GS B5M563_HBV/1-352      AC B5M563.1
#=GS F5C0T8_HBV/1-351      AC F5C0T8.1
#=GS C6F4T1_HBV/1-354      AC C6F4T1.1
#=GS Q4KR86_HBV/1-354      AC Q4KR86.1
#=GS C7G2Z3_HBV/1-352      AC C7G2Z3.1
#=GS F5C0J8_HBV/1-354      AC F5C0J8.1
#=GS M4QAB0_HBV/1-171      AC M4QAB0.1
#=GS M4QAG1_HBV/1-171      AC M4QAG1.1
#=GS H6UN88_HBV/1-340      AC H6UN88.1
#=GS Q99HV4_HBV/1-352      AC Q99HV4.1
#=GS L8B1U0_HBV/1-249      AC L8B1U0.1
#=GS S5ZF19_HBV/1-350      AC S5ZF19.1
#=GS Q8B4B0_HBV/1-341      AC Q8B4B0.1
#=GS X4YYA4_HBV/1-352      AC X4YYA4.1
#=GS L8AYS8_HBV/1-341      AC L8AYS8.1
#=GS I0C8C5_HBV/1-354      AC I0C8C5.1
#=GS S5ZTJ1_HBV/1-336      AC S5ZTJ1.1
#=GS D3TIJ3_HBV/1-352      AC D3TIJ3.1
#=GS Q4FDJ4_HBV/1-352      AC Q4FDJ4.1
#=GS X4YSL5_HBV/1-352      AC X4YSL5.1
#=GS B0FCK5_HBV/1-352      AC B0FCK5.1
#=GS H9N871_HBV/1-341      AC H9N871.1
#=GS A8CEJ6_HBV/1-352      AC A8CEJ6.1
#=GS C7DNK8_HBV/1-351      AC C7DNK8.1
#=GS R9Q8E5_HBV/1-114      AC R9Q8E5.1
#=GS I0C8U1_HBV/1-354      AC I0C8U1.1
#=GS R9Q7R5_HBV/1-114      AC R9Q7R5.1
#=GS G3XH28_HBV/1-332      AC G3XH28.1
#=GS S5ZTG3_HBV/1-337      AC S5ZTG3.1
#=GS O91554_HBV/1-352      AC O91554.1
#=GS F5C150_HBV/1-354      AC F5C150.1
#=GS D2JMC6_HBV/1-352      AC D2JMC6.1
#=GS Q67895_HBV/1-354      AC Q67895.1
#=GS Q1PD12_HBV/1-352      AC Q1PD12.1
#=GS Q8B4H4_HBV/1-354      AC Q8B4H4.1
#=GS B0YK40_HBV/1-352      AC B0YK40.1
#=GS I0C869_HBV/1-354      AC I0C869.1
#=GS T2HRM1_HBV/1-50       AC T2HRM1.1
#=GS T2HR77_HBV/1-50       AC T2HR77.1
#=GS E9L2L4_HBV/1-171      AC E9L2L4.1
#=GS B7TUX8_HBV/1-352      AC B7TUX8.1
#=GS G4XI57_HBV/1-160      AC G4XI57.1
#=GS I7L989_HBV/1-341      AC I7L989.1
#=GS H6UN37_HBV/1-341      AC H6UN37.1
#=GS M4QJ41_HBV/1-171      AC M4QJ41.1
#=GS I7LRB0_HBV/1-353      AC I7LRB0.1
#=GS Q2MLQ8_HBV/1-341      AC Q2MLQ8.1
#=GS F5C7M5_HBV/1-352      AC F5C7M5.1
#=GS K4PWA9_HBV/1-162      AC K4PWA9.1
#=GS X4ZE57_HBV/1-352      AC X4ZE57.1
#=GS Q80MR4_HBV/1-352      AC Q80MR4.1
#=GS D3TK96_HBV/1-352      AC D3TK96.1
#=GS B5B492_HBV/1-238      AC B5B492.1
#=GS I0DDY2_HBV/1-328      AC I0DDY2.1
#=GS E5RD41_HBV/1-352      AC E5RD41.1
#=GS Q80IL1_HBV/1-351      AC Q80IL1.1
#=GS Q76B37_HBV/1-352      AC Q76B37.1
#=GS G9G9V0_HBV/1-341      AC G9G9V0.1
#=GS S6A711_HBV/1-341      AC S6A711.1
#=GS Q5U7S1_HBV/1-341      AC Q5U7S1.1
#=GS Q6UBL0_HBV/1-354      AC Q6UBL0.1
#=GS M4Q7X7_HBV/1-171      AC M4Q7X7.1
#=GS Q8UYE3_HBV/1-352      AC Q8UYE3.1
#=GS H6WFE2_HBV/1-112      AC H6WFE2.1
#=GS J7H358_HBV/1-152      AC J7H358.1
#=GS I0DGI7_HBV/1-352      AC I0DGI7.1
#=GS C1K1S1_HBV/1-352      AC C1K1S1.1
#=GS G9HNQ8_HBV/1-159      AC G9HNQ8.1
#=GS K0FBB0_HBV/1-352      AC K0FBB0.1
#=GS I0DDQ7_HBV/1-328      AC I0DDQ7.1
#=GS C5WK18_HBV/1-352      AC C5WK18.1
#=GS B2CY23_HBV/1-352      AC B2CY23.1
#=GS Q6XGJ2_HBV/1-341      AC Q6XGJ2.1
#=GS S6A6S2_HBV/1-340      AC S6A6S2.1
#=GS Q4FD61_HBV/1-352      AC Q4FD61.1
#=GS X4Z134_HBV/1-352      AC X4Z134.1
#=GS Q80H36_HBV/1-352      AC Q80H36.1
#=GS K7QGD1_HBV/1-352      AC K7QGD1.1
#=GS I7JHV0_HBV/1-340      AC I7JHV0.2
#=GS H9XQG2_HBV/1-91       AC H9XQG2.1
#=GS S5ZS29_HBV/1-336      AC S5ZS29.1
#=GS A7L365_HBV/1-30       AC A7L365.1
#=GS B5TFI5_HBV/1-112      AC B5TFI5.1
#=GS DPOL_HBVD3/1-341      AC P03156.1
#=GS Q8JJT5_HBV/1-352      AC Q8JJT5.1
#=GS Q9IX93_HBV/1-52       AC Q9IX93.1
#=GS W6IBG3_HBV/1-315      AC W6IBG3.1
#=GS I0DGE5_HBV/1-352      AC I0DGE5.1
#=GS E5RPN9_HBV/1-341      AC E5RPN9.1
#=GS Q9WDD4_HBV/1-52       AC Q9WDD4.1
#=GS I0C8X1_HBV/1-354      AC I0C8X1.1
#=GS E8Z623_HBV/1-352      AC E8Z623.1
#=GS G1E7Q9_HBV/217-316    AC G1E7Q9.1
#=GS Q8B4H8_HBV/1-354      AC Q8B4H8.1
#=GS D3TJD5_HBV/218-305    AC D3TJD5.1
#=GS H9XR78_HBV/1-91       AC H9XR78.1
#=GS Q1T7D9_HBV/1-341      AC Q1T7D9.1
#=GS H9XSY7_HBV/1-40       AC H9XSY7.1
#=GS Q9IX84_HBV/1-52       AC Q9IX84.1
#=GS B5M5B0_HBV/236-291    AC B5M5B0.1
#=GS Q67907_HBV/1-49       AC Q67907.1
#=GS Q9IXD8_HBV/1-52       AC Q9IXD8.1
#=GS E3Q0H5_HBV/1-352      AC E3Q0H5.1
#=GS D5LC48_HBV/1-352      AC D5LC48.1
#=GS A8J456_HBV/1-352      AC A8J456.1
#=GS R4NTR0_HBV/1-352      AC R4NTR0.1
#=GS S5ZTH0_HBV/1-341      AC S5ZTH0.1
#=GS L0BE94_HBV/1-210      AC L0BE94.1
#=GS H9XR22_HBV/1-91       AC H9XR22.1
#=GS B9VL09_HBV/1-352      AC B9VL09.1
#=GS Q5DVZ4_HBV/1-352      AC Q5DVZ4.1
#=GS Q0PML7_HBV/1-352      AC Q0PML7.1
#=GS L0BC98_HBV/1-210      AC L0BC98.1
#=GS G1C8M4_HBV/1-338      AC G1C8M4.1
#=GS B5ATE6_HBV/274-305    AC B5ATE6.1
#=GS D0E5G1_HBV/1-352      AC D0E5G1.1
#=GS I0DGD0_HBV/1-352      AC I0DGD0.1
#=GS B1ABM2_HBV/1-238      AC B1ABM2.1
#=GS Q1JUS6_HBV/1-334      AC Q1JUS6.1
#=GS G1E8E0_HBV/1-341      AC G1E8E0.1
#=GS Q2LCA4_HBV/1-341      AC Q2LCA4.1
#=GS H2ERF1_HBV/1-352      AC H2ERF1.1
#=GS D3TIL0_HBV/1-286      AC D3TIL0.1
#=GS Q2LC98_HBV/1-341      AC Q2LC98.1
#=GS C9WDJ3_HBV/1-352      AC C9WDJ3.1
#=GS Q5UFS2_HBV/1-341      AC Q5UFS2.1
#=GS B0YK32_HBV/1-354      AC B0YK32.1
#=GS I0DDG6_HBV/1-328      AC I0DDG6.1
#=GS L8B1X6_HBV/1-227      AC L8B1X6.1
#=GS A1Z0N2_HBV/1-352      AC A1Z0N2.1
#=GS Q5U7T3_HBV/1-341      AC Q5U7T3.1
#=GS S5NEV1_HBV/1-351      AC S5NEV1.1
#=GS I0C8R4_HBV/1-227      AC I0C8R4.1
#=GS B2LWD0_HBV/1-287      AC B2LWD0.1
#=GS R9Q8B8_HBV/1-114      AC R9Q8B8.1
#=GS S6A6Z6_HBV/1-334      AC S6A6Z6.1
#=GS Q2LCE8_HBV/1-341      AC Q2LCE8.1
#=GS S5ZTR8_HBV/1-341      AC S5ZTR8.1
#=GS B9VKP9_HBV/1-352      AC B9VKP9.1
#=GS DPOL_HBVC7/1-352      AC Q913A7.1
#=GS D0EEN1_HBV/1-354      AC D0EEN1.1
#=GS K7QGV5_HBV/1-352      AC K7QGV5.1
#=GS Q20C08_HBV/1-42       AC Q20C08.1
#=GS C7DN89_HBV/1-351      AC C7DN89.1
#=GS G4XI39_HBV/1-160      AC G4XI39.1
#=GS B0FD53_HBV/1-352      AC B0FD53.1
#=GS I0DCE3_HBV/1-328      AC I0DCE3.1
#=GS S5ZKE8_HBV/1-334      AC S5ZKE8.1
#=GS S6A724_HBV/1-334      AC S6A724.1
#=GS B9VKP2_HBV/1-352      AC B9VKP2.1
#=GS I0C9G8_HBV/1-338      AC I0C9G8.1
#=GS W6HVV2_HBV/1-315      AC W6HVV2.1
#=GS I0C8V7_HBV/1-354      AC I0C8V7.1
#=GS I0DGA1_HBV/1-352      AC I0DGA1.1
#=GS R9Q7Z9_HBV/1-114      AC R9Q7Z9.1
#=GS A8J4G8_HBV/1-352      AC A8J4G8.1
#=GS D2X4V8_HBV/4-171      AC D2X4V8.1
#=GS B5M653_HBV/1-352      AC B5M653.1
#=GS D6QW45_HBV/1-352      AC D6QW45.1
#=GS R9Q889_HBV/1-114      AC R9Q889.1
#=GS C1K1B2_HBV/1-352      AC C1K1B2.1
#=GS X4Z038_HBV/1-352      AC X4Z038.1
#=GS H6UG94_HBV/1-341      AC H6UG94.1
#=GS A0MMM0_HBV/1-352      AC A0MMM0.1
#=GS L0BCF9_HBV/1-210      AC L0BCF9.1
#=GS Q8B4F6_HBV/1-260      AC Q8B4F6.1
#=GS E9L2N7_HBV/1-171      AC E9L2N7.1
#=GS Q8B5Q3_HBV/1-190      AC Q8B5Q3.1
#=GS S6A6T1_HBV/1-336      AC S6A6T1.1
#=GS H9XRL6_HBV/1-91       AC H9XRL6.1
#=GS B6DXD3_HBV/1-304      AC B6DXD3.1
#=GS E3Q0I2_HBV/1-352      AC E3Q0I2.1
#=GS B7TTL5_HBV/1-352      AC B7TTL5.1
#=GS H1ACX6_HBV/1-352      AC H1ACX6.1
#=GS F1AEU6_HBV/1-354      AC F1AEU6.1
#=GS B5M5M8_HBV/1-352      AC B5M5M8.1
#=GS F5C115_HBV/281-320    AC F5C115.1
#=GS B5BPK5_HBV/1-352      AC B5BPK5.1
#=GS B0YK59_HBV/1-352      AC B0YK59.1
#=GS S5ZT51_HBV/1-352      AC S5ZT51.1
#=GS B5M659_HBV/1-352      AC B5M659.1
#=GS D5LCW4_HBV/1-352      AC D5LCW4.1
#=GS X4ZER9_HBV/1-352      AC X4ZER9.1
#=GS S5ZFA4_HBV/1-337      AC S5ZFA4.1
#=GS Q9IX63_HBV/1-52       AC Q9IX63.1
#=GS Q2ABZ8_HBV/1-352      AC Q2ABZ8.1
#=GS H9XRJ2_HBV/1-91       AC H9XRJ2.1
#=GS Q9YPV7_HBV/1-341      AC Q9YPV7.1
#=GS D3TJW9_HBV/1-352      AC D3TJW9.1
#=GS G4XMJ9_HBV/1-352      AC G4XMJ9.1
#=GS T1YU87_HBV/1-352      AC T1YU87.1
#=GS F5C0W3_HBV/1-354      AC F5C0W3.1
#=GS R4P3E2_HBV/1-352      AC R4P3E2.1
#=GS Q4FD53_HBV/1-352      AC Q4FD53.1
#=GS I0DDY6_HBV/1-176      AC I0DDY6.1
#=GS B5U8G8_HBV/37-98      AC B5U8G8.1
#=GS D0E5E3_HBV/1-341      AC D0E5E3.1
#=GS Q9WP51_HBV/1-214      AC Q9WP51.1
#=GS D2JMC1_HBV/1-352      AC D2JMC1.1
#=GS Q5KR31_HBV/1-352      AC Q5KR31.1
#=GS DPOL_HBVCP/1-341      AC P12900.1
#=GS S5ZKH0_HBV/1-337      AC S5ZKH0.1
#=GS D9U5E8_HBV/1-352      AC D9U5E8.1
#=GS W6HZM8_HBV/1-315      AC W6HZM8.1
#=GS H9XQU8_HBV/1-91       AC H9XQU8.1
#=GS C3W3R2_HBV/1-341      AC C3W3R2.1
#=GS B5MEV7_HBV/1-352      AC B5MEV7.1
#=GS Q66400_9HEPA/102-277  AC Q66400.1
#=GS S5ZK81_HBV/1-352      AC S5ZK81.1
#=GS L0H9M6_HBV/1-351      AC L0H9M6.1
#=GS I0DGI1_HBV/1-352      AC I0DGI1.1
#=GS D2X3V8_HBV/1-98       AC D2X3V8.1
#=GS B4YKW3_HBV/1-341      AC B4YKW3.1
#=GS B4Y7D6_HBV/1-352      AC B4Y7D6.2
#=GS I0C9A9_HBV/1-341      AC I0C9A9.1
#=GS Q80GZ4_HBV/1-352      AC Q80GZ4.1
#=GS S5ZS64_HBV/1-333      AC S5ZS64.1
#=GS S5ZE56_HBV/236-291    AC S5ZE56.1
#=GS F5C168_HBV/1-354      AC F5C168.1
#=GS I0C8D2_HBV/1-354      AC I0C8D2.1
#=GS Q5R2P0_HBV/1-341      AC Q5R2P0.1
#=GS K7QGB9_HBV/1-352      AC K7QGB9.1
#=GS D2JMZ8_HBV/1-350      AC D2JMZ8.1
#=GS R9Q829_HBV/1-114      AC R9Q829.1
#=GS X4ZEV1_HBV/1-352      AC X4ZEV1.1
#=GS I0DGG3_HBV/1-352      AC I0DGG3.1
#=GS D7NKY9_HBV/1-341      AC D7NKY9.1
#=GS B5TFD7_HBV/1-112      AC B5TFD7.1
#=GS J7KFA3_HBV/1-88       AC J7KFA3.1
#=GS K9MCB4_HBV/1-24       AC K9MCB4.1
#=GS E5RDA5_HBV/1-341      AC E5RDA5.1
#=GS Q918N4_9HEPA/6-393    AC Q918N4.1
#=GS H9XQJ6_HBV/1-91       AC H9XQJ6.1
#=GS F5C1A1_HBV/1-354      AC F5C1A1.1
#=GS D2JMP1_HBV/1-352      AC D2JMP1.1
#=GS M9PMV5_HBV/1-49       AC M9PMV5.1
#=GS D3TK56_HBV/1-352      AC D3TK56.1
#=GS O91541_HBV/1-352      AC O91541.1
#=GS W6JG49_HBV/1-351      AC W6JG49.1
#=GS D2JN10_HBV/157-221    AC D2JN10.1
#=GS I3XMN9_HBV/1-354      AC I3XMN9.1
#=GS I0DCA9_HBV/1-328      AC I0DCA9.1
#=GS G3XLB1_HBV/1-352      AC G3XLB1.1
#=GS S6A6X9_HBV/281-324    AC S6A6X9.1
#=GS F1AEQ8_HBV/1-354      AC F1AEQ8.1
#=GS F5C152_HBV/1-354      AC F5C152.1
#=GS G4XI95_HBV/1-160      AC G4XI95.1
#=GS S5ZFG5_HBV/1-335      AC S5ZFG5.1
#=GS A9CM49_HBV/1-352      AC A9CM49.1
#=GS E5RPY3_HBV/1-343      AC E5RPY3.1
#=GS B2CXY9_HBV/1-352      AC B2CXY9.1
#=GS I0C8A7_HBV/1-354      AC I0C8A7.1
#=GS D0EYZ8_HBV/1-341      AC D0EYZ8.1
#=GS Q20C02_HBV/1-55       AC Q20C02.1
#=GS S5ZK70_HBV/1-324      AC S5ZK70.1
#=GS H6UN17_HBV/1-341      AC H6UN17.1
#=GS S5ZSF8_HBV/1-340      AC S5ZSF8.1
#=GS S6A700_HBV/1-341      AC S6A700.1
#=GS B3VLK8_HBV/1-176      AC B3VLK8.1
#=GS S5ZFK3_HBV/1-336      AC S5ZFK3.1
#=GS I1UYW3_HBV/1-166      AC I1UYW3.1
#=GS Q5KR16_HBV/1-352      AC Q5KR16.1
#=GS B3VLM2_HBV/1-176      AC B3VLM2.1
#=GS Q5Q0Z2_HBV/1-341      AC Q5Q0Z2.1
#=GS F5C0Y6_HBV/1-354      AC F5C0Y6.1
#=GS B4YLI8_HBV/1-341      AC B4YLI8.1
#=GS Q8BCB9_HBV/1-354      AC Q8BCB9.1
#=GS S6A6Y3_HBV/1-336      AC S6A6Y3.1
#=GS W6HZQ8_HBV/1-315      AC W6HZQ8.1
#=GS H6WF70_HBV/1-112      AC H6WF70.1
#=GS Q5UFS7_HBV/1-341      AC Q5UFS7.1
#=GS B5B4J3_HBV/1-352      AC B5B4J3.1
#=GS H6WFC2_HBV/1-112      AC H6WFC2.1
#=GS Q20BX9_HBV/1-52       AC Q20BX9.1
#=GS Q7TDT1_HBV/1-352      AC Q7TDT1.1
#=GS A5JIC3_HBV/1-112      AC A5JIC3.1
#=GS D9U5D5_HBV/1-352      AC D9U5D5.1
#=GS C9WD75_HBV/1-341      AC C9WD75.1
#=GS H6UN80_HBV/1-341      AC H6UN80.1
#=GS F5C0U4_HBV/1-351      AC F5C0U4.1
#=GS E5RPX3_HBV/1-343      AC E5RPX3.1
#=GS H9XRP8_HBV/1-91       AC H9XRP8.1
#=GS Q4KRA0_HBV/1-354      AC Q4KRA0.1
#=GS I0C8Q9_HBV/1-227      AC I0C8Q9.1
#=GS I0C9E9_HBV/1-338      AC I0C9E9.1
#=GS I0C8P8_HBV/1-341      AC I0C8P8.1
#=GS F5C0X1_HBV/1-354      AC F5C0X1.1
#=GS B1ABL8_HBV/236-291    AC B1ABL8.1
#=GS G9G8L9_HBV/1-341      AC G9G8L9.1
#=GS D3TIS0_HBV/213-291    AC D3TIS0.1
#=GS A5JI36_HBV/2-101      AC A5JI36.1
#=GS U3M9X5_HBV/3-337      AC U3M9X5.1
#=GS F5C0M6_HBV/1-354      AC F5C0M6.1
#=GS I0DDS5_HBV/1-328      AC I0DDS5.1
#=GS Q20BT5_HBV/1-57       AC Q20BT5.1
#=GS Q2L4M4_HBV/1-341      AC Q2L4M4.1
#=GS Q461A8_HBV/1-351      AC Q461A8.1
#=GS S5ZFJ1_HBV/1-341      AC S5ZFJ1.1
#=GS D2K7P1_HBV/74-121     AC D2K7P1.1
#=GS I0DGE0_HBV/1-352      AC I0DGE0.1
#=GS A5JHS4_HBV/1-112      AC A5JHS4.1
#=GS J7H798_HBV/1-360      AC J7H798.1
#=GS B5ATA3_HBV/1-352      AC B5ATA3.1
#=GS B4YLG3_HBV/1-341      AC B4YLG3.1
#=GS B0FCU9_HBV/1-352      AC B0FCU9.1
#=GS Q8QKZ0_HBV/1-354      AC Q8QKZ0.1
#=GS E5F0V4_HBV/1-44       AC E5F0V4.1
#=GS G1C8H6_HBV/1-341      AC G1C8H6.1
#=GS Q9E9A1_HBV/1-352      AC Q9E9A1.1
#=GS J7IJS0_HBV/1-341      AC J7IJS0.1
#=GS Q00KA0_HBV/1-352      AC Q00KA0.1
#=GS U3RC40_HBV/1-218      AC U3RC40.1
#=GS Q00K96_HBV/1-352      AC Q00K96.1
#=GS A5JI00_HBV/1-112      AC A5JI00.1
#=GS I0C8B9_HBV/1-354      AC I0C8B9.1
#=GS S5ZSZ4_HBV/1-336      AC S5ZSZ4.1
#=GS B7TTC8_HBV/1-352      AC B7TTC8.1
#=GS S5ZTP3_HBV/1-330      AC S5ZTP3.1
#=GS V5JE30_HBV/1-329      AC V5JE30.1
#=GS E3Q0J5_HBV/1-352      AC E3Q0J5.1
#=GS Q8B4D0_HBV/1-341      AC Q8B4D0.1
#=GS X4YFP7_HBV/1-354      AC X4YFP7.1
#=GS L0CMN6_HBV/1-341      AC L0CMN6.1
#=GS I0DCB3_HBV/1-325      AC I0DCB3.1
#=GS F5C087_HBV/1-352      AC F5C087.1
#=GS I0C908_HBV/1-354      AC I0C908.1
#=GS B1ABQ7_HBV/1-352      AC B1ABQ7.1
#=GS S6A6W1_HBV/1-352      AC S6A6W1.1
#=GS X4YZ99_HBV/1-352      AC X4YZ99.1
#=GS I0DCN8_HBV/1-327      AC I0DCN8.1
#=GS J7IDB8_HBV/1-341      AC J7IDB8.1
#=GS F5C161_HBV/1-354      AC F5C161.1
#=GS B6VA67_HBV/1-352      AC B6VA67.1
#=GS Q20BU5_HBV/1-57       AC Q20BU5.1
#=GS S5ZDY5_HBV/1-335      AC S5ZDY5.1
#=GS Q69594_HBV/1-352      AC Q69594.1
#=GS A2A151_HBV/1-341      AC A2A151.1
#=GS B5M553_HBV/1-352      AC B5M553.1
#=GS J7H3G1_HBV/1-352      AC J7H3G1.1
#=GS Q9IXC0_HBV/1-52       AC Q9IXC0.1
#=GS W6HYD9_HBV/1-304      AC W6HYD9.1
#=GS J7H598_HBV/1-152      AC J7H598.1
#=GS K4PYJ9_HBV/1-123      AC K4PYJ9.1
#=GS R9Q8R3_HBV/1-114      AC R9Q8R3.1
#=GS R9Q7X4_HBV/1-43       AC R9Q7X4.1
#=GS G9BNJ3_HBV/1-354      AC G9BNJ3.1
#=GS L0BE28_HBV/1-210      AC L0BE28.1
#=GS Q8B3N7_9HEPA/66-334   AC Q8B3N7.1
#=GS I0DGD2_HBV/1-352      AC I0DGD2.1
#=GS S5MCS4_HBV/1-352      AC S5MCS4.1
#=GS Q9IX87_HBV/1-52       AC Q9IX87.1
#=GS G1C8N1_HBV/1-339      AC G1C8N1.1
#=GS A8R7G0_HBV/1-337      AC A8R7G0.1
#=GS I0C959_HBV/1-354      AC I0C959.1
#=GS G4XI13_HBV/1-160      AC G4XI13.1
#=GS S5ZSQ5_HBV/1-341      AC S5ZSQ5.1
#=GS Q9IHC7_HBV/1-352      AC Q9IHC7.1
#=GS I0DDZ0_HBV/1-328      AC I0DDZ0.1
#=GS O91511_HBV/1-352      AC O91511.1
#=GS H9XRF8_HBV/1-91       AC H9XRF8.1
#=GS R9Q8E6_HBV/1-100      AC R9Q8E6.1
#=GS I0C8B7_HBV/1-354      AC I0C8B7.1
#=GS B5AT32_HBV/1-352      AC B5AT32.1
#=GS S5ZSM4_HBV/1-336      AC S5ZSM4.1
#=GS Q9YPU7_HBV/1-341      AC Q9YPU7.1
#=GS I0DC86_HBV/1-312      AC I0DC86.1
#=GS G3XH36_HBV/1-332      AC G3XH36.1
#=GS S5ZF72_HBV/1-339      AC S5ZF72.1
#=GS I0DGD5_HBV/1-352      AC I0DGD5.1
#=GS K4PWA4_HBV/1-84       AC K4PWA4.1
#=GS B4YLK2_HBV/1-341      AC B4YLK2.1
#=GS D5LFG6_HBV/1-352      AC D5LFG6.1
#=GS D0E656_HBV/1-352      AC D0E656.1
#=GS C7DMV3_HBV/1-347      AC C7DMV3.1
#=GS Q9J5S0_HBV/1-341      AC Q9J5S0.1
#=GS C6F4J7_HBV/1-354      AC C6F4J7.1
#=GS D3TJZ7_HBV/1-239      AC D3TJZ7.1
#=GS E5F0W0_HBV/1-48       AC E5F0W0.1
#=GS B5BPM2_HBV/1-336      AC B5BPM2.1
#=GS Q91IP1_HBV/1-352      AC Q91IP1.1
#=GS A5JHX6_HBV/1-112      AC A5JHX6.1
#=GS E5RPU1_HBV/1-343      AC E5RPU1.1
#=GS I0C8A6_HBV/1-354      AC I0C8A6.1
#=GS G1E8H1_HBV/1-341      AC G1E8H1.1
#=GS I0DG89_HBV/1-352      AC I0DG89.1
#=GS M1G274_9HEPA/74-375   AC M1G274.1
#=GS W0SMC0_HBV/1-352      AC W0SMC0.1
#=GS L0BCG5_HBV/1-210      AC L0BCG5.1
#=GS H6UN48_HBV/1-341      AC H6UN48.1
#=GS C7DM78_HBV/1-351      AC C7DM78.1
#=GS L0H9S8_HBV/1-337      AC L0H9S8.1
#=GS H3K3R2_HBV/1-354      AC H3K3R2.1
#=GS B7TUG2_HBV/1-352      AC B7TUG2.1
#=GS D0E592_HBV/1-352      AC D0E592.1
