
Database: Pfam
Entry: DNA_pol_viral_N
LinkDB: DNA_pol_viral_N
Original site: DNA_pol_viral_N 
#=GF ID   DNA_pol_viral_N
#=GF AC   PF00242.12
#=GF DE   DNA polymerase (viral) N-terminal domain
#=GF AU   Finn RD
#=GF SE   Pfam-B_107 (release 1.0)
#=GF GA   29.90 29.90;
#=GF TC   30.00 30.80;
#=GF NC   29.00 29.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR000201;
#=GF SQ   5612
#=GS G1E821_HBV/1-341     AC G1E821.1
#=GS G0YVM7_HBV/1-341     AC G0YVM7.1
#=GS I0C8P3_HBV/1-341     AC I0C8P3.1
#=GS D6QVX0_HBV/1-352     AC D6QVX0.1
#=GS B5TXX4_HBV/1-352     AC B5TXX4.1
#=GS Q00KA8_HBV/1-352     AC Q00KA8.1
#=GS C7DN49_HBV/1-351     AC C7DN49.1
#=GS G1E801_HBV/1-341     AC G1E801.1
#=GS B0YGJ4_HBV/1-341     AC B0YGJ4.1
#=GS C1K1Y1_HBV/1-337     AC C1K1Y1.1
#=GS B8PTB7_HBV/1-341     AC B8PTB7.1
#=GS B3V8W2_HBV/1-337     AC B3V8W2.1
#=GS B0FCQ1_HBV/1-352     AC B0FCQ1.1
#=GS I0DE24_HBV/1-328     AC I0DE24.1
#=GS I0DCX8_HBV/1-328     AC I0DCX8.1
#=GS Q4FD45_HBV/1-352     AC Q4FD45.1
#=GS F5C114_HBV/1-287     AC F5C114.1
#=GS D0E6G4_HBV/1-352     AC D0E6G4.1
#=GS H9BE04_HBV/1-351     AC H9BE04.1
#=GS F5C1A3_HBV/1-354     AC F5C1A3.1
#=GS D3YGJ8_HBV/1-327     AC D3YGJ8.1
#=GS H9XRG9_HBV/1-91      AC H9XRG9.1
#=GS G9G9S0_HBV/1-206     AC G9G9S0.1
#=GS F5C0S4_HBV/1-333     AC F5C0S4.1
#=GS B5BPN7_HBV/1-337     AC B5BPN7.1
#=GS DPOL_HBVB3/1-352     AC Q9QAB8.1
#=GS C7DMF8_HBV/1-351     AC C7DMF8.1
#=GS H9XQZ9_HBV/1-91      AC H9XQZ9.1
#=GS Q81131_HBV/1-352     AC Q81131.1
#=GS I0C8T8_HBV/1-341     AC I0C8T8.1
#=GS I0C941_HBV/1-354     AC I0C941.1
#=GS C7DM38_HBV/1-351     AC C7DM38.1
#=GS Q6Y5I1_HBV/1-352     AC Q6Y5I1.1
#=GS I0C913_HBV/1-354     AC I0C913.1
#=GS D0E588_HBV/1-352     AC D0E588.1
#=GS E5RPR7_HBV/1-343     AC E5RPR7.1
#=GS D0E5R1_HBV/1-352     AC D0E5R1.1
#=GS B5B4C7_HBV/1-235     AC B5B4C7.1
#=GS Q4FDM2_HBV/1-352     AC Q4FDM2.1
#=GS I0C8I7_HBV/1-350     AC I0C8I7.1
#=GS B5M550_HBV/1-341     AC B5M550.1
#=GS Q19SZ4_HBV/1-340     AC Q19SZ4.1
#=GS I0DC78_HBV/1-321     AC I0DC78.1
#=GS A9CM78_HBV/1-352     AC A9CM78.1
#=GS D6QVI3_HBV/1-352     AC D6QVI3.1
#=GS I0DGF4_HBV/1-352     AC I0DGF4.1
#=GS I0DCS0_HBV/1-328     AC I0DCS0.1
#=GS D0UE49_HBV/1-352     AC D0UE49.1
#=GS A9CM53_HBV/1-352     AC A9CM53.1
#=GS A6MG56_HBV/1-352     AC A6MG56.1
#=GS D0UE67_HBV/1-352     AC D0UE67.1
#=GS Q9IF27_HBV/1-352     AC Q9IF27.1
#=GS H6UG83_HBV/1-341     AC H6UG83.1
#=GS B9VKB4_HBV/1-352     AC B9VKB4.1
#=GS B5M5P6_HBV/1-352     AC B5M5P6.1
#=GS I0C9C8_HBV/1-334     AC I0C9C8.1
#=GS F5C149_HBV/1-354     AC F5C149.1
#=GS C3W3Z1_HBV/1-343     AC C3W3Z1.1
#=GS A7L372_HBV/1-30      AC A7L372.1
#=GS B7TU32_HBV/1-352     AC B7TU32.1
#=GS O42041_HBV/1-352     AC O42041.1
#=GS Q6XGP8_HBV/1-354     AC Q6XGP8.1
#=GS B5M5I1_HBV/209-314   AC B5M5I1.1
#=GS G4XI26_HBV/1-160     AC G4XI26.1
#=GS D6QVG9_HBV/1-352     AC D6QVG9.1
#=GS D0UDT4_HBV/1-352     AC D0UDT4.1
#=GS B5ASU7_HBV/1-352     AC B5ASU7.1
#=GS B2CY29_HBV/1-352     AC B2CY29.1
#=GS D7NL90_HBV/1-341     AC D7NL90.1