#=GS G4XIA5_HBV/1-130      AC G4XIA5.1
#=GS S6A037_HBV/1-343      AC S6A037.1
#=GS I1UYU2_HBV/1-166      AC I1UYU2.1
#=GS H6UNC4_HBV/1-341      AC H6UNC4.1
#=GS H2ERF6_HBV/1-334      AC H2ERF6.1
#=GS B4UU51_HBV/1-352      AC B4UU51.2
#=GS E5RPY7_HBV/1-332      AC E5RPY7.1
#=GS B4YLB0_HBV/1-341      AC B4YLB0.1
#=GS K7QG08_HBV/1-352      AC K7QG08.1
#=GS H6UN13_HBV/1-341      AC H6UN13.1
#=GS L0BE38_HBV/1-210      AC L0BE38.1
#=GS Q1HHB1_HBV/1-341      AC Q1HHB1.1
#=GS I0DDH0_HBV/1-328      AC I0DDH0.1
#=GS S5ZSL8_HBV/1-352      AC S5ZSL8.1
#=GS S6A040_HBV/1-336      AC S6A040.1
#=GS T1WMK9_HBV/1-341      AC T1WMK9.1
#=GS D0E6C8_HBV/1-352      AC D0E6C8.1
#=GS S5ZS95_HBV/1-337      AC S5ZS95.1
#=GS H9N863_HBV/1-341      AC H9N863.1
#=GS C7DSL8_HBV/1-341      AC C7DSL8.1
#=GS I0C8R9_HBV/1-227      AC I0C8R9.1
#=GS L7R7T0_HBV/1-352      AC L7R7T0.1
#=GS D0EYZ1_HBV/1-341      AC D0EYZ1.1
#=GS B3V8U4_HBV/1-291      AC B3V8U4.1
#=GS C3W445_HBV/1-341      AC C3W445.1
#=GS G1E8P5_HBV/1-341      AC G1E8P5.1
#=GS Q20BW7_HBV/1-56       AC Q20BW7.1
#=GS D5MSH3_HBV/1-335      AC D5MSH3.1
#=GS D2X4X2_HBV/1-172      AC D2X4X2.1
#=GS D2JMX1_HBV/1-341      AC D2JMX1.1
#=GS G9G8Z8_HBV/1-341      AC G9G8Z8.1
#=GS D0VXG9_HBV/1-352      AC D0VXG9.1
#=GS Q65Z47_HBV/1-352      AC Q65Z47.1
#=GS M4Q7Z6_HBV/1-171      AC M4Q7Z6.1
#=GS O91558_HBV/1-352      AC O91558.1
#=GS V9TJ64_HBV/1-341      AC V9TJ64.1
#=GS F5C109_HBV/1-354      AC F5C109.1
#=GS W6HVZ7_HBV/1-304      AC W6HVZ7.1
#=GS I0DCJ9_HBV/1-328      AC I0DCJ9.1
#=GS E5RPK7_HBV/1-341      AC E5RPK7.1
#=GS I0C982_HBV/1-354      AC I0C982.1
#=GS F5C130_HBV/1-354      AC F5C130.1
#=GS A5JIJ9_HBV/1-112      AC A5JIJ9.1
#=GS A5JIJ1_HBV/1-112      AC A5JIJ1.1
#=GS Q7T7V3_HBV/1-341      AC Q7T7V3.1
#=GS D5LBQ2_HBV/1-352      AC D5LBQ2.1
#=GS Q4FD77_HBV/1-352      AC Q4FD77.1
#=GS H9XQQ9_HBV/1-91       AC H9XQQ9.1
#=GS H9XQD8_HBV/1-91       AC H9XQD8.1
#=GS A5LG22_HBV/1-352      AC A5LG22.1
#=GS Q1T7D5_HBV/1-341      AC Q1T7D5.1
#=GS Q5DVY6_HBV/1-341      AC Q5DVY6.1
#=GS X4YSJ8_HBV/1-352      AC X4YSJ8.1
#=GS B7TTN3_HBV/1-352      AC B7TTN3.1
#=GS R9Q7R9_HBV/1-114      AC R9Q7R9.1
#=GS L0H9W6_HBV/1-352      AC L0H9W6.1
#=GS S6A723_HBV/1-341      AC S6A723.1
#=GS Q7T4V3_HBV/1-341      AC Q7T4V3.1
#=GS H6UNE4_HBV/1-333      AC H6UNE4.1
#=GS B5ASV3_HBV/1-352      AC B5ASV3.1
#=GS Q8V0N1_HBV/1-352      AC Q8V0N1.1
#=GS W8P752_HBV/1-352      AC W8P752.1
#=GS M9PN04_HBV/1-93       AC M9PN04.1
#=GS Q8QXP7_HBV/1-341      AC Q8QXP7.1
#=GS C3W409_HBV/1-341      AC C3W409.1
#=GS U3KUF5_HBV/1-171      AC U3KUF5.1
#=GS Q80GU6_HBV/1-352      AC Q80GU6.1
#=GS C7AY23_HBV/1-354      AC C7AY23.1
#=GS K4PXM8_HBV/1-82       AC K4PXM8.1
#=GS Q8B4G2_HBV/1-278      AC Q8B4G2.1
#=GS F5C0L2_HBV/1-354      AC F5C0L2.1
#=GS D3TJ92_HBV/1-349      AC D3TJ92.1
#=GS G9G9M2_HBV/1-341      AC G9G9M2.1
#=GS D0VXJ7_HBV/1-341      AC D0VXJ7.1
#=GS Q2L4Q3_HBV/1-341      AC Q2L4Q3.1
#=GS D5LB47_HBV/1-352      AC D5LB47.1
#=GS I0DDI6_HBV/1-328      AC I0DDI6.1
#=GS D2JME5_HBV/1-352      AC D2JME5.1
#=GS G3XH02_HBV/1-343      AC G3XH02.1
#=GS D3GIJ7_HBV/1-352      AC D3GIJ7.1
#=GS H6WF58_HBV/1-112      AC H6WF58.1
#=GS B4YL66_HBV/1-239      AC B4YL66.1
#=GS Q9YKJ5_HBV/1-352      AC Q9YKJ5.1
#=GS G4XI75_HBV/1-160      AC G4XI75.1
#=GS M4Q872_HBV/1-165      AC M4Q872.1
#=GS K4PXS8_HBV/1-81       AC K4PXS8.1
#=GS K9MD34_HBV/1-24       AC K9MD34.1
#=GS S5ZT48_HBV/1-341      AC S5ZT48.1
#=GS Q4FDG7_HBV/1-352      AC Q4FDG7.1
#=GS B5BPT1_HBV/1-352      AC B5BPT1.1
#=GS S5ZFB7_HBV/1-352      AC S5ZFB7.1
#=GS D9U570_HBV/1-352      AC D9U570.1
#=GS S6A6U1_HBV/1-341      AC S6A6U1.1
#=GS Q5DW06_HBV/1-352      AC Q5DW06.1
#=GS D5LET0_HBV/1-352      AC D5LET0.1
#=GS I0C8K8_HBV/1-335      AC I0C8K8.1
#=GS D5MSG3_HBV/1-352      AC D5MSG3.1
#=GS V5JE68_HBV/1-341      AC V5JE68.1
#=GS D5LB54_HBV/1-352      AC D5LB54.1
#=GS G9G8X0_HBV/1-326      AC G9G8X0.2
#=GS F5C0U3_HBV/1-351      AC F5C0U3.1
#=GS Q8B4C6_HBV/1-341      AC Q8B4C6.1
#=GS E9L5E2_HBV/1-352      AC E9L5E2.1
#=GS S5ZLZ7_HBV/1-337      AC S5ZLZ7.1
#=GS I0DGG2_HBV/1-247      AC I0DGG2.1
#=GS Q77BF7_HBV/1-167      AC Q77BF7.1
#=GS I0DG94_HBV/1-352      AC I0DG94.1
#=GS B5M515_HBV/1-352      AC B5M515.1
#=GS Q2VAD3_9HEPA/52-236   AC Q2VAD3.1
#=GS D2JMW2_HBV/1-352      AC D2JMW2.1
#=GS E7FK66_HBV/1-352      AC E7FK66.1
#=GS D3TK69_HBV/1-348      AC D3TK69.1
#=GS I0C887_HBV/1-354      AC I0C887.1
#=GS G3XGX0_HBV/1-343      AC G3XGX0.1
#=GS Q7T7U6_HBV/1-341      AC Q7T7U6.1
#=GS G9I480_9HEPA/72-312   AC G9I480.1
#=GS M4QCA1_HBV/1-352      AC M4QCA1.1
#=GS B5TF10_HBV/1-112      AC B5TF10.1
#=GS Q9J0U4_HBV/1-341      AC Q9J0U4.1
#=GS Q20BP9_HBV/1-57       AC Q20BP9.1
#=GS L8B257_HBV/1-342      AC L8B257.1
#=GS H6UGI5_HBV/1-341      AC H6UGI5.1
#=GS W0SK90_HBV/1-352      AC W0SK90.1
#=GS A5LG94_HBV/1-352      AC A5LG94.1
#=GS B9VJY1_HBV/1-341      AC B9VJY1.1
#=GS S5ZSB9_HBV/1-321      AC S5ZSB9.1
#=GS I0C8E1_HBV/1-354      AC I0C8E1.1
#=GS U3M9V6_HBV/6-328      AC U3M9V6.1
#=GS Q9WKD2_HBV/1-354      AC Q9WKD2.1
#=GS Q8V1M4_HBV/1-352      AC Q8V1M4.1
#=GS S5ZLB0_HBV/1-352      AC S5ZLB0.1
#=GS D2JMV3_HBV/1-352      AC D2JMV3.1
#=GS H9XQT3_HBV/1-91       AC H9XQT3.1
#=GS B2Y6S9_HBV/1-354      AC B2Y6S9.1
#=GS I0DE76_HBV/1-328      AC I0DE76.1
#=GS W6IBF1_HBV/1-315      AC W6IBF1.1
#=GS R9Q812_HBV/1-114      AC R9Q812.1
#=GS M4Q873_HBV/1-171      AC M4Q873.1
#=GS R9Q7S7_HBV/1-114      AC R9Q7S7.1
#=GS Q1JUR8_HBV/1-354      AC Q1JUR8.1
#=GS F5C7N2_HBV/1-352      AC F5C7N2.1
#=GS A0FGR1_HBV/1-352      AC A0FGR1.1
#=GS Q81124_HBV/1-352      AC Q81124.1
#=GS B1NYA9_HBV/1-341      AC B1NYA9.1
#=GS H6UNA0_HBV/1-341      AC H6UNA0.1
#=GS DPOL_HPBDB/54-341     AC P17192.1
#=GS B0FDB1_HBV/1-346      AC B0FDB1.1
#=GS H9XR74_HBV/1-91       AC H9XR74.1
#=GS L7R717_HBV/1-341      AC L7R717.1
#=GS D6QVG2_HBV/1-352      AC D6QVG2.1
#=GS I0DGK6_HBV/1-297      AC I0DGK6.1
#=GS H6UG59_HBV/1-341      AC H6UG59.1
#=GS F5C1Q6_HBV/1-341      AC F5C1Q6.1
#=GS F5C131_HBV/1-354      AC F5C131.1
#=GS G4XMJ1_HBV/1-352      AC G4XMJ1.1
#=GS I0DGA4_HBV/1-352      AC I0DGA4.1
#=GS Q9YPU3_HBV/1-341      AC Q9YPU3.1
#=GS B7SXU2_HBV/1-351      AC B7SXU2.1
#=GS Q9DGY8_HBV/1-352      AC Q9DGY8.1
#=GS B5M5N1_HBV/1-352      AC B5M5N1.1
#=GS F5C1A4_HBV/1-354      AC F5C1A4.1
#=GS B5B4A7_HBV/236-291    AC B5B4A7.1
#=GS A7YET7_HBV/1-352      AC A7YET7.1
#=GS Q1XHF4_HBV/1-340      AC Q1XHF4.1
#=GS O91569_HBV/1-337      AC O91569.1
#=GS F5C138_HBV/1-354      AC F5C138.1
#=GS I0DCZ4_HBV/1-313      AC I0DCZ4.1
#=GS Q6XGW1_HBV/1-354      AC Q6XGW1.1
#=GS F5C0L7_HBV/1-354      AC F5C0L7.1
#=GS G4XIA1_HBV/1-130      AC G4XIA1.1
#=GS X4YHU9_HBV/1-341      AC X4YHU9.1
#=GS L0HAN4_HBV/1-339      AC L0HAN4.1
#=GS S5ZL17_HBV/1-332      AC S5ZL17.1
#=GS F5C119_HBV/281-320    AC F5C119.1
#=GS Q8JN11_HBV/1-341      AC Q8JN11.1
#=GS D2JM96_HBV/1-352      AC D2JM96.1
#=GS Q6Y5I8_HBV/1-352      AC Q6Y5I8.1
#=GS R9Q8U9_HBV/1-95       AC R9Q8U9.1
#=GS I0C8M1_HBV/1-335      AC I0C8M1.1
#=GS DPOL_HPBDC/61-340     AC P30028.1
#=GS R9Q8H8_HBV/1-114      AC R9Q8H8.1
#=GS B9VKE4_HBV/1-352      AC B9VKE4.1
#=GS B5ATB4_HBV/1-346      AC B5ATB4.1
#=GS C3W3N9_HBV/1-341      AC C3W3N9.2
#=GS A5JHU8_HBV/1-112      AC A5JHU8.1
#=GS M1G259_9HEPA/67-359   AC M1G259.1
#=GS T2HTN8_HBV/1-50       AC T2HTN8.1
#=GS B5BPH7_HBV/1-352      AC B5BPH7.1
#=GS X4YY89_HBV/1-238      AC X4YY89.1
#=GS Q2LCB2_HBV/1-341      AC Q2LCB2.1
#=GS L8B1Y5_HBV/1-341      AC L8B1Y5.1
#=GS C6F569_HBV/1-354      AC C6F569.1
#=GS B0YK65_HBV/1-347      AC B0YK65.1
#=GS I0C8P2_HBV/224-280    AC I0C8P2.1
#=GS Q8QSD1_HBV/1-352      AC Q8QSD1.1
#=GS S6A720_HBV/1-332      AC S6A720.1
#=GS Q4FDH5_HBV/1-352      AC Q4FDH5.1
#=GS Q9QAG0_HBV/1-341      AC Q9QAG0.1
#=GS B9VKJ9_HBV/1-352      AC B9VKJ9.1
#=GS O91589_HBV/1-352      AC O91589.1
#=GS Q7THR7_HBV/1-314      AC Q7THR7.1
#=GS I0C8R2_HBV/224-280    AC I0C8R2.1
#=GS I0DDM8_HBV/1-328      AC I0DDM8.1
#=GS B5TFD3_HBV/1-112      AC B5TFD3.1
#=GS Q20BZ6_HBV/1-57       AC Q20BZ6.1
#=GS S5ZK91_HBV/1-336      AC S5ZK91.1
#=GS E9L2J0_HBV/1-354      AC E9L2J0.1
#=GS D0UDN9_HBV/1-352      AC D0UDN9.1
#=GS Q9IR24_HBV/1-174      AC Q9IR24.1
#=GS L7R8S4_HBV/1-346      AC L7R8S4.1
#=GS Q67942_HBV/1-170      AC Q67942.1
#=GS B9VKZ7_HBV/1-352      AC B9VKZ7.1
#=GS Q9IGV8_HBV/1-341      AC Q9IGV8.1
#=GS E0ZRY1_HBV/1-351      AC E0ZRY1.1
#=GS S5MCV6_HBV/1-352      AC S5MCV6.1
#=GS K7QG93_HBV/1-335      AC K7QG93.1
#=GS D0QP47_HBV/1-352      AC D0QP47.2
#=GS C3W3Q6_HBV/1-337      AC C3W3Q6.1
#=GS G9G9A4_HBV/1-333      AC G9G9A4.1
#=GS W0SLR6_HBV/1-352      AC W0SLR6.1
#=GS I7LSR6_HBV/1-352      AC I7LSR6.1
#=GS C3W488_HBV/1-341      AC C3W488.1
#=GS F5C7P6_HBV/1-352      AC F5C7P6.1
#=GS I0DC89_HBV/1-328      AC I0DC89.1
#=GS C1K227_HBV/284-330    AC C1K227.1
#=GS M4QAK1_HBV/1-171      AC M4QAK1.1
#=GS G1C8G2_HBV/1-341      AC G1C8G2.1
#=GS H6WFG6_HBV/1-112      AC H6WFG6.1
#=GS D3YGP0_HBV/1-341      AC D3YGP0.1
#=GS I0C8Z6_HBV/1-354      AC I0C8Z6.1
#=GS G1E8L8_HBV/1-341      AC G1E8L8.1
#=GS B5M5A8_HBV/1-336      AC B5M5A8.1
#=GS Q6UBK6_HBV/1-354      AC Q6UBK6.1
#=GS U3KUC2_HBV/1-162      AC U3KUC2.1
#=GS E5RDB3_HBV/1-341      AC E5RDB3.1
#=GS A3F6I9_HBV/1-354      AC A3F6I9.1
#=GS B2LW92_HBV/1-350      AC B2LW92.1
#=GS V9Y236_HBV/1-352      AC V9Y236.1
#=GS B5ASU2_HBV/1-352      AC B5ASU2.1
#=GS I0DDQ2_HBV/158-198    AC I0DDQ2.1
#=GS I0DCU8_HBV/1-325      AC I0DCU8.1
#=GS B5ATC3_HBV/1-346      AC B5ATC3.1
#=GS A9QPW9_HBV/1-351      AC A9QPW9.1
#=GS E5RPJ9_HBV/1-352      AC E5RPJ9.1
#=GS D5LC69_HBV/1-352      AC D5LC69.1
#=GS I0C8U6_HBV/1-354      AC I0C8U6.1
#=GS S6A6Z4_HBV/1-331      AC S6A6Z4.1
#=GS E9L2U2_HBV/1-171      AC E9L2U2.1
#=GS C7AYL1_HBV/1-354      AC C7AYL1.1
#=GS D0E5K0_HBV/1-352      AC D0E5K0.1
#=GS I0C8Q1_HBV/1-341      AC I0C8Q1.1
#=GS G1E863_HBV/1-341      AC G1E863.1
#=GS H6V5R0_HBV/1-352      AC H6V5R0.1
#=GS E7EFD0_HBV/1-352      AC E7EFD0.1
#=GS H9XQH4_HBV/1-91       AC H9XQH4.1
#=GS C1K231_HBV/1-343      AC C1K231.1
#=GS D2JMU5_HBV/1-352      AC D2JMU5.1
#=GS B9VKJ5_HBV/1-352      AC B9VKJ5.1
#=GS I0C8Q7_HBV/1-341      AC I0C8Q7.1
#=GS I0C8V2_HBV/1-354      AC I0C8V2.1
#=GS F5C0J3_HBV/1-341      AC F5C0J3.1
#=GS H6WFL4_HBV/1-112      AC H6WFL4.1
#=GS D9U591_HBV/1-352      AC D9U591.1
#=GS S5ZSF4_HBV/1-340      AC S5ZSF4.1
#=GS H6WF46_HBV/1-112      AC H6WF46.1
#=GS G1E8J2_HBV/1-227      AC G1E8J2.1
#=GS D3TK76_HBV/1-338      AC D3TK76.1
#=GS C7DQR3_HBV/1-354      AC C7DQR3.1
#=GS X4YS62_HBV/1-352      AC X4YS62.1
#=GS D3YGB3_HBV/1-341      AC D3YGB3.1
#=GS B2CZU9_HBV/1-352      AC B2CZU9.1
#=GS Q5DVX8_HBV/1-351      AC Q5DVX8.1
#=GS F5C0K0_HBV/1-348      AC F5C0K0.1
#=GS U5JY27_HBV/85-129     AC U5JY27.1
#=GS S5ZTA2_HBV/1-352      AC S5ZTA2.1
#=GS D3TIS0_HBV/1-217      AC D3TIS0.1
#=GS L8B1U0_HBV/248-298    AC L8B1U0.1
#=GS Q6XGN4_HBV/1-354      AC Q6XGN4.1
#=GS I0DE44_HBV/1-328      AC I0DE44.1
#=GS B2LWD0_HBV/285-317    AC B2LWD0.1
#=GS I0C938_HBV/1-354      AC I0C938.1
#=GS Q9IXE1_HBV/1-52       AC Q9IXE1.1
#=GS A5JIL1_HBV/1-112      AC A5JIL1.1
#=GS J7S5A7_HBV/1-352      AC J7S5A7.1
#=GS E7CT88_HBV/1-352      AC E7CT88.1
#=GS L7R6P0_HBV/1-341      AC L7R6P0.1
#=GS Q9WJS9_HBV/1-352      AC Q9WJS9.1
#=GS C7DMC4_HBV/1-351      AC C7DMC4.1
#=GS G1E8A1_HBV/1-341      AC G1E8A1.1
#=GS Q20BZ8_HBV/1-55       AC Q20BZ8.1
#=GS B5M536_HBV/1-349      AC B5M536.1
#=GS S5MHA6_HBV/1-352      AC S5MHA6.1
#=GS I0DCP6_HBV/1-317      AC I0DCP6.1
#=GS B0FC83_HBV/1-352      AC B0FC83.1
#=GS B5LX83_HBV/1-341      AC B5LX83.1
#=GS B9VKS7_HBV/1-352      AC B9VKS7.1
#=GS I0C904_HBV/1-354      AC I0C904.1
#=GS B4ZYX2_HBV/1-341      AC B4ZYX2.1
#=GS C6F499_HBV/1-354      AC C6F499.1
#=GS I0C915_HBV/1-354      AC I0C915.1
#=GS D2JMV7_HBV/1-352      AC D2JMV7.1
#=GS S6A034_HBV/1-341      AC S6A034.1
#=GS E5RPX5_HBV/1-343      AC E5RPX5.1
#=GS I1UYV7_HBV/1-166      AC I1UYV7.1
#=GS B7TTP0_HBV/1-352      AC B7TTP0.1
#=GS X2G4X0_HBV/1-347      AC X2G4X0.1
#=GS F5C177_HBV/1-354      AC F5C177.1
#=GS D6QVJ6_HBV/1-352      AC D6QVJ6.1
#=GS S6A008_HBV/1-341      AC S6A008.1
#=GS L8B287_HBV/1-341      AC L8B287.1
#=GS L0BDD3_HBV/1-210      AC L0BDD3.1
#=GS D0VXG5_HBV/1-352      AC D0VXG5.1
#=GS S5ZS83_HBV/1-332      AC S5ZS83.1
#=GS C7AYX1_HBV/1-354      AC C7AYX1.1
#=GS D2JMI3_HBV/1-352      AC D2JMI3.1
#=GS DPOL_WMHBV/1-340      AC O71304.1
#=GS C7AYB7_HBV/1-354      AC C7AYB7.1
#=GS C7AYT0_HBV/1-354      AC C7AYT0.1
#=GS Q81111_HBV/1-352      AC Q81111.2
#=GS A5JHR6_HBV/1-112      AC A5JHR6.1
#=GS V5NAE1_HBV/1-346      AC V5NAE1.1
#=GS D5LC01_HBV/1-352      AC D5LC01.1
#=GS I0DDK9_HBV/1-328      AC I0DDK9.1
#=GS C5WK06_HBV/1-352      AC C5WK06.1
#=GS F5C0W8_HBV/1-354      AC F5C0W8.1
#=GS F5C0S8_HBV/1-333      AC F5C0S8.1
#=GS D5LFL5_HBV/1-352      AC D5LFL5.1
#=GS D9U5M6_HBV/1-341      AC D9U5M6.1
#=GS A5JIG7_HBV/1-112      AC A5JIG7.1
#=GS L0CN04_HBV/1-341      AC L0CN04.1
#=GS S6A012_HBV/1-352      AC S6A012.1
#=GS I0DCW3_HBV/1-328      AC I0DCW3.1
#=GS B2CSB9_HBV/1-352      AC B2CSB9.1
#=GS Q4FD41_HBV/1-352      AC Q4FD41.1
#=GS H9XRP0_HBV/1-91       AC H9XRP0.1
#=GS W6HZP4_HBV/1-315      AC W6HZP4.1
#=GS H9XQP1_HBV/1-91       AC H9XQP1.1
#=GS F5C081_HBV/1-352      AC F5C081.1
#=GS I0DEA0_HBV/1-209      AC I0DEA0.1
#=GS F2X0J5_HBV/1-352      AC F2X0J5.1
#=GS U3RC56_HBV/1-218      AC U3RC56.1
#=GS Q1PD04_HBV/1-352      AC Q1PD04.1
#=GS Q9J0U9_HBV/1-341      AC Q9J0U9.1
#=GS S6A004_HBV/1-341      AC S6A004.1
#=GS D2JMQ6_HBV/1-352      AC D2JMQ6.1
#=GS S5ZE56_HBV/1-239      AC S5ZE56.1
#=GS Q80GY9_HBV/1-341      AC Q80GY9.1
#=GS B1ABR0_HBV/233-290    AC B1ABR0.1
#=GS S5ZDT7_HBV/1-341      AC S5ZDT7.1
#=GS L0CMR3_HBV/1-341      AC L0CMR3.1
#=GS B5BPV4_HBV/1-337      AC B5BPV4.1
#=GS G9G9K1_HBV/1-341      AC G9G9K1.1
#=GS I0DGE3_HBV/1-352      AC I0DGE3.1
#=GS L0BCE3_HBV/1-210      AC L0BCE3.1
#=GS V9TLM2_HBV/1-336      AC V9TLM2.1
#=GS F4ZCB1_HBV/1-36       AC F4ZCB1.1
#=GS DPOL_HBVF2/1-352      AC Q8JMY4.1
#=GS F5C1P2_HBV/1-341      AC F5C1P2.1
#=GS S5ZLD6_HBV/1-341      AC S5ZLD6.1
#=GS S5ZDQ0_HBV/1-335      AC S5ZDQ0.1
#=GS I0DEA1_HBV/1-328      AC I0DEA1.1
#=GS I3RTF7_HBV/1-352      AC I3RTF7.1
#=GS B5AT20_HBV/1-352      AC B5AT20.1
#=GS Q65Z73_HBV/1-341      AC Q65Z73.1
#=GS E0ZRJ5_HBV/1-351      AC E0ZRJ5.1
#=GS G4XI91_HBV/1-54       AC G4XI91.1
#=GS O91585_HBV/1-342      AC O91585.1
#=GS R9Q8T7_HBV/1-114      AC R9Q8T7.1
#=GS I0DDL3_HBV/1-328      AC I0DDL3.1
#=GS F5C1K7_HBV/1-341      AC F5C1K7.1
#=GS Q80JA4_HBV/1-352      AC Q80JA4.1
#=GS I0C9G5_HBV/1-338      AC I0C9G5.1
#=GS I0DCX0_HBV/1-317      AC I0DCX0.1
#=GS I0C9H7_HBV/1-344      AC I0C9H7.1
#=GS Q7TG39_9HEPA/109-391  AC Q7TG39.1
#=GS G1E7N4_HBV/1-341      AC G1E7N4.1
#=GS I0C8L1_HBV/1-350      AC I0C8L1.1
#=GS H6WF22_HBV/1-112      AC H6WF22.1
#=GS Q5R2R5_HBV/1-341      AC Q5R2R5.1
#=GS B9VL37_HBV/1-352      AC B9VL37.1
#=GS A0A024FA30_HBV/1-352  AC A0A024FA30.1
#=GS Q4FDD9_HBV/1-352      AC Q4FDD9.1
#=GS Q9IXD5_HBV/1-52       AC Q9IXD5.1
#=GS S5ZFL7_HBV/1-332      AC S5ZFL7.1
#=GS F5C145_HBV/1-354      AC F5C145.1
#=GS F5C1B6_HBV/1-354      AC F5C1B6.1
#=GS S5ZS59_HBV/1-319      AC S5ZS59.1
#=GS S5ZTJ7_HBV/1-341      AC S5ZTJ7.1
#=GS A0A023NLB2_HBV/1-341  AC A0A023NLB2.1
#=GS B9VAY7_HBV/1-352      AC B9VAY7.1
#=GS D2JMT3_HBV/1-352      AC D2JMT3.1
#=GS I0C9B3_HBV/1-341      AC I0C9B3.1
#=GS X4YSC7_HBV/1-352      AC X4YSC7.1
#=GS I0C975_HBV/1-354      AC I0C975.1
#=GS I0C878_HBV/1-354      AC I0C878.1
#=GS S5ZSP9_HBV/1-350      AC S5ZSP9.1
#=GS X4Z165_HBV/1-352      AC X4Z165.1
#=GS F5C0K3_HBV/1-326      AC F5C0K3.1
#=GS R9Q8M9_HBV/1-114      AC R9Q8M9.1
#=GS G3XL97_HBV/1-352      AC G3XL97.1
#=GS Q7TDZ0_HBV/1-352      AC Q7TDZ0.1
#=GS B5TXL3_HBV/1-352      AC B5TXL3.1
#=GS Q4W6E0_HBV/1-351      AC Q4W6E0.1
#=GS I0C912_HBV/1-354      AC I0C912.1
#=GS B5MEW5_HBV/1-339      AC B5MEW5.1
#=GS Q9WRJ9_HBV/1-354      AC Q9WRJ9.1
#=GS Q9E945_HBV/1-342      AC Q9E945.1
#=GS I0DGH3_HBV/1-352      AC I0DGH3.1
#=GS B7TUK7_HBV/1-352      AC B7TUK7.1
#=GS D6QVE1_HBV/1-352      AC D6QVE1.1
#=GS I0DGJ7_HBV/1-352      AC I0DGJ7.1
#=GS G9G9J4_HBV/1-341      AC G9G9J4.1
#=GS I0C933_HBV/1-354      AC I0C933.1
#=GS M1G262_9HEPA/74-341   AC M1G262.1
#=GS F5C134_HBV/1-354      AC F5C134.1
#=GS A7L366_HBV/1-30       AC A7L366.1
#=GS C1K222_HBV/1-300      AC C1K222.1
#=GS Q99HU5_HBV/1-352      AC Q99HU5.1
#=GS Q9QBE2_HBV/1-352      AC Q9QBE2.1
#=GS Q9WP51_HBV/210-289    AC Q9WP51.1
#=GS H9XRD0_HBV/1-91       AC H9XRD0.1
#=GS M4QAE7_HBV/1-171      AC M4QAE7.1
#=GS I0C8W2_HBV/1-354      AC I0C8W2.1
#=GS Q5U7V7_HBV/1-341      AC Q5U7V7.1
#=GS T2HRN5_HBV/1-50       AC T2HRN5.1
#=GS Q2F516_HBV/1-341      AC Q2F516.1
#=GS S5ZZU5_HBV/1-342      AC S5ZZU5.1
#=GS Q404G6_HBV/1-341      AC Q404G6.1
#=GS D0EDU1_HBV/1-341      AC D0EDU1.1
#=GS B0YJS9_HBV/1-351      AC B0YJS9.1
#=GS D7NKU7_HBV/1-341      AC D7NKU7.1
#=GS Q67834_HBV/1-111      AC Q67834.1
#=GS H6UGK9_HBV/1-341      AC H6UGK9.1
#=GS S5ZZT0_HBV/1-341      AC S5ZZT0.1
#=GS B5M5Z1_HBV/1-352      AC B5M5Z1.1
#=GS C7AY29_HBV/185-274    AC C7AY29.1
#=GS D0UEA3_HBV/1-341      AC D0UEA3.1
#=GS Q2ABZ2_HBV/1-352      AC Q2ABZ2.1
#=GS I0DCF1_HBV/1-328      AC I0DCF1.1
#=GS M1G261_9HEPA/65-347   AC M1G261.1
#=GS B5M5V5_HBV/1-346      AC B5M5V5.1
#=GS I0C8C4_HBV/1-354      AC I0C8C4.1
#=GS Q4R1T8_HBV/1-351      AC Q4R1T8.1
#=GS B5ATD2_HBV/1-347      AC B5ATD2.1
#=GS E0ZRZ7_HBV/1-351      AC E0ZRZ7.1
#=GS M4Q825_HBV/1-171      AC M4Q825.1
#=GS R9Q8Q3_HBV/1-114      AC R9Q8Q3.1
#=GS Q20BN9_HBV/1-55       AC Q20BN9.1
#=GS I1UYU8_HBV/1-166      AC I1UYU8.1
#=GS B5AT75_HBV/1-352      AC B5AT75.1
#=GS S6A093_HBV/1-341      AC S6A093.1
#=GS K4PWA7_HBV/1-172      AC K4PWA7.1
#=GS F5C1B5_HBV/1-354      AC F5C1B5.1
#=GS D5LF25_HBV/1-352      AC D5LF25.1
#=GS X4ZEI6_HBV/1-352      AC X4ZEI6.1
#=GS S5ZFV6_HBV/1-341      AC S5ZFV6.1
#=GS A0MMM4_HBV/115-155    AC A0MMM4.1
#=GS S5ZFB4_HBV/1-317      AC S5ZFB4.1
#=GS W8P711_HBV/1-352      AC W8P711.1
#=GS X4YS95_HBV/1-352      AC X4YS95.1
#=GS Q4FDE3_HBV/1-352      AC Q4FDE3.1
#=GS Q9DTC5_HBV/1-352      AC Q9DTC5.1
#=GS G4XI31_HBV/1-160      AC G4XI31.1
#=GS Q3ZKR9_HBV/1-354      AC Q3ZKR9.1
#=GS A5JIM3_HBV/1-112      AC A5JIM3.1
#=GS Q9YZU3_HBV/1-336      AC Q9YZU3.1
#=GS C7DMH8_HBV/1-351      AC C7DMH8.1
#=GS Q9IXA8_HBV/1-52       AC Q9IXA8.1
#=GS S6A6U8_HBV/1-341      AC S6A6U8.1
#=GS D5LEN8_HBV/1-352      AC D5LEN8.1
#=GS I0DG96_HBV/1-352      AC I0DG96.1
#=GS G1E856_HBV/1-341      AC G1E856.1
#=GS I0DDD4_HBV/1-328      AC I0DDD4.1
#=GS S5ZZK4_HBV/1-340      AC S5ZZK4.1
#=GS F5C164_HBV/1-354      AC F5C164.1
#=GS Q9E9A8_HBV/1-352      AC Q9E9A8.1
#=GS E5RPQ5_HBV/1-343      AC E5RPQ5.1
#=GS E3VLB4_HBV/1-341      AC E3VLB4.1
#=GS S5ZF32_HBV/1-350      AC S5ZF32.1
#=GS D2JMY0_HBV/1-352      AC D2JMY0.1
#=GS H9XSZ0_HBV/1-84       AC H9XSZ0.1
#=GS G4XHY1_HBV/1-160      AC G4XHY1.1
#=GS W6HZN9_HBV/1-315      AC W6HZN9.1
#=GS D7NKL3_HBV/1-341      AC D7NKL3.1
#=GS Q5Q0T2_HBV/1-352      AC Q5Q0T2.1
#=GS I0DDU5_HBV/1-328      AC I0DDU5.1
#=GS M4QBA3_HBV/1-171      AC M4QBA3.1
#=GS R9Q7Y8_HBV/1-114      AC R9Q7Y8.1
#=GS B5M5L2_HBV/1-352      AC B5M5L2.1
#=GS G9G8S4_HBV/1-341      AC G9G8S4.2
#=GS D6QVP1_HBV/1-351      AC D6QVP1.1
#=GS C6F4A6_HBV/1-354      AC C6F4A6.1
#=GS B5M539_HBV/1-348      AC B5M539.1
#=GS R9Q7T6_HBV/1-114      AC R9Q7T6.1
#=GS D0UE27_HBV/1-343      AC D0UE27.1
#=GS DPOL_HBVCJ/1-352      AC Q69028.2
#=GS B5M501_HBV/1-352      AC B5M501.1
#=GS A5GZI1_HBV/1-352      AC A5GZI1.1
#=GS F5C122_HBV/1-284      AC F5C122.1
#=GS F4ZCB7_HBV/1-49       AC F4ZCB7.1
#=GS D5LBK7_HBV/1-352      AC D5LBK7.1
#=GS S5ZS98_HBV/1-352      AC S5ZS98.1
#=GS B7TTT7_HBV/1-352      AC B7TTT7.1
#=GS N0DK58_HBV/1-352      AC N0DK58.1
#=GS G1C980_HBV/1-341      AC G1C980.1
#=GS F5C0R4_HBV/1-351      AC F5C0R4.1
#=GS E5RPS5_HBV/1-343      AC E5RPS5.1
#=GS D0E6L2_HBV/1-352      AC D0E6L2.1
#=GS D2JMR5_HBV/1-352      AC D2JMR5.1
#=GS B7TTI0_HBV/1-352      AC B7TTI0.1
#=GS B5M647_HBV/1-352      AC B5M647.1
#=GS G4XMK7_HBV/1-352      AC G4XMK7.1
#=GS L0CLG5_HBV/1-341      AC L0CLG5.1
#=GS S5ZF44_HBV/1-342      AC S5ZF44.1
#=GS B3VLL9_HBV/1-175      AC B3VLL9.1
#=GS F2WS80_HBV/1-352      AC F2WS80.1
#=GS K7QH04_HBV/1-352      AC K7QH04.1
#=GS F5C0K2_HBV/1-354      AC F5C0K2.1
#=GS L0BE05_HBV/1-210      AC L0BE05.1
#=GS G1E8I5_HBV/1-341      AC G1E8I5.1
#=GS C5WK22_HBV/1-352      AC C5WK22.1
#=GS H6UGS8_HBV/1-341      AC H6UGS8.1
#=GS E5D5M5_HBV/1-354      AC E5D5M5.1
#=GS D5LE07_HBV/1-352      AC D5LE07.1
#=GS D2U634_HBV/1-351      AC D2U634.1
#=GS G1C8E8_HBV/1-341      AC G1C8E8.1
#=GS G0YVM3_HBV/1-240      AC G0YVM3.1
#=GS G9HNR4_HBV/1-159      AC G9HNR4.1
#=GS A4UBL9_HBV/1-75       AC A4UBL9.1
#=GS B1PI65_9HEPA/109-390  AC B1PI65.1
#=GS C1K191_HBV/1-352      AC C1K191.1
#=GS C7AYD7_HBV/1-354      AC C7AYD7.1
#=GS A9QPU8_HBV/1-351      AC A9QPU8.1
#=GS Q2LCG0_HBV/1-341      AC Q2LCG0.1
#=GS G9G8U9_HBV/1-341      AC G9G8U9.1
#=GS Q9QMN3_HBV/1-285      AC Q9QMN3.1
#=GS S5ZFD9_HBV/1-337      AC S5ZFD9.1
#=GS F5C0I9_HBV/1-341      AC F5C0I9.1
#=GS A5JI71_HBV/1-112      AC A5JI71.1
#=GS A5JI55_HBV/1-112      AC A5JI55.1
#=GS I0DGH5_HBV/1-352      AC I0DGH5.1
#=GS Q5Q0S5_HBV/1-352      AC Q5Q0S5.1
#=GS B2LXP6_HBV/1-352      AC B2LXP6.1
#=GS Q6RSF2_9HEPA/59-223   AC Q6RSF2.1
#=GS Q20BU7_HBV/1-57       AC Q20BU7.1
#=GS D5LDQ5_HBV/1-352      AC D5LDQ5.1
#=GS I0C867_HBV/1-354      AC I0C867.1
#=GS G3E5B5_HBV/1-341      AC G3E5B5.1
#=GS B5M5V2_HBV/280-311    AC B5M5V2.1
#=GS J7RUC8_HBV/1-351      AC J7RUC8.1
#=GS I0DGF6_HBV/1-352      AC I0DGF6.1
#=GS B9VKN2_HBV/1-352      AC B9VKN2.1
#=GS D0EED9_HBV/1-354      AC D0EED9.1
#=GS C7DM92_HBV/1-351      AC C7DM92.1
#=GS I0C8L5_HBV/1-335      AC I0C8L5.1
#=GS I0C905_HBV/1-354      AC I0C905.1
#=GS H6WF34_HBV/1-112      AC H6WF34.1
#=GS A9PLJ1_HBV/3-43       AC A9PLJ1.1
#=GS E5F0V2_HBV/1-49       AC E5F0V2.1
#=GS I0C907_HBV/1-354      AC I0C907.1
#=GS M1FST8_HBV/1-352      AC M1FST8.1
#=GS B9VK94_HBV/1-352      AC B9VK94.1
#=GS X4YSF0_HBV/1-352      AC X4YSF0.1
#=GS D7NL82_HBV/1-341      AC D7NL82.1
#=GS A8J4G4_HBV/1-352      AC A8J4G4.1
#=GS A5JHT6_HBV/1-112      AC A5JHT6.1
#=GS D2U616_HBV/1-351      AC D2U616.1
#=GS S5ZDV6_HBV/1-341      AC S5ZDV6.1
#=GS H9XRB4_HBV/1-91       AC H9XRB4.1
#=GS G1E8H8_HBV/1-341      AC G1E8H8.1
#=GS B3VLM5_HBV/1-175      AC B3VLM5.1
#=GS Q5DW16_HBV/1-352      AC Q5DW16.1
#=GS Q8QZQ0_HBV/1-348      AC Q8QZQ0.1
#=GS G1C966_HBV/1-341      AC G1C966.1
#=GS H9XQJ0_HBV/1-91       AC H9XQJ0.1
#=GS Q9WRL0_HBV/1-354      AC Q9WRL0.1
#=GS S5ZLE2_HBV/1-341      AC S5ZLE2.1
#=GS L0BCC5_HBV/1-210      AC L0BCC5.1
#=GS D3TK04_HBV/236-280    AC D3TK04.1
#=GS B5TF34_HBV/1-112      AC B5TF34.1
#=GS B7TUQ5_HBV/1-352      AC B7TUQ5.1
#=GS C8C9S8_HBV/1-352      AC C8C9S8.1
#=GS G1C925_HBV/1-341      AC G1C925.1
#=GS C7DN23_HBV/1-351      AC C7DN23.1
#=GS F1AEY6_HBV/1-352      AC F1AEY6.1
#=GS K4PXP0_HBV/2-165      AC K4PXP0.1
#=GS H2ERD1_HBV/1-352      AC H2ERD1.1
#=GS S5MVH3_HBV/1-352      AC S5MVH3.1
#=GS K7QG41_HBV/1-352      AC K7QG41.1
#=GS G4XI61_HBV/1-160      AC G4XI61.1
#=GS F5C0T1_HBV/1-351      AC F5C0T1.1
#=GS Q2EIG5_HBV/1-352      AC Q2EIG5.1
#=GS D0E5N4_HBV/1-352      AC D0E5N4.1
#=GS W8NZN9_HBV/1-352      AC W8NZN9.1
#=GS A7J8K6_HBV/1-354      AC A7J8K6.1
#=GS R4P3M6_HBV/1-352      AC R4P3M6.1
#=GS Q9YQ40_HBV/1-167      AC Q9YQ40.1
#=GS X4ZEW2_HBV/1-352      AC X4ZEW2.1
#=GS B5BPJ7_HBV/1-352      AC B5BPJ7.1
#=GS DPOL_HBVB8/1-352      AC P0C676.1
#=GS G1E7Z4_HBV/1-341      AC G1E7Z4.1
#=GS C7AY39_HBV/1-354      AC C7AY39.1
#=GS B2LWB2_HBV/1-337      AC B2LWB2.1
#=GS H6WF98_HBV/1-112      AC H6WF98.1
#=GS B6CEV3_HBV/1-352      AC B6CEV3.1
#=GS H6WFG2_HBV/1-112      AC H6WFG2.1
#=GS Q4R1T5_HBV/1-351      AC Q4R1T5.1
#=GS B2CZH6_HBV/1-352      AC B2CZH6.1
#=GS R9Q7T9_HBV/1-114      AC R9Q7T9.1
#=GS I0C891_HBV/1-354      AC I0C891.1
#=GS B3V8T9_HBV/1-243      AC B3V8T9.1
#=GS H6UGN8_HBV/1-341      AC H6UGN8.1
#=GS I0C8A3_HBV/1-354      AC I0C8A3.1
#=GS B9VJX8_HBV/1-352      AC B9VJX8.1
#=GS D0E6B4_HBV/1-352      AC D0E6B4.1
#=GS C5WK30_HBV/1-352      AC C5WK30.1
#=GS Q4FDN0_HBV/1-341      AC Q4FDN0.1
#=GS X4YY65_HBV/1-352      AC X4YY65.1
#=GS H6UGU1_HBV/1-341      AC H6UGU1.1
#=GS B9VKT1_HBV/1-342      AC B9VKT1.1
#=GS L8B1W6_HBV/1-337      AC L8B1W6.1
#=GS S5ZKC8_HBV/1-352      AC S5ZKC8.1
#=GS H6WFL0_HBV/1-112      AC H6WFL0.1
#=GS G4XMM7_HBV/1-352      AC G4XMM7.1
#=GS I0C8G9_HBV/1-354      AC I0C8G9.1
#=GS F5C0P7_HBV/1-347      AC F5C0P7.1
#=GS D2N0Y6_HBV/1-354      AC D2N0Y6.1
#=GS E5RPQ3_HBV/1-343      AC E5RPQ3.1
#=GS S6A705_HBV/1-341      AC S6A705.1
#=GS G1E7T3_HBV/229-322    AC G1E7T3.1
#=GS A9CM57_HBV/1-352      AC A9CM57.1
#=GS K7QXQ3_HBV/1-352      AC K7QXQ3.1
#=GS I0C961_HBV/1-354      AC I0C961.1
#=GS W6A604_9HEPA/5-388    AC W6A604.1
#=GS Q4FD69_HBV/1-352      AC Q4FD69.1
#=GS I0C906_HBV/1-354      AC I0C906.1
#=GS O39877_HBV/1-352      AC O39877.1
#=GS D2JMI8_HBV/1-352      AC D2JMI8.1
#=GS D5LCE7_HBV/1-352      AC D5LCE7.1
#=GS DPOL_HBVC2/1-352      AC Q9YZR5.1
#=GS K0F4J2_HBV/1-352      AC K0F4J2.1
#=GS H9XRF4_HBV/1-91       AC H9XRF4.1
#=GS B2CSA6_HBV/1-352      AC B2CSA6.1
#=GS W8PAB0_HBV/1-176      AC W8PAB0.1
#=GS B7TV03_HBV/1-352      AC B7TV03.1
#=GS S5ZFA9_HBV/1-336      AC S5ZFA9.1
#=GS D5LF92_HBV/1-352      AC D5LF92.1
#=GS B2LWD9_HBV/1-287      AC B2LWD9.1
#=GS L0BDF8_HBV/1-210      AC L0BDF8.1
#=GS I1UYW6_HBV/1-166      AC I1UYW6.1
#=GS Q8B4G2_HBV/276-307    AC Q8B4G2.1
#=GS I0CF23_HBV/1-271      AC I0CF23.1
#=GS S5ZZS1_HBV/1-341      AC S5ZZS1.1
#=GS X2G9Q1_HBV/1-351      AC X2G9Q1.1
#=GS Q8JMZ3_HBV/1-352      AC Q8JMZ3.1
#=GS D6QVS3_HBV/1-352      AC D6QVS3.1
#=GS I0C8R5_HBV/1-341      AC I0C8R5.1
#=GS I0C996_HBV/1-341      AC I0C996.1
#=GS U3RGW3_HBV/1-218      AC U3RGW3.1
#=GS D0EEL8_HBV/1-354      AC D0EEL8.1
#=GS Q8V1M0_HBV/1-352      AC Q8V1M0.1
#=GS Q19T06_HBV/1-340      AC Q19T06.1
#=GS F5C0Z2_HBV/1-354      AC F5C0Z2.1
#=GS G4XMP3_HBV/1-352      AC G4XMP3.1
#=GS DPOL_HBVA6/1-347      AC Q91C36.1
#=GS S5ZF13_HBV/1-320      AC S5ZF13.1
#=GS B2LRU3_HBV/1-352      AC B2LRU3.1
#=GS D5MSJ1_HBV/1-332      AC D5MSJ1.1
#=GS Q20BY3_HBV/1-52       AC Q20BY3.1
#=GS B9VL72_HBV/215-315    AC B9VL72.1
#=GS I0DE80_HBV/1-328      AC I0DE80.1
#=GS S5MHT2_HBV/1-352      AC S5MHT2.1
#=GS R9Q8W1_HBV/1-114      AC R9Q8W1.1
#=GS C5WK34_HBV/1-352      AC C5WK34.1
#=GS H9XRE6_HBV/1-91       AC H9XRE6.1
#=GS I0C8R3_HBV/1-341      AC I0C8R3.1
#=GS B5B4D3_HBV/1-352      AC B5B4D3.1
#=GS Q8B5R1_HBV/1-203      AC Q8B5R1.1
#=GS M9WR65_HBV/1-352      AC M9WR65.1
#=GS D5LEB2_HBV/1-352      AC D5LEB2.1
#=GS H9XRK8_HBV/1-91       AC H9XRK8.1
#=GS Q5KR35_HBV/1-352      AC Q5KR35.1
#=GS I0DDR1_HBV/248-280    AC I0DDR1.1
#=GS F5C0Y9_HBV/1-354      AC F5C0Y9.1
#=GS V5LDL5_HBV/1-352      AC V5LDL5.1
#=GS D0EDW2_HBV/1-354      AC D0EDW2.1
#=GS A5JHS0_HBV/1-112      AC A5JHS0.1
#=GS B5B4K7_HBV/1-352      AC B5B4K7.1
#=GS C1K1V7_HBV/1-352      AC C1K1V7.1
#=GS B1ABK6_HBV/1-73       AC B1ABK6.1
#=GS I0DC47_HBV/1-328      AC I0DC47.1
#=GS G1E7M8_HBV/1-341      AC G1E7M8.1
#=GS G3XGU0_HBV/1-348      AC G3XGU0.1
#=GS H9XR14_HBV/1-91       AC H9XR14.1
#=GS Q5C830_HBV/1-352      AC Q5C830.1
#=GS D7NL41_HBV/1-341      AC D7NL41.1
#=GS G3XGZ4_HBV/1-343      AC G3XGZ4.1
#=GS U3RJX3_HBV/1-218      AC U3RJX3.1
#=GS G3XLC5_HBV/1-352      AC G3XLC5.1
#=GS H9XR26_HBV/1-91       AC H9XR26.1
#=GS D5LEM4_HBV/1-352      AC D5LEM4.1
#=GS I0C8R2_HBV/1-227      AC I0C8R2.1
#=GS X4YY89_HBV/235-291    AC X4YY89.1
#=GS C7DSM5_HBV/1-341      AC C7DSM5.1
#=GS I0C9F2_HBV/1-352      AC I0C9F2.1
#=GS D3GIL3_HBV/1-352      AC D3GIL3.1
#=GS I0DGG7_HBV/1-352      AC I0DGG7.1
#=GS L7R7K4_HBV/1-341      AC L7R7K4.1
#=GS O09504_HBV/212-310    AC O09504.1
#=GS B7TTD5_HBV/1-352      AC B7TTD5.1
#=GS C3W3R8_HBV/1-341      AC C3W3R8.1
#=GS W6HWK6_HBV/1-315      AC W6HWK6.1
#=GS B2WSR6_HBV/1-352      AC B2WSR6.1
#=GS Q7THP5_HBV/1-352      AC Q7THP5.1
#=GS B5ASP4_HBV/1-352      AC B5ASP4.1
#=GS A5JHW0_HBV/1-112      AC A5JHW0.1
#=GS W6HZR4_HBV/1-315      AC W6HZR4.1
#=GS T1YUS1_HBV/1-352      AC T1YUS1.1
#=GS T1YVI6_HBV/1-352      AC T1YVI6.1
#=GS D0E6A6_HBV/1-352      AC D0E6A6.1
#=GS C4RU79_HBV/1-341      AC C4RU79.1
#=GS W6CYY0_HBV/1-170      AC W6CYY0.1
#=GS I7L956_HBV/1-354      AC I7L956.1
#=GS R9Q8G6_HBV/1-114      AC R9Q8G6.1
#=GS Q20BS5_HBV/1-52       AC Q20BS5.1
#=GS S6A6Z7_HBV/1-341      AC S6A6Z7.1
#=GS W8NZ36_HBV/1-352      AC W8NZ36.1
#=GS H1ACZ2_HBV/1-352      AC H1ACZ2.1
#=GS K4N380_HBV/1-352      AC K4N380.1
#=GS I0C9C4_HBV/1-334      AC I0C9C4.1
#=GS F5C1N5_HBV/1-341      AC F5C1N5.1
#=GS B2CZT5_HBV/1-352      AC B2CZT5.1
#=GS S5ZKT8_HBV/1-321      AC S5ZKT8.1
#=GS Q9WRK5_HBV/1-354      AC Q9WRK5.1
#=GS G9G9T1_HBV/272-321    AC G9G9T1.1
#=GS I0C9G9_HBV/1-338      AC I0C9G9.1
#=GS K4PWZ7_HBV/1-49       AC K4PWZ7.1
#=GS A5JIL5_HBV/1-112      AC A5JIL5.1
#=GS S6A703_HBV/1-341      AC S6A703.1
#=GS U3RER2_HBV/1-218      AC U3RER2.1
#=GS E0ZRI1_HBV/1-351      AC E0ZRI1.1
#=GS B7TUU8_HBV/1-352      AC B7TUU8.1
#=GS I0C965_HBV/1-351      AC I0C965.1
#=GS Q4FDF5_HBV/1-352      AC Q4FDF5.1
#=GS W8P7N5_HBV/1-346      AC W8P7N5.1
#=GS F5C0X0_HBV/1-354      AC F5C0X0.1
#=GS V5JE33_HBV/1-329      AC V5JE33.1
#=GS S5ZZR4_HBV/1-336      AC S5ZZR4.1
#=GS R9Q8J0_HBV/1-114      AC R9Q8J0.1
#=GS E5RPT1_HBV/1-343      AC E5RPT1.1
#=GS G4XMH1_HBV/1-352      AC G4XMH1.1
#=GS U5K8U0_HBV/3-50       AC U5K8U0.1
#=GS G1E8B9_HBV/1-341      AC G1E8B9.1
#=GS S5ZFG9_HBV/1-336      AC S5ZFG9.1
#=GS C7G301_HBV/1-352      AC C7G301.1
#=GS L7R9N4_HBV/1-352      AC L7R9N4.1
#=GS C7AY45_HBV/1-354      AC C7AY45.1
#=GS Q918N7_9HEPA/5-231    AC Q918N7.1
#=GS S5ZZK1_HBV/1-342      AC S5ZZK1.1
#=GS A7YEX9_HBV/1-352      AC A7YEX9.1
#=GS A5A355_HBV/1-112      AC A5A355.1
#=GS I0C8X8_HBV/1-354      AC I0C8X8.1
#=GS B9VK67_HBV/1-352      AC B9VK67.1
#=GS I7JHR5_HBV/1-354      AC I7JHR5.1
#=GS B4YKS8_HBV/1-354      AC B4YKS8.1
#=GS B5M5M5_HBV/1-352      AC B5M5M5.1
#=GS Q20BY5_HBV/1-57       AC Q20BY5.1
#=GS X4YHV3_HBV/1-341      AC X4YHV3.1
#=GS D2JMU9_HBV/1-352      AC D2JMU9.1
#=GS B9VKZ3_HBV/1-352      AC B9VKZ3.1
#=GS S5ZKU9_HBV/1-342      AC S5ZKU9.1
#=GS Q2PWY0_HBV/1-354      AC Q2PWY0.1
#=GS F5C196_HBV/1-354      AC F5C196.1
#=GS G4XI01_HBV/1-160      AC G4XI01.1
#=GS I0CF26_HBV/3-268      AC I0CF26.1
#=GS G1E7E7_HBV/250-297    AC G1E7E7.1
#=GS S6A010_HBV/1-341      AC S6A010.1
#=GS X4YYT0_HBV/1-352      AC X4YYT0.1
#=GS S6A0C2_HBV/1-337      AC S6A0C2.1
#=GS Q2EID9_HBV/1-352      AC Q2EID9.1
#=GS L0HBI7_HBV/1-352      AC L0HBI7.1
#=GS E9L2F1_HBV/1-171      AC E9L2F1.1
#=GS D2JML8_HBV/1-352      AC D2JML8.1
#=GS E5RPU5_HBV/1-340      AC E5RPU5.1
#=GS B4YKU9_HBV/1-341      AC B4YKU9.1
#=GS I0DGD4_HBV/1-352      AC I0DGD4.1
#=GS I0DDS1_HBV/1-328      AC I0DDS1.1
#=GS E0ZRT5_HBV/1-351      AC E0ZRT5.1
#=GS F5C0X8_HBV/1-354      AC F5C0X8.1
#=GS I0C9G2_HBV/1-338      AC I0C9G2.1
#=GS H6WF26_HBV/1-112      AC H6WF26.1
#=GS I0DCA1_HBV/1-328      AC I0DCA1.1
#=GS B4YKP3_HBV/1-354      AC B4YKP3.1
#=GS S5ZLT9_HBV/1-350      AC S5ZLT9.1
#=GS D0UE72_HBV/1-352      AC D0UE72.1
#=GS Q8V1I8_HBV/1-352      AC Q8V1I8.1
#=GS H6WFF4_HBV/1-112      AC H6WFF4.1
#=GS Q4FD73_HBV/1-352      AC Q4FD73.1
#=GS B5TXM4_HBV/1-352      AC B5TXM4.1
#=GS B5BPI9_HBV/1-352      AC B5BPI9.1
#=GS S5N155_HBV/1-352      AC S5N155.1
#=GS D2X416_HBV/66-104     AC D2X416.1
#=GS Q4FD65_HBV/1-352      AC Q4FD65.1
#=GS F5C169_HBV/1-354      AC F5C169.1
#=GS S5ZSB3_HBV/1-226      AC S5ZSB3.1
#=GS G4XMB9_HBV/1-341      AC G4XMB9.1
#=GS Q9WP68_HBV/1-304      AC Q9WP68.1
#=GS K4PYL2_HBV/1-84       AC K4PYL2.1
#=GS K7QGE0_HBV/1-352      AC K7QGE0.1
#=GS D3Y5Q2_HBV/1-352      AC D3Y5Q2.1
#=GS S5ZLV6_HBV/1-339      AC S5ZLV6.1
#=GS E5RD29_HBV/1-352      AC E5RD29.1
#=GS X4YYD1_HBV/1-352      AC X4YYD1.1
#=GS F5C0P4_HBV/1-354      AC F5C0P4.1
#=GS B5TXI8_HBV/1-347      AC B5TXI8.1
#=GS D3TIQ6_HBV/1-352      AC D3TIQ6.1
#=GS S6A021_HBV/1-340      AC S6A021.1
#=GS E9L5G3_HBV/1-352      AC E9L5G3.1
#=GS A5JI44_HBV/1-112      AC A5JI44.1
#=GS D0UDS9_HBV/1-352      AC D0UDS9.1
#=GS K9MDK2_HBV/1-24       AC K9MDK2.1
#=GS W8NZD7_HBV/1-352      AC W8NZD7.1
#=GS X4YRD8_HBV/1-352      AC X4YRD8.1
#=GS B2LRX6_HBV/1-352      AC B2LRX6.1
#=GS D5LEI2_HBV/1-352      AC D5LEI2.1
#=GS Q6XGX5_HBV/1-354      AC Q6XGX5.1
#=GS B9VKE0_HBV/1-352      AC B9VKE0.1
#=GS Q9DH57_HBV/1-352      AC Q9DH57.1
#=GS S5ZZV5_HBV/1-352      AC S5ZZV5.1
#=GS I0DD48_HBV/1-328      AC I0DD48.1
#=GS C9WDF4_HBV/1-341      AC C9WDF4.1
#=GS C3W4D7_HBV/1-341      AC C3W4D7.1
#=GS B5B496_HBV/236-309    AC B5B496.1
#=GS I0DGI5_HBV/1-170      AC I0DGI5.1
#=GS S5ZJZ6_HBV/1-337      AC S5ZJZ6.1
#=GS B5TXJ8_HBV/1-352      AC B5TXJ8.1
#=GS B5BPZ0_HBV/1-350      AC B5BPZ0.1
#=GS W0SK62_HBV/1-352      AC W0SK62.1
#=GS A6MGC0_HBV/1-352      AC A6MGC0.1
#=GS Q0KG51_HBV/1-354      AC Q0KG51.1
#=GS Q306H1_HBV/1-352      AC Q306H1.1
#=GS D6QVP7_HBV/1-352      AC D6QVP7.1
#=GS E9L2G9_HBV/1-171      AC E9L2G9.1
#=GS G1E8L2_HBV/1-341      AC G1E8L2.1
#=GS L0BE88_HBV/1-210      AC L0BE88.1
#=GS T2FG50_HBV/1-352      AC T2FG50.1
#=GS Q7THQ0_HBV/1-352      AC Q7THQ0.1
#=GS C7AYQ0_HBV/1-354      AC C7AYQ0.1
#=GS B9VKI4_HBV/1-352      AC B9VKI4.1
#=GS R9Q818_HBV/1-114      AC R9Q818.1
#=GS D2X3T4_HBV/1-161      AC D2X3T4.1
#=GS G1C8B4_HBV/271-319    AC G1C8B4.1
#=GS A9CM70_HBV/1-352      AC A9CM70.1
#=GS H6V5I4_HBV/1-352      AC H6V5I4.1
#=GS H9XR62_HBV/1-91       AC H9XR62.1
#=GS K0FB86_HBV/1-352      AC K0FB86.1
#=GS C1K200_HBV/1-238      AC C1K200.1
#=GS A5JI29_HBV/1-112      AC A5JI29.1
#=GS G4XIB7_HBV/1-124      AC G4XIB7.1
#=GS D0VXI1_HBV/1-352      AC D0VXI1.1
#=GS C7DNG3_HBV/1-351      AC C7DNG3.1
#=GS B5M621_HBV/1-352      AC B5M621.1
#=GS H6V5S6_HBV/1-352      AC H6V5S6.1
#=GS X4ZEJ6_HBV/1-352      AC X4ZEJ6.1
#=GS F5C128_HBV/1-354      AC F5C128.1
#=GS Q77BH0_HBV/1-167      AC Q77BH0.1
#=GS I0DGK7_HBV/269-352    AC I0DGK7.1
#=GS W8NZ32_HBV/1-352      AC W8NZ32.1
#=GS L0BE64_HBV/1-210      AC L0BE64.1
#=GS Q80JT8_9HEPA/61-340   AC Q80JT8.1
#=GS Q5U7Q4_HBV/1-341      AC Q5U7Q4.1
#=GS B2LWA2_HBV/193-286    AC B2LWA2.1
#=GS Q9IXA5_HBV/1-52       AC Q9IXA5.1
#=GS D3YGS0_HBV/1-341      AC D3YGS0.1
#=GS B5TF49_HBV/1-112      AC B5TF49.1
#=GS Q80SD3_HBV/1-345      AC Q80SD3.1
#=GS Q1JUU2_HBV/1-352      AC Q1JUU2.1
#=GS R9Q8A2_HBV/1-114      AC R9Q8A2.1
#=GS DPOL_HBVG3/1-351      AC Q9IBI4.1
#=GS Q6XGP1_HBV/1-354      AC Q6XGP1.1
#=GS B5M4Z8_HBV/1-352      AC B5M4Z8.1
#=GS J7SC69_HBV/1-347      AC J7SC69.1
#=GS I0C8L4_HBV/1-335      AC I0C8L4.1
#=GS D0EDX5_HBV/1-354      AC D0EDX5.1
#=GS S5ZL61_HBV/1-352      AC S5ZL61.1
#=GS B4ZYU3_HBV/1-352      AC B4ZYU3.1
#=GS H9XQN7_HBV/1-91       AC H9XQN7.1
#=GS Q8B5P9_HBV/1-200      AC Q8B5P9.1
#=GS I0DDV7_HBV/1-328      AC I0DDV7.1
#=GS I3XMT7_HBV/1-354      AC I3XMT7.1
#=GS C7DM44_HBV/1-351      AC C7DM44.1
#=GS DPOL_WHV3/6-393       AC P12899.1
#=GS B7TUW0_HBV/1-352      AC B7TUW0.1
#=GS F5C0Q2_HBV/1-347      AC F5C0Q2.1
#=GS D0ESQ8_HBV/1-352      AC D0ESQ8.1
#=GS Q9E8L4_HBV/1-352      AC Q9E8L4.1
#=GS R9Q8C8_HBV/1-102      AC R9Q8C8.1
#=GS G9HNR2_HBV/1-159      AC G9HNR2.1
#=GS B5B496_HBV/1-239      AC B5B496.1
#=GS Q9QRQ7_HBV/136-178    AC Q9QRQ7.1
#=GS S5ZJT2_HBV/1-340      AC S5ZJT2.1
#=GS Q004A5_HBV/1-352      AC Q004A5.1
#=GS B5M5G5_HBV/1-352      AC B5M5G5.1
#=GS K4PXR6_HBV/1-75       AC K4PXR6.1
#=GS C7AYL3_HBV/1-354      AC C7AYL3.1
#=GS DPOL_HBVC0/1-352      AC Q9E6S5.1
#=GS Q3ZKP9_HBV/1-351      AC Q3ZKP9.1
#=GS S5ZLQ5_HBV/1-341      AC S5ZLQ5.1
#=GS G1E7L0_HBV/1-341      AC G1E7L0.1
#=GS I1VYG3_HBV/1-352      AC I1VYG3.1
#=GS C3W3X8_HBV/1-341      AC C3W3X8.1
#=GS D3GIM1_HBV/1-352      AC D3GIM1.1
#=GS B5TXN8_HBV/1-352      AC B5TXN8.1
#=GS C3W3S4_HBV/1-341      AC C3W3S4.1
#=GS D8VCL9_HBV/1-302      AC D8VCL9.1
#=GS Q1XHE2_HBV/1-341      AC Q1XHE2.1
#=GS D0E690_HBV/1-352      AC D0E690.1
#=GS I0C8R1_HBV/1-341      AC I0C8R1.1
#=GS G4XHX5_HBV/1-160      AC G4XHX5.1
#=GS D0EE60_HBV/1-354      AC D0EE60.1
#=GS D0E5Q7_HBV/1-352      AC D0E5Q7.1
#=GS T2HS22_HBV/1-50       AC T2HS22.1
#=GS B9VKY9_HBV/1-352      AC B9VKY9.1
#=GS E5RPW3_HBV/1-343      AC E5RPW3.1
#=GS Q00K88_HBV/1-352      AC Q00K88.1
#=GS Q6YLM0_HBV/1-352      AC Q6YLM0.1
#=GS S5ZF64_HBV/1-350      AC S5ZF64.1
#=GS U3M9Y4_HBV/3-337      AC U3M9Y4.1
#=GS F5C1F2_HBV/1-341      AC F5C1F2.1
#=GS S6A6X0_HBV/1-340      AC S6A6X0.1
#=GS D7NL61_HBV/1-341      AC D7NL61.1
#=GS C7DNE2_HBV/1-345      AC C7DNE2.1
#=GS B5TFC9_HBV/1-112      AC B5TFC9.1
#=GS D0E648_HBV/1-352      AC D0E648.1
#=GS I0C9B7_HBV/1-334      AC I0C9B7.1
#=GS H6WFK2_HBV/1-112      AC H6WFK2.1
#=GS G1E8F3_HBV/1-341      AC G1E8F3.1
#=GS I0C8Z3_HBV/1-354      AC I0C8Z3.1
#=GS C3W4I7_HBV/1-341      AC C3W4I7.1
#=GS F5C0U9_HBV/1-354      AC F5C0U9.1
#=GS L7R7W1_HBV/1-341      AC L7R7W1.1
#=GS I0DGK7_HBV/1-178      AC I0DGK7.1
#=GS B1A0B1_HBV/1-352      AC B1A0B1.1
#=GS G1E895_HBV/1-341      AC G1E895.1
#=GS D5LCM1_HBV/1-352      AC D5LCM1.1
#=GS C6KGU1_HBV/1-352      AC C6KGU1.1
#=GS S6A6X5_HBV/1-341      AC S6A6X5.1
#=GS C5WJU6_HBV/1-352      AC C5WJU6.1
#=GS F5C0Y7_HBV/1-354      AC F5C0Y7.1
#=GS A5LGA6_HBV/1-352      AC A5LGA6.1
#=GS B5TF85_HBV/1-112      AC B5TF85.1
#=GS Q9E8K2_HBV/1-341      AC Q9E8K2.1
#=GS A9CM74_HBV/1-352      AC A9CM74.1
#=GS Q6UBJ4_HBV/1-354      AC Q6UBJ4.1
#=GS H6UN64_HBV/1-341      AC H6UN64.1
#=GS Q9IX99_HBV/1-52       AC Q9IX99.1
#=GS G3E580_HBV/1-341      AC G3E580.1
#=GS E0ZR80_HBV/1-351      AC E0ZR80.1
#=GS I0C889_HBV/1-354      AC I0C889.1
#=GS B5B4K0_HBV/1-352      AC B5B4K0.1
#=GS D5LBY9_HBV/1-352      AC D5LBY9.1
#=GS D0E5A3_HBV/1-352      AC D0E5A3.1
#=GS Q8B8Q8_HBV/1-341      AC Q8B8Q8.1
#=GS F1CFC9_HBV/1-341      AC F1CFC9.1
#=GS Q20BQ1_HBV/1-56       AC Q20BQ1.1
#=GS B2Y6S2_HBV/1-354      AC B2Y6S2.1
#=GS S6A097_HBV/1-337      AC S6A097.1
#=GS D0E5H2_HBV/1-352      AC D0E5H2.1
#=GS Q80GX5_HBV/195-249    AC Q80GX5.1
#=GS Q9E6R8_HBV/1-352      AC Q9E6R8.1
#=GS B9VAY1_HBV/1-222      AC B9VAY1.1
#=GS H2ER70_HBV/1-352      AC H2ER70.1
#=GS B8PTC4_HBV/1-341      AC B8PTC4.1
#=GS Q1JUT0_HBV/1-334      AC Q1JUT0.1
#=GS I6YLY1_HBV/1-352      AC I6YLY1.1
#=GS F5C0U6_HBV/1-354      AC F5C0U6.1
#=GS G4XMG3_HBV/1-352      AC G4XMG3.1
#=GS Q99HT7_HBV/1-352      AC Q99HT7.1
#=GS E5RD53_HBV/1-352      AC E5RD53.1
#=GS I0DC74_HBV/1-328      AC I0DC74.1
#=GS B5M5W1_HBV/1-352      AC B5M5W1.1
#=GS B5BPL7_HBV/1-352      AC B5BPL7.1
#=GS I0C9C0_HBV/1-334      AC I0C9C0.1
#=GS I0C877_HBV/1-354      AC I0C877.1
#=GS D5LDB4_HBV/1-352      AC D5LDB4.1
#=GS U3KUD2_HBV/1-162      AC U3KUD2.1
#=GS D3YGE9_HBV/1-341      AC D3YGE9.1
#=GS H9XQK0_HBV/1-91       AC H9XQK0.1
#=GS F5C1A0_HBV/1-354      AC F5C1A0.1
#=GS D5LBL4_HBV/1-352      AC D5LBL4.1
#=GS E5CZ50_HBV/1-352      AC E5CZ50.1
#=GS I0DG97_HBV/1-352      AC I0DG97.1
#=GS D5LB75_HBV/1-352      AC D5LB75.1
#=GS E1U7M3_HBV/1-341      AC E1U7M3.1
#=GS G1E7K3_HBV/1-341      AC G1E7K3.1
#=GS O91582_HBV/274-320    AC O91582.1
#=GS S5ZTE6_HBV/1-340      AC S5ZTE6.1
#=GS T1YUS9_HBV/1-352      AC T1YUS9.1
#=GS S5ZE62_HBV/1-341      AC S5ZE62.1
#=GS B0FCA6_HBV/1-345      AC B0FCA6.1
#=GS I0DD52_HBV/1-328      AC I0DD52.1
#=GS X4YPP1_HBV/40-171     AC X4YPP1.1
#=GS J7SBI1_HBV/1-347      AC J7SBI1.1
#=GS Q2F505_HBV/1-341      AC Q2F505.1
#=GS A5JI67_HBV/1-112      AC A5JI67.1
#=GS T2HRL5_HBV/1-50       AC T2HRL5.1
#=GS A7M688_HBV/1-344      AC A7M688.1
#=GS W8SYB5_HBV/1-354      AC W8SYB5.1
#=GS D0EDU8_HBV/1-341      AC D0EDU8.1
#=GS X4ZD05_HBV/1-346      AC X4ZD05.1
#=GS T2AZ19_HBV/1-352      AC T2AZ19.1
#=GS S5ZK20_HBV/1-339      AC S5ZK20.1
#=GS B5BUV2_HBV/1-354      AC B5BUV2.1
#=GS R9Q826_HBV/1-114      AC R9Q826.1
#=GS A0FDJ7_HBV/1-352      AC A0FDJ7.1
#=GS F5C0N0_HBV/1-354      AC F5C0N0.1
#=GS F5C0Y8_HBV/1-354      AC F5C0Y8.1
#=GS D5LDK8_HBV/1-352      AC D5LDK8.1
#=GS X4YYG4_HBV/1-352      AC X4YYG4.1
#=GS Q58W12_HBV/1-352      AC Q58W12.1
#=GS C3W433_HBV/1-341      AC C3W433.1
#=GS B5M5I1_HBV/221-314    AC B5M5I1.1
#=GS D9U1L5_HBV/1-352      AC D9U1L5.1
#=GS K9MD20_HBV/1-24       AC K9MD20.1
#=GS I0C8P9_HBV/1-341      AC I0C8P9.1
#=GS T1YUQ9_HBV/1-352      AC T1YUQ9.1
#=GS S5ZK13_HBV/1-337      AC S5ZK13.1
#=GS S5ZSX7_HBV/1-337      AC S5ZSX7.1
#=GS B5MEX3_HBV/1-352      AC B5MEX3.1
#=GS Q7THS7_HBV/1-352      AC Q7THS7.1
#=GS A5JHY8_HBV/1-112      AC A5JHY8.1
#=GS E3Q0I9_HBV/1-352      AC E3Q0I9.1
#=GS H9XQI2_HBV/1-91       AC H9XQI2.1
#=GS Q6UBK2_HBV/1-341      AC Q6UBK2.1
#=GS B5M4Z3_HBV/1-346      AC B5M4Z3.1
#=GS G3E552_HBV/1-341      AC G3E552.1
#=GS B3IWU7_HBV/1-352      AC B3IWU7.1
#=GS S6A6X7_HBV/1-320      AC S6A6X7.1
#=GS G1E870_HBV/1-341      AC G1E870.1
#=GS L0CMK1_HBV/1-341      AC L0CMK1.1
#=GS Q8B6N3_HBV/1-352      AC Q8B6N3.1
#=GS Q8B5Q2_HBV/1-190      AC Q8B5Q2.1
#=GS B0FCL9_HBV/1-352      AC B0FCL9.1
#=GS Q06AN0_HBV/1-352      AC Q06AN0.1
#=GS G1C8T6_HBV/1-341      AC G1C8T6.1
#=GS D6QW25_HBV/1-352      AC D6QW25.1
#=GS B5ASS4_HBV/1-352      AC B5ASS4.1
#=GS A5GZH7_HBV/1-352      AC A5GZH7.1
#=GS B3VLI1_HBV/1-176      AC B3VLI1.1
#=GS S5ZK61_HBV/1-337      AC S5ZK61.1
S5ZLK5_HBV/1-341                 ....................................-----------LLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
G1E821_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.TG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVSP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G0YVM7_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPHWK.TPSFPNIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAN........KSASCLH..QS.PVRK.A..TYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
X4YHX0_HBV/50-111                ..............................dhwpea---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..----NQ.VHAVEF.H.N...IPP....SS...A......RPQ.SEGPILP...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZL85_HBV/1-341                 ....................................-----------LLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
W8P7I9_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..N..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPDIHLHEDIIHRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLEKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SE..RHGDE..S..F...CS..............QSSG.IF.....SR.........S....PV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAX.........GXS......G...R.SG.SI....R.AR.VH.STTRR.S.F.....G........VE.....P....T..GSGH.....ID.N.SXS........SSSSCFH..QS.AVRK.T..AYSHLSTS..KRHSSS.GHAVEL.H.S...ISP....SS...A......RSQ.SKGPVFS...CWW.LQFRNSXPCSEYCLSHIINLXD..DWGPC.................................................................................................................................................................................................
K4PYJ3_HBV/1-172                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.IR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHTVEL.H.N...IPP....GS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8P3_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..V...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....P.LAK.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NA.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..EKYSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D6QVX0_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWK.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLSLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....P.....HGRLVF..QT.SK..RHGDE..S..L...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.LAS.........GKS......G...R.SG.SI....R.AR.VH.STPRX.S.F.....G........VE.....P....A..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHFSTS..KRQSSS.GHAVEX.H.N...ISP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZFQ7_HBV/1-337                 ....................................---------------..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPCFNPXWQ.TPSFPDIHLQEDIVDRCRQFVGTLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.SAPWG.T.V.....G........VE.....P....S..GSGH.....TY.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GRAVEL.H.H...FPP....NS...S......RSQ.SQGPXLS...CWW.LQFRNSEPCSEYCLXHIVNLIE..DWGPC.................................................................................................................................................................................................
B5TXX4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLANEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...RS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAS.........GKS......G...R.SG.SI....R.AR.VH.PTSRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D3TJE1_HBV/211-306               ...................................q---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........-Q.....P....S..SSGH.....SH.N.CAS........SSSSCLH..QS.AGRK.E..AYSPVSTS..KRHSSS.GRAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
S6A6X9_HBV/1-284                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLXMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFXGSPYSWE..QD...L....Q.....HGRLVF..XT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....X.AR.VH.PXPXG.T.V.....G........XE.....P....S..XSGH.....XH.N.CAS........SSSSCLH..QS.AVX-.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----ss...............................................................................................................................................................................................
K7QGS2_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PAPWG.T.V.....G........VE.....P....S..GSRP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVXS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
L0HC78_HBV/1-252                 ....................................MPLSYQHFRKLLLLD..N..D...A.....GPLEEELPRLADEGLNRRVAEDLH..L..G.D.LN..VSIPWTHKAGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFLTRHYLHTLWKAGVLYKRETSRSASFCGSPYSWE..QE...L....Q.....HGRLDF..QT.ST..RHGDE..P..F...CS..............QSSG.IL.....SR.........S....PV.....................GPSVR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GKP......G...R.SG.II....R.AR.GH.STA--.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----v................................................................................................................................................................................................
Q00KA8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNHRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNTTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVF..QT.SK..RHGDK..S..V...CP..............QSSG.IL.....SR.........S....PV.....................GPCVQ........S.....QL....RQ...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AG.IH.SSPWG.T.I.....G........VE.....P....S..GSGH.....TH.I.SAS........SSSSCLH..QS.AGRK.A..AYSPVSTS..KRHSSS.SHAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSDYCLFHIVNLTE..DWGPC.................................................................................................................................................................................................
L0HAA9_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..K..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQENIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..V...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LDG.........RKQ......G...G.SG.SI....R.AR.VH.PSPRG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...LPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C7DN49_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPIFNPNWK.TPSFPDIHLHQDIIKKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.SAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVSS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
G1E801_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SF....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKYSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B0YGJ4_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.TI....P.GG.IH.PTARR.P.F.....G........GE.....P....S..GSGH.....TT.N.LAN........ESSSCLY..QS.SLRK.G..ADPSVSTF..ERHSCS.GHAVKL.H.N...FPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
S6A032_HBV/1-341                 ....................................-----------LLLD..N..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LD..VNIPWTHKVGNFTGLYSSTVPCFNPEWK.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKSGILYKRETSRSASFCGSPYSWE..QD...L....Q.....HGRLVF..ET.SK..RHGDK..S..L...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....KL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSSWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRE.A..AYSLISTS..KGHSSS.GHAVEL.P.H...LPQ....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEFCLYHIVNLVD..DWGPC.................................................................................................................................................................................................
C1K1Y1_HBV/1-337                 ....................................MPLSYQHFRKLPLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..HE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.GI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...---....--...-......---.------S...CWW.LQFRNNKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
V5JE40_HBV/1-329                 ....................................------------LLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRXASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYSAVSTF..AKHSSS.GHAVEF.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFGNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D2JN10_HBV/1-117                 ....................................MPLSYPHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIRWTHKVGNFTGLYSFTVPRFNPDWQ.TPSFPDIHLQEDMVDRCKHFVGPLTVKENRRLKLX------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----xxxxxxx..........................................................................................................................................................................................
B8PTB7_HBV/1-341                 ....................................MPLSCQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTAPVFNPNWQ.TPSFPDIHLHQDIIDKCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYFPPDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...CQ..............QPAG.IF.....SR.........A....PV.....................GPSVQ........S.....QH....KQ...SRLG.L....QSP..Q...G....H.LAR.........GHQ......G...R.SG.SI....W.AR.VH.STSRR.S.F.....G........VE.....P....T..GSGR.....HH.N.IAS........SSSSCLH..QS.AVGK.A..AYSHLSTA..ERHSSS.GHAVEL.H.S...VPP....NS...A......GSQ.SKGSVFP...CWW.LQFRNSEPCSDFCLHHIVNLLQ..DWGPC.................................................................................................................................................................................................
O71306_9HEPA/109-391             .......................pnvraplshvvra---------------..-..-...-.....--------------------ATID..L..P.R.LG..NKLPARHHLGKLSGLYQMKGCTFNPEWK.VPDISDTHFNLDVVNECP----------SRNWKYLTPAKFWPKSISYFPVQVGVKPKYPDNVMQHESIVGKYLTRLYEAGILYKRISKHLVTFKGQPYNWE..QQ...H....-.....---LVN..QH.HI..YDGAT..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----sskingrqtdrrrrntvkptcrkddpkrdfdmvrqvsnarsrvrpcannggdkhppesgslacwggkesriiksdssrdssapvdsrgrpkstrsfsplsrrkttgnhhhssvfpssveattrgrst..................................................................
B3V8W2_HBV/1-337                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLDEELPRLADEGLNRRVAEELN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLDF..QT.SK..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....A..GSGR.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...---....--...-......---.------S...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B0FCQ1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPHLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTAPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TN.N.CAS........NSSSCLH..QS.AVRK.A..AYSHISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
X4ZD45_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWR.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..ADSHFSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DE24_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
D4QGJ3_HBV/1-352                 ....................................MPLSYQHFRKLLLLE..E..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSSVPCFNPKWQ.TPSFPNIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTGHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....S.MAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.I.V.....G........VE.....P....S..GSGP.....TL.I.CVS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....LS...S......WAQ.SQGPVLS...CWW.LQFRNSEPCSDYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
I0DCX8_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSSVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q4FD45_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYRRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..P..V...YS..............QSSG.IL.....SQ.........S....PV.....................GPSVQ........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GKQ......G...R.SG.II....R.AR.VH.STTRQ.P.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVQK.T..AYSHLSTS..KRQSSS.GHAVEL.K.H...IPP....SS...A......RSQ.SEGPILS...CWW.LKFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0E6G4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPIFS...CWW.LQFRNSKPCSDYCLXHIVNLLE..DWGPC.................................................................................................................................................................................................
H9BE04_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWPHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..HE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AW.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....DK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
F5C1A3_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELSRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....PR.........S....SV.....................GPRIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
R9Q8J5_HBV/1-114                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....VG.H.SAS........SSSSCLH..QS.AVRK.A..AYSHFSTS..KRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFP...CWW.LQFRNTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
S6A6U6_HBV/1-340                 ....................................------------LLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.X.LN..VSIPWTHKVGNFTGLYSSTVPCFNPEWQ.TPSFPNIHLQEDIVDRCKQFVGPLTXNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..KT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....X.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSTWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSXISTS..KGHSSS.GHAVEL.H.H...FSP....NP...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
D3YGJ8_HBV/1-327                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWTAGILYKRETTRSASFCGSLYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....SK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SC.--....-.--.--.-----.-.-.....G........GE.....P....S..GSGH.....TT.N.LAN........KSASCLY..QS.TVRK.A..AYPSDSTF..EKHSSS.GHAVEL.H.N...LPT....NS...A......RSQ.SERPAFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
H9XRG9_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
Q6QZQ7_9HEPA/64-220              ............................plshvvra---------------..-..-...-.....--------------------ATID..L..P.R.LG..NRLPAQHHMGKLSGLYQMKGCSFNPEWK.VPDISDTHFDLQVVNECPS----------GNWKYLTPAKFWPKSISYFPVQAGVKAKYPDNVMQHEAIVGKYLNRLYEAGILYKRISKHLVTFKGKPYNWE..LQ...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----ylvkqhqvpdgtttsking..............................................................................................................................................................................
F5C0S4_HBV/1-333                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADKDLNRRVAKDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...SRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.S.....G........VE.....P....S..VSGH.....TN.N.FTS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVE-.-.-...---....--...-......---.------P...CWW.LQFRDSEPCSDYCLSHLVNLLP..DWGPC.................................................................................................................................................................................................
B5BPN7_HBV/1-337                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVQ........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GTS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...---....--...-......---.------T...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
DPOL_HBVB3/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCQQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..C...CP..............QSPG.IL.....SR.........S....SV.....................GPCIQ........S.....QL....RQ...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLVSTS..KGYSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C7DMF8_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PD..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDG.........SQQ......G...R.SG.SI....R.AG.VH.SPARR.P.F.....G........VE.....P....S..GSRH.....AN.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....TS...A......ESQ.SKRSGFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
H9XQZ9_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....IH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
L0HCU7_HBV/1-352                 ....................................MPLSCQHVRKLMLLY..D..E...A.....GRIEEELPRIANEGLNRRVAEDVN..L..G.N.LN..VSIPWTHKVGNFTGLYSFTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..P..F...CS..............QSSG.IL.....SR.........S....PV.....................GPSVQ........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GKP......G...R.SG.II....R.AR.VH.STTRQ.P.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LKFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q81131_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSTPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLEKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLLF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....A..GSGH.....ID.N.RAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8T8_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.IPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..V...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C941_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQLVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....S.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B9VAY1_HBV/219-283               ..................................kq---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..-----STS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
C7DM38_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTLPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AN.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVSS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
Q6Y5I1_HBV/1-352                 ....................................MPLSYPHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPTFNPDWL.TPSFPDIHLHQDLIHKCEQFVGPLTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGSTSI..ND.SK..GHGTE..S..L...CT..............QSSG.IL.....SR.........P....SA.....................GSSFQ........G.....KF....QQ...SRLG.L....QQK..Q...G....Q.LAN.........GKQ......G...R.SG.RI....R.SW.VH.TPTRW.P.V.....G........VE.....S....T..GTGC.....AY.N.IAS........RSASCFH..QS.AVRE.K..TNPSLSTS..KRHSST.GHAVEL.H.S...VPP....GS...V......RSE.SKGSVFS...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
I0C913_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..VWGPC.................................................................................................................................................................................................
D0E588_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTLPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
E5RPR7_HBV/1-343                 ....................................---------KLLLLD..D..E...A.....GPLEEELPRLADDGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNTEWQ.TPSFPDIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SE..RHGDE..S..V...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...TRLG.L....QPQ..Q...G....S.LAK.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.P.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.A..AYSHLSTS..KRQSPS.GHAVEL.H.S...IPP....SS...A......RSQ.SEGPLFS...CWW.LQFRNSKPCSDYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
D0E5R1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.Y.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KRHSSS.GHAVEL.H.H...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
W8PRM8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPDIHLREDIINRCQQYVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVL..QT.SE..RHGDE..S..F...CS..............KSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.GG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....A..GPGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AHSHHTTS..KRHSSS.GHAVEL.H.S...IPS....SS...A......RSQ.SKGSVFS...CWW.LQFRGSKPCSEYCLSHLINLHE..DWGPC.................................................................................................................................................................................................
Q4FDM2_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDE..S..C...CS..............QSSG.IL.....SR.........S....PV.....................GPCIQ........S.....QY....KQ...SRLG.L....QPQ..Q...G....S.MAR.........GXA......G...R.SG.IL....R.AR.VH.STTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.STS........SASFCLH..QS.AVRK.T..AYSHFSTS..KRQSSS.GRAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8I7_HBV/1-350                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...PRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.F.....G........VE.....P....S..VSGH.....TN.N.FAS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVEL.Y.S...IPP....SS...T......KSQ.SQGPV-S...CWW.LQFRDSEPCSDYCLSHLVNLLQ..DWGPC.................................................................................................................................................................................................
B5M550_HBV/1-341                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMRARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRFVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....S-...-......---.------S...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q19SZ4_HBV/1-340                 ....................................MPLSYPHFRRLLLLD..D..E...A.....GPLEEELPRLPDEDLNRRVPEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIRLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...TQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........CQQ......G...R.SR.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..ANPAVSTF..ERHSSS.-HTVEL.H.S...IQT....NS...T......RSQ.SERPVSP...CWW.LQFKNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
U3RCE3_HBV/1-218                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPNIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSVQ........S.....K-....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----hq...............................................................................................................................................................................................
I0DC78_HBV/1-321                 ....................................---------------..-..-...-.....----------ADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLQEDIVDRCRQFVGPLTKNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSTG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QST..Q...G....H.LAG.........RQQ......G...G.SG.SI....R.AR.VH.TSPRG.P.V.....G........VE.....P....S..GSGH.....TH.N.CAS........---SCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSAYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
G9BNK2_HBV/1-293                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNERRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVS..QT.SQ..RHGDE..S..F...GS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAT.........NQP......G...R.SG.SI....R.PR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....VG.Y.SAS........NSSHCLH..QS.AVRK.A..AYSHLST-..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
A9CM78_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADAGLNHRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPDIHLQEDIVDRCKNFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTHSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..P..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RPQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.I.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSEYCLSHIVKLID..DWGPC.................................................................................................................................................................................................
D6QVI3_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTINEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGXLYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCIR........S.....QF....TQ...SRLG.F....QPQ..Q...G....S.MAS.........GTP......G...R.SG.IL....R.AR.VH.STTRQ.P.F.....G........VE.....P....S..GSGH.....ID.N.STS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQPSS.GHAVEL.Q.H...IPP....SS...A......GSQ.SEGPILS...CWW.LQFRNSKPCSDHCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DGF4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGIR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GKP......G...R.SG.II....R.AG.VH.STTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.STS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DCS0_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSXXPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPXHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHIVNLRE..DWGPC.................................................................................................................................................................................................
D0UE49_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
A9CM53_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GALEEELPRLADPDLNHRVAEDLN..L..G.D.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIIDRCTQFVGPLTPNENRRLKMIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVC..QT.SK..RHGDK..S..F...RP..............QSSG.IL.....SR.........S....PV.....................GPCIQ........S.....QL....RQ...SRLG.P....QPT..Q...G....Q.LAR.........RQQ......G...G.SG.SI....R.AG.IH.SSPWG.I.I.....G........VE.....P....S..GSGH.....TH.L.SAS........SSSSCLH..QS.AGRK.A..AYSPFSTS..KRHSSS.SHAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
R9Q864_HBV/1-114                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
A6MG56_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....SR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEF.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLSHIVNLIE..DWGPC.................................................................................................................................................................................................
D0UE67_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVV..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SSSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I1UYW0_HBV/1-166                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWRAGILYKRETTRSA----------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
S5ZT61_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..QT.SS..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...R....S.LAR.........GQS......G...R.SG.SI....R.AR.VH.PTPRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........GTSSCLH..QS.AVRK.T..AYSHISTS..KRQSSS.GHKVEF.H.N...IPP....SS...A......RSQ.SEEPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q9IF27_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..VSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
H6UG83_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LT..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYTWE..QE...I....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....P.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..ERHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SEGPVFP...CWW.LQFRNSEPCSDHCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VKB4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..SSGS.....TH.N.YAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C3W494_HBV/1-232                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTIPVFNSHWK.TPSFPNIHLHQDIIKKCEQFVGPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEQIVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...I....H.....H-----..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....QQ...SRLG.F....QSQ..Q...G....H.LSR.........RQQ......G...R.SW.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----tl...............................................................................................................................................................................................
B5M5P6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.T.LN..VNIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCERFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFYGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEF.H.Q...IPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
I0C9C8_HBV/1-334                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.TVRK.T..AYSHLSTS..KRQSSS.GHAVEF.-.-...---....--...-......---.-------...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
F5C149_HBV/1-354                 ....................................MPLSYQHFRNVLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQGVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QE...L....P.....HGRLVI..QT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AIRK.A..AHSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
C3W3Z1_HBV/1-343                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTYTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QD...L....Q.....HGRLVI..KT.SQ..RHGDE..S..I...GS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.F....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.IH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.H.KVN........SSSSCLH..QS.AVRK.A..AHSHFSSS..KRQSSS.GHAMEF.H.C...PQP....N-...-......---.------S...CWW.LQFRNSKPCSDYCISXLVNLRE..DWGPC.................................................................................................................................................................................................
A7L372_HBV/1-30                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZZZ1_HBV/1-341                 ....................................-----------LLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..P..F...CS..............QSSG.IL.....SR.........P....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRW.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AXTK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPS....SX...A......RPQ.SEGPILP...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B7TU32_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.Y.F.....G........VE.....P....S..GPGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...VPP....SS...A......RSK.SEGPLFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
O42041_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..A..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.GG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........RASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q6XGP8_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVS..QT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQP......G...R.SG.SI....R.PR.VH.SPTRR.C.F.....G........VE.....S....S..GSGH.....IG.Y.SAS........SSSHCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVES.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRTTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
G4XI26_HBV/1-160                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NA.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......GSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D6QVG9_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCZQFVGPLTVNENRRLKLIMPARFYPNVTKYFPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCXQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.SH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.GAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPARS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
D0UDT4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSRH.....ID.N.SAS........SSSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SEGPISS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B5ASU7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...RS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GRAVEL.H.N...IPP....SS...A......RPQ.SEGPILP...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZEF4_HBV/221-279               ..................................ak---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..---GQS.GHAVEL.H.H...IPP....SS...A......KSQ.SEGPVFS...CWW.LQFRNSKPCSDYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
B2CY29_HBV/1-352                 ....................................MPLSYQYFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GQS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........NTSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D3TJC3_HBV/1-219                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPSFNPQWQ.TPSFPDIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....H-----..QT.ST..RHGDK..S..F...RP..............QSAG.IL.....SR.........S....PV.....................GPCIQ........S.....QL....RQ...SR--.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----sh...............................................................................................................................................................................................
D7NL90_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSTTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AHPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
L8EC24_HBV/1-272                 ....................................----------LLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTINENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VK.....P....S..XSGH.....AH.N.CAS........SSSSCLH..QS.AVR-.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
W6HWH8_HBV/1-315                 ....................................---------------..-..-...-.....-------------------AEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPSIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.Q.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.GQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B7TTI7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCIH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D5LEL7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEHCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
X4YRT2_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SR.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........NSSSCLH..QS.AVRK.A..AYSHISTS..KGHSSS.GHAVEL.H.H...FPP....SS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
L0H7M1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........A....SV.....................GPCIQ........S.....QL....KK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
G9G9Q7_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTS..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
X4ZED6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHXVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGIQ........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAR.........GKP......G...R.SG.II....R.AG.VH.STTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.STS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNRKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B2LWD3_HBV/1-347                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.S-----S...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
C7DMW6_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDG.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.STRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
F5C1B3_HBV/1-75                  ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPE--.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
I0C9G3_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLKEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPTVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSTG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QSI..Q...G....Q.LAG.........CQQ......G...G.SG.SI....R.AR.VH.PSPWG.L.V.....G........VE.....P....S..GSGH.....TH.N.CAS........STSFCLH..QS.AVRK.A..AYSLNSTS..KRHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVFS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
D5LC35_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSLG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SR.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...LPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
H6UN09_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QN...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
D3TJB1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....R.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GSCIQ........S.....QL....RK...SRLG.L....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SCSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHPVDL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
H6UGB7_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VNIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYTWE..QE...I....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAN........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQLRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G9G970_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
K0F4X6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTAPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYWPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
X4ZET7_HBV/236-291               ...................................k---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..-----S.GHAVEF.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B4YKK2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....QH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.FAS........KSASCLH..QS.PVRK.A..AYPVVSTF..AKHSSS.GHAVEL.H.N...LPS....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
D2JMM3_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....SK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.VR.VH.PSPWG.T.V.....G........VE.....P....S..GSGR.....TY.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQAPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C7AYV9_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..EetE...A.....GPLEDELPRLADEDLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPSFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLDI..NT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQS......G...G.SG.SI....W.AR.VH.PSTRR.C.S.....G........VE.....P....S..GSGH.....ID.Y.SAS........SSSSCLH..QS.AVRK.A..AYTHLSTS..QRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRNSKPCSEYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
B9VK86_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTIPVFNPEWQ.TPSFPNIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...RS..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAK.........SQS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTT..KRQSSS.GHAVEL.H.N...FPP....SS...A......RSQ.SKGPLLS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q19SW8_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPHLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGSFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.S.F.....G........VE.....P....S..GSGH.....AT.N.FAS........KSASCLH..QS.SVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
Q80H42_HBV/1-352                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSPTAPVFNPEWQ.TPSFPHVHLKEDIIDRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPGHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..HE...L....H.....HGRLVC..QT.SE..RHGDE..S..F...CS..............QSAG.IL.....SR.........S....PV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........SKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....TD.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...FPP....NS...A......RSQ.SKGPLLS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0UE58_HBV/1-345                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....H-----..--.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.MAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q68RN1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....H.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GSCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LDG.........RQQ......G...G.SG.SI....R.AR.GH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QP.AVRK.A..TYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
H6WFM8_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIH..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0UDQ9_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRW.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SSSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DD17_HBV/1-326                 ....................................---------------..-..-...-.....------LPRLADEGLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPTFNPDWL.TPSFPDIHLHEDLIHKCEQFVGPLTKNELRRFKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGSTSI..ND.SK..GHGTE..S..L...CT..............QSSG.IL.....SR.........P....XA.....................GSSIQ........G.....KF....QQ...SRLG.L....QQK..Q...G....Q.LAN.........GKQ......G...X.SG.SI....R.SW.LH.TPTRW.P.A.....G........LE.....P....T..GTGC.....AY.N.IAS........RSASCFH..QS.AVRE.K..TNPSLSTS..KRHSST.GHAVEL.H.S...VPP....GS...V......TSD.GKGSV--...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
Q6RSF7_9HEPA/65-385              .............................lshvvra---------------..-..-...-.....--------------------ATID..L..P.R.LG..NKLPARHHLGKLSGLYQMKGCTFNPEWK.VPDISDTHFKSEIINECP----------SRNWKYLTPAKFWPKSISYFPVQAGVKPKYPDNVMQHESIVGKYLTRLYEAGILYKRISKHLVTFKGQPYNWE..QQ...Y....-.....---LVN..QH.LK..PDGAT..SrkI...NG..............HSES.RR.....RR.........T....FV.....................TTTCR........K.....ND....T-...ERNC.H....MVR..Q...V....S.NIR.........SCV......R...P.CA.NN....G.GD.KH.PPTTR.G.M.....A........T-.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----rgrkesgvaeshssrdsstpvvsrrrsessrsfqkisgrtstgsdhhcsnitssvetatgrrssprksfaaghasavpesgtsdtchkdtpsqeenvwylrgntswpn.....................................................................................
H6WF62_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASRLY..QS.PVRK.A..AYTSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8T7_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..V...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
C6F562_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAN.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
S5ZZY5_HBV/1-338                 ....................................--------------D..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCQQFVGPLTINETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QXX..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.X.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.XVRK.A..AYSRISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVPS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
Q2LCF2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPHLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGSFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.S.F.....G........VE.....P....S..GSGH.....AT.N.FAS........KSASCLH..QS.SVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
A4F517_HBV/1-239                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLANADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQGDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..V...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----sqp..............................................................................................................................................................................................
Q05HA3_HBV/1-340                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTLPIFNPNWQ.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLKLVMPARFFPTSTKYLPLEKGIKPYYPNDVVNHYFQTRHYLHTLWEAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...NQ..............QSTR.IF.....SR.........P....PV.....................GPCIQ........S.....KH....QQ...SRLG.L....QPQ..Q...G....Q.LAK.........SQR......G...R.SW.SV....R.SR.PH.PSTRR.A.F.....G........VE.....L....S..GSGQ.....TN.N.CAN........KSASCLH..QS.AVRK.A..TYSPFSTS..ERHSSS.GHALE-.H.D...ISP....SS...A......RSQ.SEWAVFP...CWW.LQFRDSEPCSDYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
E9RGW9_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPTFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPTVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
DPOL_HBVB7/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKRESTHSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPP..Q...G....Q.LAG.........RPQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.I.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GRAVEL.H.H...FPP....NS...S......RSQ.SQGSVPS...CWW.LQFRNSKPCSEYCLCHIVNLID..DWGPC.................................................................................................................................................................................................
S5ZZU3_HBV/1-340                 ....................................------------LLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.XN..VSIPWTHKVGNFTGLYSSTVPCFNPXWQ.TPSFPNIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SXLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GRAVEL.H.H...FPP....NS...S......RYQ.SQGPVPS...CWW.LQFRNSEPCSEYCLCHIVNLIX..DWGPC.................................................................................................................................................................................................
H6UN05_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEF.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
B7TV09_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPCFNPEWQ.TPSFPDIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSTWG.T.V.....G........VE.....P....S..GSEH.....IH.N.CAS........SSSSCLH..QS.AVRK.A..AYSRNSTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGTVLS...CWW.LQFRNTEPCSEHCLYHIVNLIE..DWGPC.................................................................................................................................................................................................
Q20BX1_HBV/1-55                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..---SSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWG--.................................................................................................................................................................................................
A5JIH1_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRE.A..TYPAVSTF..ERHSSS.SHAVEF.H.N...FPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZED0_HBV/1-318                 ....................................---------------..-..-...-.....----------------RRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAR........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
X4ZFB5_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPRG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B5M5B4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRW.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPISS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
F5C199_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....PR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AHSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
I0DGI8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CX..............QSSG.IL.....SR.........S....PV.....................GPCIR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........STP......G...X.SG.XL....R.AR.VH.STTRX.S.F.....G........VE.....P....S..GSGH.....ID.N.XTS........XASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GXAVEX.X.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D8V9Z2_HBV/44-150                ........................dfnpnkdqwpaa---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........-N.....Q....V..GVGS.....LE.P.GAS........RASSCLH..QT.AVRK.T..AYSHFSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LKFRNSTPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VK82_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..P..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.IR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ND.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRKSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZZR8_HBV/1-337                 ...................................k---------------..-..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCLQ........S.....QL....RK...SRLG.L....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGL.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHASS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVPS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
I7JHT9_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
G1C8Q1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQRETTHSASFCGLPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.F....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.TTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLH..QS.PVRK.A..AYSSVSTF..ERHSSS.SHAVEL.H.N...LPS....NS...A......RSQ.SERPVFP...CWW.LQFRNSQPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I6XQJ8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVLVFNSEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IN.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q8QMM4_HBV/1-342                 ....................................MPLSYPLFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTAPVFNSEWQ.TPSFPDIHLRQDIIDKCQQFVGPLTINEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWEAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...RY..............QSSG.IL.....SR.........A....SV.....................RPSGQ........G.....QL....KQ...SRLG.L....QPA..Q...G....Q.LAR.........SHQ......G...R.SG.SI....R.AR.VH.PTTRR.S.S.....G........VE.....P....S..GSGT.....NNnN.IAS........SSSSCLH..QS.AVRK.A..TYSHLSTF..EGHSSS.GHAVEL.H.G...IPQ....NS...T......RSQ.GEGPVFS...CWW.LQFRNSEPCSEYCLSHIVNLLD..DWGPC.................................................................................................................................................................................................
D5LEA7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEHCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
Q1JUR4_HBV/1-340                 ....................................MPLSYPHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPGFNPEWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDE..S..F...CP..............QSAG.IL.....SR.........S....PV.....................GPCIQ........S.....QL....RQ...SRLG.P....QPT..Q...G....L.LAG.........LQQ......G...G.SG.SI....R.AG.IH.STPRG.T.V.....G........VE.....P....S..SSGH.....TH.N.CAS........SSSSCLH..QS.AGSK.A..AYSPVSTS..KGHSSS.GHAMDR.P.Q...VPK....--...-......---.------F...CWW.LQFRNSEPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
W0NTS1_HBV/1-341                 ....................................MPLSYQHFRRLVLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VDIPWTHKVGNFTGLYSTTVPVFNPHWK.TPSFPNIHLHQDIIDKCEQFVGPLTVNEKRRLKLIMPARFFPKCTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRESTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IP.....SR.........S....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.VH.PTARR.P.F.....G........VE.....P....S..GSGH.....ST.N.FAS........KSASCLY..QS.PVRT.A..AYPAVSTS..ERXSXS.GHTXEL.H.Y...LPT....NS...A......RSQ.SERPVSP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
E5F0X3_HBV/1-49                  ...................................f---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.H.S...FSP....SS...A......RSQ.SQGPVFS...CWW.LQFRNTQPCSQYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
R9Q8L8_HBV/1-97                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....IG.H.SAS........SSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVE-.-.-...---....--...-......---.-----FP...CWW.LQFRNTQPCSKYCLSHLVNLLK..DWGPC.................................................................................................................................................................................................
H9XQM1_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NA...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
A0MML8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..Q..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPAGFYPNGTKYFPLDKGIKPHYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.GH.SSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRR.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......GSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B9VKL5_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....TD.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B5A2F0_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....W.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
E5F0Y0_HBV/1-49                  ...................................l---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.N.P...VPP....GS...V......GSQ.GKGSVPP...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
S5ZFC1_HBV/1-336                 ....................................---------------..-..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPESVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAG........SSSSCLH..QS.AVRK.A..AYSLISTS..KGNSSS.GRAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
A8IES5_HBV/1-52                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.--AVEL.N.P...VPP....GS...V......GSQ.GKGSVLP...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
X4Z0M4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQENIVDRCEQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.VR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLNSTS..KGHSSS.GHEVEL.H.H...FPP....NS...S......RSQ.SQGPVLP...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
G4XMP7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCFR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHTVEF.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
H9XR98_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
A5JI87_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..SSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
L0BEA4_HBV/1-210                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-------HLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYSVYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.TK..RHGDK..S..F...CP..............QSPG.IL.....SR.........S....PV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
C6F4Z4_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAN.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
D3TIJ9_HBV/284-316               ..................................aa---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.------S...CWW.LQFRDSEPCSEYCLCHIVNLID..DWGPC.................................................................................................................................................................................................
B0FC59_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.I.....G........VE.....P....S..GSGP.....TH.N.CTS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
L0BDI7_HBV/1-210                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-------HLQEDIINRCQHFVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GNS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.ADRK.T..AYSLISTS..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
R4NVI8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.SAPRG.T.V.....G........VE.....P....S..GSGH.....TY.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B7TTT0_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNSEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....W.SR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IN.N.SAS........STSSCFH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....LS...A......RSQ.SEGPIFC...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D0E5C5_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IN.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...ISP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q1HHA7_HBV/1-334                 ....................................MPLSYQHFRRLVLLD..D..E...A.....GPLEEELPRLEDEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPYIHLPQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQLVNHYFQTRHYLHTLWKAGVLYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QFSG.IL.....SP.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.S.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVKK.A..AYPSVSAF..ERHSSS.GHAVEL.N.N...LPT....NS...A......RS-.------P...CWW.LQFRNSKPCSDYCISHIVNLLE..DWGPC.................................................................................................................................................................................................
Q6RSG7_9HEPA/65-236              ......................lsrvllgtttdlpr---------------..-..-...-.....------------------------..-..-.-.LG..NKDPARHKLGKLSGLYQMKGCEFNPQWK.VPDISDTHFNLDIINECP----------SRNWKYLTPAKFWPKSISYFPVHSGVKPKYPDDVAGHEQIVGQYLTKLFEAGILYKRESKHLVTFKGTPYQWE..RQ...Y....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----lvnqpadlhgaatskingrkksrrsgtppsttgr...............................................................................................................................................................
I0C894_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...G.SG.SI....R.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVSS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
D3TJA4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPHLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KRHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
D6QVK8_HBV/1-352                 ....................................MPLSYQHFRKLLLLE..E..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLNLIMPARFYPNVTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....P.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RX...XRLG.P....QPA..Q...R....Q.LAG.........RXQ......G...G.SG.SI....R.AR.VH.PSPWG.X.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..LS.AVRK.A..AYSLNSTS..KGHSSS.GHAVEL.H.H...FPP....NY...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLSHIVNLTE..DWGPC.................................................................................................................................................................................................
L7PDC4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSKPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C3W3W6_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LT..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKRCEQFVGPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....QQ...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.VH.PTARR.P.I.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCLH..QS.SVRK.A..AHPAVSTV..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCISHIVNLLE..DWGPC.................................................................................................................................................................................................
G4XHW7_HBV/1-160                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.VH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHASS.GHAVEL.H.N...RPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
H9XR90_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLXSTS..KRHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVXS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
Q9IF49_HBV/1-172                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....HGRLVF..QT.SE..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RN...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TY.N.CAS........SSSFCLH..QS.AVRK.T..AYSLISTS..KGHSSS.GHEVEL.P.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B3GED9_HBV/1-33                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.----VFP...CWW.LQFRSSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
H1ACV2_HBV/1-352                 ....................................MPLSYQLFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPDIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..P..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RPQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.I.CAS........SSSSCLH..QS.AVRK.A..AYSLVSTS..KGHSSS.GHAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSEYCLSHIVNLIE..DWGPC.................................................................................................................................................................................................
E5RD97_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.V.....G........VE.....P....S..GSGH.....IT.N.FAS........KSASCLH..QS.PVRK.A..AYPTVSTF..EKHSSS.GHAVEL.H.K...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
D0EDS2_HBV/1-330                 ....................................MPLSYQHFRNVLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLINHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAK.........RQQ......G...R.SW.SI....R.--.--.-----.-.-.....G........GE.....P....S..GSGH.....NT.N.LAS........KSASCSY..QP.PVRK.A..AYPAVSTF..ERHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
A0A023NLD3_HBV/1-341             ....................................MPLSYQHFRRLVLLD..N..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRESTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KF....QQ...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AR.XH.PAARR.S.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCLY..QS.PXRT.A..AYPAVSAS..EKHSSS.GHAVEL.H.N...LPX....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
DPOL_HBVE4/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFSGLYSSTIPVFNPHWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
G9BNK2_HBV/292-323               ...................................s---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.------T...CWW.LQFRNTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
Q91C56_HBV/1-343                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QD...L....Q.....H-----..--.--..--GDE..S..F...TR..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AW.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYSHVSTF..EKHSSS.GHAVEF.H.C...LAP....SS...A......GSQ.RQGSVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
C5WJY2_HBV/1-352                 ....................................MPLSYQHFRRLVLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPGFNPDWQ.TPSFPDIHLQEDIVNRCEQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSSG.IL.....SR.........S....PV.....................GSCIQ........S.....QL....RQ...SRLG.P....QPT..Q...G....Q.LAG.........LQQ......G...G.SG.SI....R.DG.IH.STPWG.T.V.....G........VE.....P....S..SSGY.....AH.N.CAN........SSSSCLH..QS.AVRK.A..AYSPVSTS..KRLSSS.GHAVEL.H.H...VPP....NS...S......RPQ.SQGSVPS...CWW.LQFRNSEPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
B9VKJ2_HBV/1-274                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLQEDIVNRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.TR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STS----..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----c................................................................................................................................................................................................
Q5UFT1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAQNLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....P.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAN........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHAPS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VK19_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IN.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B2Y6Y1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLXDEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.XAS........KSASCLH..QS.PVRK.A..AYPAVSTF..AKHSSS.GHAVEL.H.N...LPS....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
E5F0Y3_HBV/1-46                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
F1AEV3_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...SRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.F.....G........VE.....P....S..VSGH.....TN.N.FAS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVEL.Y.S...IPP....SS...T......KSQ.SQGPVFS...CWW.LQFRDSEPCSDYCLSHLVNLLQ..DWGPC.................................................................................................................................................................................................
C9WDE3_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPKIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAN........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G9G9T1_HBV/1-274                 ....................................MPLSYQNLRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..CSIPWTHKVGNFTGLYSSTVPVFNPYWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.NI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----h................................................................................................................................................................................................
S5ZSJ0_HBV/1-340                 ....................................------------LLD..Q..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VXIPWTHKVGNFTGLYSSTVPXFNPXWQ.TPSFPDIHLQEDIVDRCXQFVGPLTVNETRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFXGXPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..X...CP..............QSPG.IL.....PR.........S....XV.....................GPCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.XH.PSPXG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRX.A..ADSLNSTS..KGHASS.GRAVEL.H.H...FPP....NS...S......RSQ.SQGPVPS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B7TU51_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTAPVFNPEWQ.TPSFPHIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRSVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAG.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SAGPIFS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
C7AYU1_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEDELPRLADEDLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPSFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....H.....HGRLDI..NT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SI.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQS......G...R.SG.SI....W.AR.VH.PSTRR.C.S.....G........VE.....P....S..GSGH.....ID.Y.SAS........SSSSCLH..QS.AVRK.A..AYTHLSTS..KRQSSS.GHAVEF.H.S...FPP....SX...A......RSQ.SQGPVFS...CWW.LQFRNSXPCSEYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
E0D2T3_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LSP....SS...A......GSQ.SQGSVSS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
H1ACY0_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..N..D...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPDIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFFPNVTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRESTHSASFYGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........P....SV.....................GPRIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RPQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.I.CAS........NSSSCLH..QS.AVRK.A..AYSPVSTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
L0BC82_HBV/1-210                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-------HLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKRETTRSTSFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPK..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGP.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSLISTS..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
Q5R2Q3_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
R4NTV7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....W.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
Q91EI0_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEEPPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...G.SG.SI....R.AR.AH.PSTRR.Y.F.....G........LE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..TKQSSS.GHAVEF.H.C...LPP....ST...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B2LSL6_HBV/1-352                 ....................................MPLSYQHFRRLVLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKKGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RPQ.SERPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
B7TUL7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HERLDF..KT.ST..RHGDQ..A..F...CS..............QSSG.IH.....CR.........S....PL.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SE.SI....A.PG.VH.PTTRW.S.F.....G........AE.....P....S..SSRH.....ID.N.TAS........ITSSCLH..QS.PLGM.T..GYSHLSTS..NIQSPS.GHALEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
M1G264_9HEPA/77-381              .............................pclgdks---------------..-..-...-.....------------------------..-..-.-.--..---PASHKLGKLSGLYQMKGCEFNPNWK.VPDITQTQFDLDIINECP----------SRNWKYLTPAKFWPKSISYYPREIGVKPKYPDNQKEHEAIVGIYLNKLYEAGILYKRDSKHIVTFKGKPYPWE..TK..yL....V.....IQRQQYgpKS.SK..INGHS..-..-...SS..............GRRG.II.....DS.........S....II.....................S----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----attkahsssnsqwsisinrtcygtcagsgrvkyftqtrtisgrnraclgstqsqatnvttrdmdtgrrqaglrdlckisgrtrssfkrirkeagscqtatttrkttnrpcvesdregdsvrriqyvvaagsssnqgakgsqkedvy...............................................
A9QPW2_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEDELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNSNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........RQQ......G...R.SG.SI....W.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...T......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
Q3ZKJ4_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPSWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....VT.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEL.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
I0C985_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...SRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.F.....G........VE.....P....S..VSGH.....TN.N.FAS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVEL.Y.S...IPP....SS...T......KSQ.SQGPVSS...CWW.LQFRDSEPCSDYCLSHLVNLLQ..DWGPC.................................................................................................................................................................................................
G4XMF5_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SEGPISS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8V9_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...V.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CF..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
I0DCP2_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIINKCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QV...L....H.....HGRLVF..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQS......G...R.SG.SI....R.PR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....IG.Y.SAS........SSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRDTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
F1AET9_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
S5ZDW4_HBV/1-340                 ....................................------------LLD..E..E...A.....GPLEEELPRLADEGLNRRVADDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDILDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GSCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSTWG.T.V.....G........VE.....P....S..RSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...VPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSQPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
S6A029_HBV/1-336                 ...................................g---------------..-..-...A.....GPLEEELPRLADEGLNRRVAEELN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....TV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.GG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVPS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
M9PN08_HBV/1-22                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.-----SEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
S5ZLP4_HBV/1-337                 ....................................---------------..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPXFPDIHLKEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AX.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGDSSS.GHAVAP.H.H...FLP....NS...S......RNQ.CQGPELS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
H6WFD0_HBV/1-112                 ..................................wn---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.-I....R.AG.IH.PTARR.P.P.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..ERHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCISHIVNLLQ..DWGPC.................................................................................................................................................................................................
B2CSC6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..Q..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPNIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.CI....R.AR.VH.PSPWG.I.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVER.H.H...VPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
S6A716_HBV/1-340                 ....................................------------LLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPXWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.XR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVXS...CWW.LQFRNSEPCSEYCLCHIXNLIE..DWGPC.................................................................................................................................................................................................
K0FGW6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLVMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IN.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
G4XI63_HBV/1-160                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NA.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q20BV7_HBV/1-57                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..---SSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
F5C0M5_HBV/1-354                 ....................................MPLSYQHFLKLLLLD..DgtE...A.....GPLEEELPRLADEDLNRRVAEDPN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVT..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQS......G...R.SG.SI....W.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.H.SAS........NSSSCLH..QS.AARK.A..AYSHLSTS..KRQSSS.GHAVDF.H.S...FSP....NS...A......RSQ.SQGPVSS...CWW.LQFRNSKPCSEYCLSHLVNLLD..DWGPC.................................................................................................................................................................................................
G1E7E7_HBV/1-252                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....CK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTSRR.P.F.....G........VE.....P....S..SS--.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----v................................................................................................................................................................................................
C1K205_HBV/1-342                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKARHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...GS..............QSSG.IF.....SR.........P....PV.....................GSCVR........S.....QL....KQ...SRLG.L....QSQ..Q...G....S.LAR.........GKS......G...R.SG.SV....R.TR.GH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVGK.T..AYSHLATS..KRQSSS.GHAMEL.H.N...IPP....SS...-......---.------S...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B5M5J0_HBV/1-352                 ....................................MPLSYQYFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LT..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..HE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...GS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....T..GSGP.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KGQSSS.GQSVEL.N.N...IPP....SS...A......RPQ.SEGPIPS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
V5JE52_HBV/1-342                 ...................................l-------------LD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSSVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
DPOL_HBVD5/1-341                 ....................................MPLSYQHFRKLLLLD..N..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSSVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFHTRHYLHTLWKAGILYKRVSTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....SV.....................GSSLQ........S.....KH....QQ...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.TR.VH.PTARR.P.S.....G........VE.....P....S..GSGH.....NA.N.LAS........KSASCLY..QS.TVRT.A..AYPAVSTS..ENHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVSP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q00K60_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQENIIDRCTQFVGPLTVNENRRLKLIMPARFFPNTTKYLPLEKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....H.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSSG.IL.....SR.........S....PV.....................GPCVQ........S.....QL....RQ...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AG.IH.SSPWG.T.I.....G........VE.....P....S..GSGH.....TN.I.SAS........SSSSCLH..QS.AGRK.A..AYSPFSTS..KRHSSS.SHAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSDYCLFHIVNLTE..DWGPC.................................................................................................................................................................................................
G1E8Q2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSLYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.GW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDHCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8S3_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..V...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAK.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSVSCIY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
L7R7I2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLAXEGXNXRVAKDXN..X..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTTRR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NA...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
A5LG34_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SQ..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VR.TSPWG.T.V.....G........VE.....P....S..GSGT.....TH.N.GAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B0FC31_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQARHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCIQ........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GTP......G...R.SG.IL....R.AR.VH.SSTRQ.S.F.....G........AE.....P....S..GSGY.....ID.N.STR........NASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CRW.LQFRNSKPCSDYYLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DE20_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPTFNPEWQ.TPSFPQIHLHEDISNRCEQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHXLWKAGILYKRETTRSASFCGSPYSWE..QE...L....P.....HGRLVI..XT.SQ..RHGDE..P..F...CS..............QPAG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPC..Q...G....P.LAT.........SQP......G...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....P....S..GPGH.....IG.H.SAS........SSSSCLH..QS.AVRK.A..AYSHHSTS..KRQPSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRDTQPCSEYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
M9PMV2_HBV/1-49                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.-----F.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
B5M560_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLVMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SR.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGP.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEF.H.N...IPP....SS...A......RPQ.SEGPIPS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D5MSI1_HBV/1-343                 ....................................---------KLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLT..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPGFNPEWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSSG.IL.....SR.........S....PV.....................GSCIQ........S.....QL....RQ...SRLG.P....QPT..Q...G....Q.LAG.........LQQ......G...G.SG.SI....R.DG.IH.STPWG.T.V.....G........VE.....P....S..SSGH.....AH.D.CAN........SSSSCLH..QS.AVRK.A..AYSPVSTS..KRLSSS.GHAVEL.H.H...VPP....NS...S......RPQ.SQGSVLS...CWW.LQFRNSEPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
B5BPT8_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PITRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SSSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....NS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8F2_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNERRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....VD.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEL.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
E5RD93_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEDELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTSRR.S.F.....G........VA.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPIFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q75TL6_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARW.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G1E842_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..N..E...A.....GSLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSVPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLD..QS.PVRK.A..AYPSVSTF..EKHASS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VKT9_HBV/1-352                 ....................................MPLSYQRFRKLLLLD..G..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRE.T..AYSHLSTS..KRQSSS.GHAVEL.H.D...IPP....SS...A......RSQ.SEGPISS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G4XHZ6_HBV/1-160                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
G4XI80_HBV/1-54                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8F5_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....VD.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEL.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
F5C1A6_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....PR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B5TFG5_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.CAS........KSASCLH..QS.PVRK.A..AYPDLSTF..ERHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERAVFP...CWW.LQFRNSQPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
I0C9G1_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLKEDIVDRCKQFVGPLTVNETRRLKLIMPTRFYPTVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSTG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QSI..Q...G....Q.LAG.........CQQ......G...G.SG.SI....R.AR.VH.PSPWG.L.V.....G........VE.....P....S..GSGH.....TH.N.CAS........STSFCLH..QS.AVRK.A..AYSLNSTS..KRHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVFS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZEK4_HBV/1-342                 ....................................----------LLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEELN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.IPSFPNIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...GS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..DSGH.....ID.N.SAS........STSSCLH..QS.AVRT.T..AYSHLSTS..KRQSSS.GHTVEL.H.N...IPP....SS...V......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DD97_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..P..F...CP..............QSTG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QSI..Q...G....Q.LAG.........CQQ......G...G.SG.SI....R.AR.VH.PSPWG.L.V.....G........VE.....P....S..GSGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSK.SQGSVLS...CWW.LQFRNCEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
Q1PCY0_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QLA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
C5WK02_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSNVPVFNPEWQ.TPSFPDIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLFF..QT.SK..RHGDE..S..F...CS..............QSSG.IL.....AR.........P....SV.....................GPGFR........S.....QF....KQ...SRLG.L....QPQ..Q...G....P.LAR.........GLA......G...R.SW.SI....R.AR.VH.PTTRR.P.F.....G........VE.....P....A..GSGH.....ID.N.SAS........SSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEL.H.N...ISS....SS...A......RSQ.SKRPILP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B7TV41_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRFVF..QT.ST..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....PV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPISS...CWW.LQFRNSKPCSDHCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D0E698_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGP.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I1UYR5_HBV/1-166                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWRAGILYKRETTRSA----------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
Q8V1J2_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPDLTKYLPMDKGIKPYYPEYAVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSSYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GSCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAG.........GKS......G...R.SG.SI....R.AR.VH.STTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSSS..ERQSSS.GHAVEL.H.N...LPP....NS...S......RSQ.GERPVFP...CWW.LQFRHSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0U3Y5_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..EgtE...V.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSTTVPTFNPDWQ.TPSFPKIHLHEDIINRCQHFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..NT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....W.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.H.SAK........GSSSCLD..QS.AVRK.A..ADSHLSTS..KRQSSS.GHTVEF.H.N...LPP....SS...A......RSQ.SQGPVFS...CWW.LQFRNSKPCSEYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
G1E8A7_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..N..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........T....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.MAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.HAN........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GYAVEL.H.K...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSTPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VL41_HBV/1-242                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...S.SG.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----l................................................................................................................................................................................................
Q6XGT3_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....IG.H.RAS........DASSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
M1G266_9HEPA/70-376              .......................qevqedpprlgdk---------------..-..-...-.....------------------------..-..-.-.--..--SPASHKLGKLSGLYQMKGCEFNPDWK.VPDITQTQFDLDIINECP----------SRNWKYLTPAKFWPKSISYYPREIGVKPKYPDNQKEHEAIVGIYLNKLYEAGILYKRNSKHIVTFKGKPYPWE..TK...Y....-.....---LV-..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----iqrqqygpksskinghsssgrrgvidssinsainktyapsnsqwsfsinrtcygtcagsgrvkyftqtrtlsgrnravlgsnqskssqstsrdldpgrrqaglrdlcqisgrtrscfkgvrketgscetstttrktttrpcvesdrerdsfrriqyvvaagsasnqsaqgpq.....................
Q81110_HBV/267-401               ........................itnfllslgihl---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....NGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VP.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.RAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVE-.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
B7TUK6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..Q..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.I.LN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKTYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.XH.PSPWG.T.V.....G........VE.....P....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RPQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
B5M5W6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....TD.N.SAS........STSSCLR..QS.AVRK.T..AYSHLSTS..KRQSSS.GCEVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
F5C178_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRSVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....PR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
A5JIK3_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSTSCLH..QS.PVRK.A..AYPAVSTF..EKHSSS.SHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
Q461A0_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADDDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSP.GHAVEF.H.N...IPP....SS...A......RSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
A5JI17_HBV/1-112                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.-G.SI....R.AG.IH.STPWG.T.V.....G........VE.....P....S..SSGH.....TH.N.CAN........NSSSCLH..QS.AGRK.E..AYSPVSTS..KRHSSS.GHAVEL.H.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
S5ZSM9_HBV/1-342                 ....................................----------LLLLD..P..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.T.LN..VSIPWTHKVGNFTGLYSSTVPCFNXNWQ.TPSFPDIHLQEDIVDRCXQFVGPLTVNEXRXLKLIMPARFYPHVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHILWKAGILYKRESTRSASFXGSPYSWE..QD...L....Q.....HGRLDF..QT.SK..RHGDK..S..V...CP..............QSPG.IL.....TR.........S....SV.....................GSCIQ........S.....RL....RK...SRLG.P....QPS..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.N.V.....G........VE.....P....S..GSGH.....TH.N.CAS........NSSSCLH..QS.AVRK.A..AYSHISTS..XGHASS.GXAVEF.H.H...FPP....NS...S......RFQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIX..DWGPC.................................................................................................................................................................................................
Q7TDS4_HBV/1-340                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPDWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...GS..............QSSG.IL.....SR.........S....PV.....................GPCIR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GTP......G...G.SG.IL....R.AR.VC.STTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.ITS........RASSCLH..QS.AVRK.T..AYSHLSSS..KRQSSS.GHAVEL.Q.H...IPP....--...-......---.------S...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C978_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPDWQ.TPSFPKIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
I0C8T2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..V...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHGVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D6QVH6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.D.LN..VSIPWTHKVGNFTGLYSSTVPCFNTEWQ.TPSFPNIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.S....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........ME.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.XHEVEL.H.H...FSP....NS...P......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLXHIVNLIE..DWGPC.................................................................................................................................................................................................
A6MFW8_HBV/1-352                 ....................................MPLSYEDFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNEIRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKREXTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.L....QST..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.P.V.....G........VE.....P....S..GSGH.....TH.N.CAS........STSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPS....NS...S......RSQ.SQGSVLS...CWW.LQFRNSKPCSEYCLCHIINLLE..DWGPC.................................................................................................................................................................................................
K7QG44_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHXHLQEDIINRCQQYVGPLTVNEKRRLXXIMPARFYPNLTKYLPLDXGIKPYXPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDK..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.IH.PTTRR.Y.F.....G........VE.....P....S..GSGH.....ID.N.SAR........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
A9QPV5_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HL..............QSSG.IL.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........RQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
D2U650_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPAKFYPISTKYLPLEKGIKPYYADNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QK...A....T.....SGAF-L..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....W.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLVE..DWGPC.................................................................................................................................................................................................
I0C927_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....S.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
D2X5F1_HBV/4-171                 ...........................wsskprkgw---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..---GQ..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....KK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.SHAVEL.H.N...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
D5LF64_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPNIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..KT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPT..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.SSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..KGHSSS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
I0C8B1_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVINHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPGIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVSS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q765Y0_HBV/1-337                 ....................................MPLSYQHFRKLLLLD..P..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDE..S..F...CS..............KSSG.IL.....DR.........A....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.MAR.........GKS......G...R.SR.SI....R.AR.VH.PTTRR.S.F.....G........LE.....P....S..SSGH.....TD.N.SAS........SASSCHY..QS.AVRE.K..AYSHISTS..ERQSSS.SHAVEL.H.N...---....--...-......---.------T...CWW.LQRRNSKPCSDYCLSHIDNLLE..DWGPC.................................................................................................................................................................................................
H9XQL1_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....TH.N.XAS........STSSCLH..QS.AVRK.A..AYSLISTS..KRHSSS.GHTVEL.H.H...FPS....NX...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLX..DWGPC.................................................................................................................................................................................................
C7DM31_HBV/1-342                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KY....QK...SRLG.P....QSQ..Q...R....P.LDG.........SQQ......G...R.SG.SI....R.AG.AH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......---.------T...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
B3IWX1_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...SRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.F.....G........VE.....P....S..VSGH.....TN.N.FAS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVEL.Y.S...IPP....SS...T......KSQ.SQGPVFS...CWW.LQFRDSEPCSDYCLSHLVNLLQ..DWGPC.................................................................................................................................................................................................
Q6XGQ5_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SF....R.PR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....IG.Y.SAS........SSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRNTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
G9G8U2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....T..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPIFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B2Y6W0_HBV/1-341                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSSXXVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAG.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTV..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZZR0_HBV/1-352                 ....................................MPLSCQHFRKLLLLE..E..G...A.....GPLEEELPRLADEGLNRRVAEDLG..L..G.T.LN..VSIPVTHKVGNFTGLYSSTVPCFNPHWQ.TPSFPDIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKRESTHSASFYGSPYSWE..HD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........SQQ......X...G.SG.SI....R.AR.VH.PSSWG.T.V.....G........VE.....P....S..GSGH.....TH.X.XAS........SSSSCLH..QS.AVRK.A..AYSHISTS..KGHSSS.GHAVEX.H.H...FPP....NS...A......XSQ.SQGPVPS...CWW.LQFRNSEPCSEYCLXHIVNLID..DWGPC.................................................................................................................................................................................................
F5C0Y3_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SGLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSARR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q0PMK6_HBV/1-352                 ....................................MPLSYQHLRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..F..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYFPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQS......G...R.SG.SI....R.AR.AH.PSTWR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGS--A...CWW.LQFRNSKPCSEYCLSHIVNLRE..DWGPC.................................................................................................................................................................................................
I0DE16_HBV/1-317                 ....................................---------------..-..-...-.....------LPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCIY..QS.PVRK.A..AYPAVSTL..EKHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
K4PXS0_HBV/1-81                  ...................................s---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........--SSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B6CJ06_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCXQFVGPLTVNEKRRLKLXXPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPXSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DXGPC.................................................................................................................................................................................................
E5RD17_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...GS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
Q8B4D1_HBV/1-325                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HW----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....-.--.--.-----.-.-.....-........--.....-....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
S5ZZX9_HBV/1-339                 ....................................-------------LD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.XN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGVLYKRESTRSASFYGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..GSGH.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLNSTS..KGHSSS.GHAVEL.H.H...VPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
D0E5V2_HBV/1-352                 ....................................MPLSYQHFRKLQLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....VD.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SEGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
F5C0T7_HBV/1-351                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLH..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPDWQ.TPSFPNIHLHQDIITKCEQFVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHTLWKAGILYKRETSRSASFCGSPYTWE..QD...L....Q.....HGAFL-..DG.PS..RVGKE..P..F...HQ..............QSSR.IP.....SR.........S....PV.....................GPSIQ........S.....KY....QQ...SRLG.L....QSQ..K...G....P.LAR.........GQQ......G...R.SW.SL....W.TR.VH.PSTRR.P.F.....G........VE.....P....S..VSGH.....TN.N.FAS........RSASCLH..QS.SVRE.A..AYSHLSTT..KRQSSS.GHAVEL.Y.S...SPP....SS...T......KSQ.SQGPVFS...CWW.LQFRDSEPCSDYCLSHLVNLLQ..DWGPC.................................................................................................................................................................................................
A7L9Y6_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SS..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGIR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAS.........GKP......G...R.SG.II....R.AG.VH.STTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C9D6_HBV/1-334                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.TVRK.T..AYSHLSTS..KRQSSS.GHAVEF.-.-...---....--...-......---.-------...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
H6UGH3_HBV/1-341                 ....................................MPLSYQHFPRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VNIPWTHKVGNFTGLYSSTVPVFNPQWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TS.N.LAS........KSASCLY..QS.SVRK.A..TNPSVSTF..EKHSSS.GHAVEF.H.N...LPP....NS...A......GSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B9VL60_HBV/194-323               ...................................d---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...---G.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPIPS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
D2JMK5_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..N..D...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPNFNPDWQ.TPSFPDIHLQEDIVDRCKRFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSTG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QSK..Q...G....Q.LAG.........GQQ......G...G.SG.SI....R.AR.VH.PSSWG.L.V.....G........VE.....P....S..GPGN.....TH.N.YAS........STSSCLH..QS.AVRK.A..AYSLVSTS..KGHSPS.GHAVEL.H.H...FPS....NS...S......RSK.SQGSVLS...CWW.LQFRNSEPCSEYCLCHIVNLLE..DWGPC.................................................................................................................................................................................................
X4YHP4_HBV/1-341                 ....................................MPLSYQHFRRLVLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSIQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.FH.PTARR.P.V.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..ERHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
C9WDK0_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPVFNPNWK.TPSFPDIHLHQDIINKCEQLVGPLTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.P....QSQ..Q...R....P.LDR.........SQQ......G...R.SG.SI....R.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVFS...CWW.LQFRNSEPCSDYCLTHLVNLLQ..DWGPC.................................................................................................................................................................................................
X4Y467_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..N..K...A.....GPLEEELPRLADQGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQLVGPLTVNEKRRLQLIMPARFYPKATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAK.........XQQ......G...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVGK.A..AYPVVSTS..EKYSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
C3W4D0_HBV/1-345                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTYTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QD...L....Q.....HGRLVI..KT.SQ..RHGDE..S..I...CS..............QPSG.IL.....SR.........S....SV.....................GPCIX........S.....QL....KQ...SRLG.L....QPH..Q...G....S.LAS.........SQP......G...R.SG.SI....R.PR.VH.PSTRR.C.F.....G........VE.....P....S..GSGH.....ID.N.SVN........SSSSCLH..QS.AVRK.A..AYSHFSSS..KRQSSS.GHAXEF.H.C...HPP....TS...-......---.-----VS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q4W611_HBV/1-352                 ....................................MPLSYPHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPAFNPHWL.TPSFPDIHLHQDLISKCEQFVGPLTKNELRRLKLIMPARIFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGSTSL..ND.KK..GHGTE..S..L...CA..............QSTG.IL.....SR.........P....SA.....................GSSFQ........S.....KF....QQ...SRLG.L....QQK..Q...G....H.LAN.........GKQ......G...R.SG.SI....R.SR.VH.TPTRW.P.V.....G........VE.....P....S..GTRC.....SN.N.LAS........RSASCLH..QS.AVRE.E..ANPSLSTS..KRHTST.GNAVEL.N.P...VPP....GP...V......GSE.GKGSVSS...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
A7L371_HBV/1-30                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
S6A726_HBV/1-336                 ....................................---------------..-..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPCFNPNWQ.TPSFXDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPXVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.AR.VH.PSPWG.T.V.....G........VE.....P....S..XSGH.....AH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLVSTS..KGHSSS.GHTVEL.H.H...FPP....NS...S......RSQ.SQGPGLS...CWW.LQFRESKPCSEYCLXHIVNLIX..DWGPC.................................................................................................................................................................................................
S5ZT91_HBV/1-341                 ....................................-----------LLLD..K..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....HGRLVF..QT.SK..RHGDK..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....RK...SRLG.P....QPA..Q...G....Q.LAG.........RQQ......G...G.SG.SI....R.SR.VH.PSPWG.T.V.....G........VE.....S....S..GSGP.....TH.N.CAS........SSSSCLH..QS.AVRK.A..AYSLISTS..EGHPSS.GHAVEF.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLIE..DWGPC.................................................................................................................................................................................................
L0BE63_HBV/1-210                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-------HLQEDIINRCQHFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.ADRK.T..AYSLISTS..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
D3YFZ1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..N..E...A.....GSLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSVPWTHKVGNLTGLYSSTVPVFNPNWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSLYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........ME.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRQ.A..AYPTVSTL..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SEGPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
A7YEX4_HBV/1-352                 ....................................MPLSYPHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNGRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPAFNPNWL.TPSFPDIHLHQDLISKCEQFVGPLTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGSTSL..NH.KK..GHGTE..S..F...CA..............QSSG.LL.....AR.........P....SA.....................GSGIQ........S.....KF....QQ...SRLG.L....QHK..Q...G....Q.LAN.........GKQ......G...R.SG.RL....R.SR.VH.TPTRW.P.G.....G........VE.....P....S..GTRC.....SN.Y.LAS........RSASCFH..QS.AVRE.K..ANPSLSTS..KRHTST.GHAVEL.N.S...VPP....GS...V......GSE.GKGSVFS...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
G1E7G5_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...FPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
C3W4A6_HBV/1-341                 ....................................MPLSYQHFRRLVLLD..E..E...A.....GPLEDELPRLADEGLNRRVAEDLN..L..G.D.LN..VDIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKRCEQFVGPLTINEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....QQ...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.VH.PTARR.P.F.....G........VE.....P....S..GSGH.....NT.N.LAS........KSASCLH..QS.PVRK.A..AYPADSTF..ERHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVSP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
C7AYS4_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEDELPRLADEDLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPSFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLDI..NT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...X....P.LAT.........SQS......G...R.SG.SI....W.AR.VH.PSTRR.C.S.....G........ME.....P....S..GSGH.....ID.Y.SAS........SSSSCLH..QS.AVRK.A..AYTHLSTS..KRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVFS...CWW.LQFRNSKPCSEYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
I1UYT6_HBV/1-166                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWRAGILYKRETTRSA----------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
Q8B3N9_9HEPA/70-376              ..............................lgtttd---------------..-..-...-.....------------------------..L..P.R.LG..NKLPARHKLGKLTGLYQMKGCTFNPHWK.VPDISDTHFDTQIVNECP----------SRNWKYLTPAKFWPKSISYFPVHAGVKPKYPDDVKSHESIVGKYLIKLFEAGILYKRVSKHLVTFKGKTYQWE..QQ...Y....-.....---LVN..QP.AD..LHGAT..S..SkinGC..............QKSG.GR.....RT.........S....PS.....................TTSRK........SytsyaQR....NS...HMVG.Q....VSI..N...G....S.YIR.........SCA......N...N.GG.N-....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----kyyagtrlmarrsrkesrpvqsysaessscnldtrrrpegpgilqtlsrrtsqrnnnvstttsqtylgtetrrsspgdsaslpktrtsyssdqntkstqeenvfylr......................................................................................
G4XI49_HBV/1-160                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.GERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
X4ZEZ7_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
C3W4C4_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVADDLN..L..G.N.XN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIINKCEQFVGPLTANEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....HK...SRLG.L....QSQ..Q...G....P.LAR.........RQQ......G...R.SG.SI....R.AG.VH.PTARR.P.F.....G........VE.....P....A..GSRH.....NT.N.LAS........KSASCFY..QS.PVRK.A..AYPAVSTS..ERHSSS.SHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DGG9_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRSVI..QT.SK..RHGDE..S..C...CS..............QSSG.IL.....SR.........S....PV.....................GPGIQ........S.....QF....RQ...SRLG.L....QPQ..Q...G....S.MAR.........GKP......G...R.SG.LI....R.AG.VH.STTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.STS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
L8B2J8_HBV/1-325                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGXLYKRETTHSASFCGSPYSWE..QK...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....-.--.--.-----.-.-.....-........--.....-....R..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
B5TF22_HBV/1-112                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.-G.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q4KRF5_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVT..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........T....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAK.........SQS......G...R.SG.SI....W.TR.VH.PPTRR.C.S.....G........VE.....P....S..GSGH.....ID.Y.SAS........SSSYCLH..QS.AVRK.A..TYSHISTS..KRQSPP.GSAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
H9XQD4_HBV/1-91                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..-SGH.....ID.N.STS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPILS...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q7T4V1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCFY..QS.PVRK.A..AYPSVSTS..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q67859_HBV/1-305                 ....................................MPLSYQYFQIPLLLD..DgtE...A.....GPLEKELPRLADADLNRRVAEELN..L..G.N.PN..VSIPWTHKVGDLTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIIDRCRQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYRRGTTHSASFCGSPYSSE..QG...L....Q.....HGTLLI..KT.SQ..SHGHE..S..F...CS..............QRSG.IL.....CR.........S....SV.....................GPCIR........S.....QH....KQ...SRLA.L....QPH..Q...G....P.LAS.........SQP......G...G.SG.SI....R.AR.AH.PSRRR.Y.F.....G........VE.....P....S..GPGH.....ID.H.SVN........KSSSCLH..QS.PVRK.A..AYSHLSTS..KRQSSS.GHAVE-.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
W6HVY3_HBV/1-315                 ....................................---------------..-..-...-.....-------------------AEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPSIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SRP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.Q.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLANLRE..DWGPC.................................................................................................................................................................................................
D2U602_HBV/1-351                 ....................................MPLSYQHFRRILLLD..E..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTIPVFNPNWK.TPSFPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILYKRETTRSASFWGSPYSWE..QG...L....H.....HGAFL-..DG.PS..RMGEE..S..F...HH..............QSSG.IF.....SR.........P....PV.....................GSSIQ........S.....KH....QK...SRLG.Q....QSQ..Q...R....P.LDR.........SQR......G...R.SG.SF....W.AG.VH.SPTRR.P.F.....G........VE.....P....S..GSRH.....AK.N.IAS........RSASCLH..QS.AVRK.A..AYPNHSTF..ERHSSS.GHAVEF.H.N...IPP....SS...A......GSQ.SKRPVSS...CWW.LQFRNSEPCSDYCLTHLVNLLE..DWGPC.................................................................................................................................................................................................
Q2F4Y2_HBV/1-346                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSPVPIFNPEWQ.TPSFPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....H-----..--.SQ..RHGDE..P..F...CP..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQP......G...R.SG.SI....R.AR.VH.STTRR.C.F.....G........VD.....P....S..GSGH.....IS.H.SAS........SASSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAV-F.H.S...FPP....SS...A......RSQ.SQGPVSS...CWW.LQFRNTQPCSNYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
G1E8G5_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.MAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
G1E7V1_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPNWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTRSASFCGSPYSWE..QE...I....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTSRR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.SVRK.A..AYPSVSTF..EKHSSS.GHAVEF.H.N...LPP....NS...A......RSQ.SDRPVFP...CWW.LQFRNSKPCSDYCISHIVNLLE..DWGPC.................................................................................................................................................................................................
I3XMP6_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..D..Et.eA.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVT..KT.SQ..RHGDE..S..F...CP..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAT.........SQP......G...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....P....S..GSGH.....IG.Y.SAS........SASSCLH..QS.AVRK.A..AYSHLSTS..KRQPSS.GNAVEF.H.S...FSP....SS...A......RSQ.SQGPVFS...CWW.LQFRNIQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
I0DCV9_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADEDLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLHEDIANRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPNHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....H.....HGRLVI..ET.SQ..RHGDE..P..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QF....KQ...SRLG.L....QPY..Q...G....P.LAT.........SQP......G...R.SG.SI....R.AR.VH.SPTRR.C.F.....G........VE.....X....S..GSGH.....IG.H.SAS........SSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.S...FPP....SS...A......RSQ.SQGPVLS...CWW.LQFRNTQPCSKYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
B5TF93_HBV/1-112                 ...................................w---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.SI....R.AG.FH.PTARR.P.S.....G........LE.....P....S..GSGH.....TT.N.VAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHASS.GHAVEL.H.N...LPP....NS...A......RSQ.SEGPVFS...CWW.LQFRNSKPCSDYCISHIVNLLE..DWGPC.................................................................................................................................................................................................
L7R882_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPDIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFYGSPYSWE..QE...L....Q.....HGRLVF..QT.SE..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.MAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAN........SASSCLH..QS.AVRK.T..AYSHLSTA..KRQSSS.GHAVEF.H.N...IPP....SS...A......RSQ.SKGPVFS...CWW.LQFRNSKPCSDFCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
F2WS92_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLHEDIINRCQQFVGPLTVNEKRRLNLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.SE..RHGDE..S..C...CS..............QSSG.IF.....SR.........S....SV.....................GPCVS........S.....QL....KQ...SRLG.L....QPQ..Q...G....P.LAT.........SPS......G...R.SG.SI....R.AR.VH.PSTRR.S.F.....G........VE.....L....S..GSGH.....IN.K.RAS........SSSSCLR..QS.AVRK.A..ANSHLSSS..KRQSSS.GHAVEL.H.N...LPP....SS...A......RSQ.NQGPVFS...CWW.LQFRNSEPCSEYCLSHLINLHE..DWGPC.................................................................................................................................................................................................
D0EEB3_HBV/1-354                 ....................................MPLSYQHFRKLLLLDvgT..E...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTANEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..QT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PPTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
B5M5Z4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..D...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRSDF..QT.ST..RHGDK..S..F...CS..............QPSG.IL.....SR.........S....PV.....................GPGVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEF.H.N...IPP....SS...S......RPQ.SEGPILS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0DE12_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVSS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q8BC37_HBV/1-31                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.------S...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
Q1HHA3_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWX.TPSFPNIHLHQDIIKKCEQFVGPLTANEKRRLQLLMPARVYPKDTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QD...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AW.VH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PVRK.A..AYPAVSTF..EKHSPS.GHAVEF.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
E3Q0N4_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEDLNRRVAEDLN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLHEDIINRCQQFVGPLTVNEKRRLNLIMPARFYPNRTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYYRE..QE...P....Q.....HGRLVF..QT.SK..RHGDE..S..F...CS..............QSSG.IS.....SR.........S....SV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....P.LAT.........SPS......G...R.SG.SI....R.AR.VH.PSSRR.S.F.....G........VE.....P....S..GSGH.....IN.K.RAS........SSSSCLH..QS.AVRK.A..ANSHISTS..KRQSSS.GHAVEL.H.H...LPP....SS...T......RSQ.NQGPVSS...CWW.LQFRNSKPCSEYCLSHLINLHE..DWGPC.................................................................................................................................................................................................
G9G8R0_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....-.....------..--.--..RHGAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...PRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
I1UYS7_HBV/1-166                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWRAGILYKRETTRSA----------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
B5M583_HBV/1-352                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCVR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....CN.N.SAC........STSSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.N...IPP....SS...A......RSQ.SERPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
I0C8V6_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CF..............QSSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
Q20BR3_HBV/1-56                  ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..----SS.GHAVEL.H.H...FPP....NS...S......RSQ.SQGPVLS...CWW.LQFRNSEPCSEYCLCHIVNLSK..T----gdpt.............................................................................................................................................................................................
O09504_HBV/1-214                 ....................................MPLSYQHFRKLLLLD..E..E...A.....GPLEEELPRLAEEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPCFNPKWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QD...L....Q.....H-----..-T.SK..RHGDE..S..F...CP..............QSPG.IL.....PR.........S....SV.....................GPCIQ........S.....QL....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----vg...............................................................................................................................................................................................
E0D2U5_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVXS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
I0DCU0_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHIVNLRE..DWGPC.................................................................................................................................................................................................
Q2AC10_HBV/1-352                 ....................................MPLSYPHFRKLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPGFNPEWQ.TPSFPDIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGGLVF..QT.SK..RHGDE..S..F...CP..............QSAG.IL.....SR.........S....PV.....................GPCIQ........S.....QL....RQ...SRLG.P....QPT..Q...G....L.LAG.........LQQ......G...G.SG.SI....R.AG.IH.STPWG.T.V.....G........VE.....P....S..SSGH.....TH.N.CAS........ISSSCLH..QS.AGSK.A..AYSPVSTS..KGHSSS.GHAVEL.P.H...VPP....NS...S......RSQ.SQGSVLS...CWW.LQFRNSEPCSEHCLFHIVNLIE..DWGPC.................................................................................................................................................................................................
B5TZH6_HBV/1-66                  ....................................MPLSYQHFPELLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..LD--------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.------.-.-...---....--...-......---.-------...---.----------------------..-----pafgansnnpdwdfnpn................................................................................................................................................................................
H3K3H9_HBV/1-347                 ....................................MPLSYQHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPEWQ.TPSFPNIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....H-----..QT.LT..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........GKS......G...R.SG.SI....R.AR.VH.PTTRR.S.F.....G........VE.....P....S..GSGH.....IE.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.H.H...IPP....SS...A......RSQ.SKGPIFS...CWW.LQFRNSKPCSDYCLTHIVNLLE..DWGPC.................................................................................................................................................................................................
M4QBL0_HBV/1-171                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....-GRLVF..QT.ST..RHGDE..P..F...CS..............QSSG.IL.....SR.........S....PV.....................GPGVR........S.....QF....KQ...SRLG.L....QPQ..Q...G....S.MAC.........SKP......G...R.SG.SI....R.AR.VH.STTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAS........SASSCLH..QS.AVRK.T..AYSHLSTS..KRQSSS.GHAVEL.Q.H...IPP....SS...A......RSQ.SEGPIFS...CWW.LKFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0EYX8_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEELN..L..G.N.PN..VSIPWTHKVGNFTGLYSSTAPVFNPHWK.TPSFPHIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKRETTHSASFCGSPYSWE..QD...L....H.....H-----..--.--..--GAE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........SQQ......G...R.SW.SI....R.AG.FH.PTTRR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.PIRK.A..ADSTVSTF..ERHSSS.SHAVEL.H.N...LPP....NS...A......RSQ.SEGPVFP...CWW.LQFRNSKPCSDYCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
I0DDL7_HBV/1-312                 ....................................---------------..-..-...-.....----------ADADLNRRVAEDLN..L..G.N.PT..GSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....P.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPGIR........S.....QL....KQ...SRLG.L....QPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.TH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSPSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.-H----.-.-...---....-S...A......ESH.SQG-LFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
I0DD21_HBV/1-328                 ....................................---------------..-..-...-.....------LPRLADEDLNHRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPVFNPDWL.TPSFPDIHLHQDLIQKCEQFVGPLTKNERRRLKLIMPSRFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHTLWKAGILYKRESTHSASFCGSPYSWE..QE...L....Q.....HGSTSL..NG.EK..GHGTE..S..F...CA..............QSSG.IL.....SR.........P....PV.....................GSTIQ........S.....KF....QQ...SRLG.L....QHK..Q...G....Q.LAN.........GKQ......G...R.SG.RL....R.SR.VH.TPTRW.P.S.....G........VE.....P....S..STGH.....YD.N.LAT........CSTSCFH..QS.EVRK.K..ANPSLSTS..KGHTST.GHAVEL.N.T...VPP....ST...V......GSE.SKGSVFS...CWW.LQFRNTEPCSDYCLSHIVNLLE..DWGSC.................................................................................................................................................................................................
F5C0X3_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..DgtE...A.....GPLEEELPRLADADLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPIFNPEWQ.TPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVI..KT.SQ..RHGDE..S..F...CS..............QPSG.IL.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SGLG.L....PPH..Q...G....P.LAS.........SQP......G...R.SG.SI....R.AR.AH.PSTRR.Y.F.....G........VE.....P....S..GSGH.....ID.H.SVN........NSSSCLH..QS.AVRK.A..AYSHLSTS..KRQSSS.GHAVEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
C7AYN8_HBV/1-354                 ....................................MPLSYQHFRKLLLLD..NdtE...A.....GPLEDELPRLADEDLNHRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPSFNPEWQ.TPSFPKIHLHEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNSTKYLPLHKGIKPYYPDQIVNHYFQARHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....H.....HGRLDI..NT.SQ..RHGDE..S..F...CS..............QXSG.IX.....SR.........S....SV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....P.LAT.........SQS......G...X.SG.SI....W.AR.VH.PSTRR.C.P.....G........VE.....P....S..GSGH.....ID.H.SAS........SSSSCLH..QS.AVRK.A..AXSHLSTS..KRQSSS.GHXVEF.H.S...FPP....XS...A......RSQ.SQGPVFS...CWW.LQFRNSKPCSEYCLSHLVNLLE..DWGPC.................................................................................................................................................................................................
L7R7U2_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..N..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VNIPWTHKVGNFTGLYSSTVPIFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PTTRR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLY..QS.PVRK.A..AYPSVSTF..EKHSSS.GHAVEL.H.N...LPP....NA...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
C3W457_HBV/1-341                 ....................................MPLSYQHFRRLLLLD..E..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFTGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKRCEQFVGPLTINEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..F...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.TH.PTTRR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAS........KSASCLY..QS.PVRK.A..AYPSVSTV..ERHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................
D0QP41_HBV/1-352                 ....................................MPLSYPHFRKLLLLD..D..E...A.....GPLEEELPRLADEGLNRRVAEDLN..L..Q.L.PN..VSIPWTHKVGNFTGLYSSTVPTFNPDWV.TPSFPDIHLHQDLIHKCEQFVGPLTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYLHTLWKAGILYKRESTRSASFCGSPYSWE..QE...L....Q.....HGSTSI..ND.SK..GHGTE..S..L...CT..............QSSG.IL.....SR.........P....SA.....................GSSIQ........G.....KF....QQ...SRLG.L....QQR..Q...G....Q.LAN.........GKQ......G...R.SG.RI....R.SW.VH.TPTRW.P.V.....G........VE.....S....T..GTGC.....AY.N.IAS........RSASCFH..QS.AVRE.K..TNPSLSTS..KRHSST.GHAVEL.H.S...VPP....DS...V......RSE.SKGSVFS...CWW.LQFRDTEPCSDYCLSHIINLLE..DWGPC.................................................................................................................................................................................................
Q9WP59_HBV/269-322               .................................hsv---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...-.--.--....-.--.--.-----.-.-.....-........--.....-....-..----.....--.-.---........-------..--.----.-..--------..------.---NEF.H.C...LPP....SS...A......GSQ.SQGSVFS...CWW.LQFRNSKPCSEYCLSHLVNLRE..DWGPC.................................................................................................................................................................................................
L0BC61_HBV/1-210                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-------HLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWE..QE...L....Q.....HGRLVF..QT.ST..RHGDE..S..F...CS..............QSSG.IL.....SR.........S....PV.....................GPCIR........S.....QL....KQ...SRLG.L....QPQ..Q...G....S.LAR.........SKS......G...R.SG.SI....R.AR.VH.PTTRQ.S.F.....G........VE.....P....S..GSGH.....ID.N.SAN........STSSCLH..QS.AVRK.T..AYSLISTS..------.------.-.-...---....--...-......---.-------...---.----------------------..-----.................................................................................................................................................................................................
R9Q7Y4_HBV/1-114                 ....................................---------------..-..-...-.....------------------------..-..-.-.--..----------------------------.-----------------------------------------------------------------------------------------------------..--...-....-.....------..--.--..-----..-..-...--..............----.--.....--.........-....--.....................-----........-.....--....--...----.-....---..-...-....-.---.........---......-...R.SW.SI....R.AG.FH.PTARR.P.F.....G........VE.....P....S..GSGH.....TT.N.FAS........KSASCLH..QS.TVRK.A..AYPAVSTF..EKHSSS.SHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDHCLSLIVNLLE..DWGPC.................................................................................................................................................................................................
I0DDQ3_HBV/1-317                 ....................................---------------..-..-...-.....------LPRLADEGLNRRVAEDLN..L..G.N.LN..VSIPWTHKVGNFXGLYSSTVPVFNPHWK.TPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWE..QE...L....Q.....HG----..--.--..---AE..S..L...HQ..............QSSG.IL.....SR.........P....PV.....................GSSLQ........S.....KH....RK...SRLG.L....QSQ..Q...G....H.LAR.........RQQ......G...R.SW.SI....R.AG.IH.PAARR.P.F.....G........VE.....P....S..GSGH.....TT.N.LAN........KSASCLY..QS.PVRK.A..AYPAVSTF..EKHSSS.GHAVEL.H.N...LPP....NS...A......RSQ.SERPVFP...CWW.LQFRNSKPCSDYCLSHIVNLLE..DWGPC.................................................................................................................................................................................................