#=GS B7TTI7_HBV/1-352     AC B7TTI7.1
#=GS D5LEL7_HBV/1-352     AC D5LEL7.1
#=GS G9G9Q7_HBV/1-341     AC G9G9Q7.1
#=GS B2LWD3_HBV/1-347     AC B2LWD3.1
#=GS C7DMW6_HBV/1-351     AC C7DMW6.1
#=GS F5C1B3_HBV/1-75      AC F5C1B3.1
#=GS I0C9G3_HBV/1-352     AC I0C9G3.1
#=GS D5LC35_HBV/1-352     AC D5LC35.1
#=GS H6UN09_HBV/1-341     AC H6UN09.1
#=GS D3TJB1_HBV/1-352     AC D3TJB1.1
#=GS H6UGB7_HBV/1-341     AC H6UGB7.1
#=GS G9G970_HBV/1-341     AC G9G970.1
#=GS B4YKK2_HBV/1-341     AC B4YKK2.1
#=GS D2JMM3_HBV/1-352     AC D2JMM3.1
#=GS C7AYV9_HBV/1-354     AC C7AYV9.1
#=GS B9VK86_HBV/1-352     AC B9VK86.1
#=GS Q19SW8_HBV/1-341     AC Q19SW8.1
#=GS Q80H42_HBV/1-352     AC Q80H42.1
#=GS D0UE58_HBV/1-345     AC D0UE58.1
#=GS Q68RN1_HBV/1-352     AC Q68RN1.1
#=GS H6WFM8_HBV/1-112     AC H6WFM8.1
#=GS D0UDQ9_HBV/1-352     AC D0UDQ9.1
#=GS I0DD17_HBV/1-326     AC I0DD17.1
#=GS H6WF62_HBV/1-112     AC H6WF62.1
#=GS I0C8T7_HBV/1-341     AC I0C8T7.1
#=GS C6F562_HBV/1-354     AC C6F562.1
#=GS Q2LCF2_HBV/1-341     AC Q2LCF2.1
#=GS Q05HA3_HBV/1-340     AC Q05HA3.1
#=GS E9RGW9_HBV/1-341     AC E9RGW9.1
#=GS DPOL_HBVB7/1-352     AC Q9QBF1.1
#=GS H6UN05_HBV/1-341     AC H6UN05.1
#=GS B7TV09_HBV/1-352     AC B7TV09.1
#=GS Q20BX1_HBV/1-55      AC Q20BX1.1
#=GS A5JIH1_HBV/1-112     AC A5JIH1.1
#=GS B5M5B4_HBV/1-352     AC B5M5B4.1
#=GS F5C199_HBV/1-354     AC F5C199.1
#=GS I0DGI8_HBV/1-352     AC I0DGI8.1
#=GS B9VK82_HBV/1-352     AC B9VK82.1
#=GS G1C8Q1_HBV/1-341     AC G1C8Q1.1
#=GS Q8QMM4_HBV/1-342     AC Q8QMM4.1
#=GS D5LEA7_HBV/1-352     AC D5LEA7.1
#=GS Q1JUR4_HBV/1-340     AC Q1JUR4.1
#=GS E5F0X3_HBV/1-49      AC E5F0X3.1
#=GS H9XQM1_HBV/1-91      AC H9XQM1.1
#=GS A0MML8_HBV/1-352     AC A0MML8.1
#=GS B9VKL5_HBV/1-352     AC B9VKL5.1
#=GS B5A2F0_HBV/1-352     AC B5A2F0.1
#=GS E5F0Y0_HBV/1-49      AC E5F0Y0.1
#=GS A8IES5_HBV/1-52      AC A8IES5.1
#=GS G4XMP7_HBV/1-352     AC G4XMP7.1
#=GS H9XR98_HBV/1-91      AC H9XR98.1
#=GS A5JI87_HBV/1-112     AC A5JI87.1
#=GS C6F4Z4_HBV/1-354     AC C6F4Z4.1
#=GS D3TIJ9_HBV/284-316   AC D3TIJ9.1
#=GS B0FC59_HBV/1-352     AC B0FC59.1
#=GS C1K159_HBV/1-239     AC C1K159.1
#=GS B7TTT0_HBV/1-352     AC B7TTT0.1
#=GS D0E5C5_HBV/1-352     AC D0E5C5.1
#=GS Q1HHA7_HBV/1-334     AC Q1HHA7.1
#=GS I0C894_HBV/1-354     AC I0C894.1
#=GS D3TJA4_HBV/1-352     AC D3TJA4.1
#=GS D6QVK8_HBV/1-352     AC D6QVK8.1
#=GS F5C115_HBV/280-320   AC F5C115.1
#=GS C3W3W6_HBV/1-341     AC C3W3W6.1
#=GS G4XHW7_HBV/1-160     AC G4XHW7.1
#=GS H9XR90_HBV/1-91      AC H9XR90.1
#=GS Q9IF49_HBV/1-172     AC Q9IF49.1
#=GS B3GED9_HBV/1-33      AC B3GED9.1
#=GS H1ACV2_HBV/1-352     AC H1ACV2.1
#=GS E5RD97_HBV/1-341     AC E5RD97.1
#=GS D0EDS2_HBV/1-330     AC D0EDS2.1
#=GS DPOL_HBVE4/1-351     AC Q80IU4.1
#=GS Q91C56_HBV/1-343     AC Q91C56.1
#=GS C5WJY2_HBV/1-352     AC C5WJY2.1
#=GS Q5UFT1_HBV/1-341     AC Q5UFT1.1
#=GS B9VK19_HBV/1-352     AC B9VK19.1
#=GS B2Y6Y1_HBV/1-341     AC B2Y6Y1.1
#=GS E5F0Y3_HBV/1-46      AC E5F0Y3.1
#=GS F1AEV3_HBV/1-351     AC F1AEV3.1
#=GS C9WDE3_HBV/1-341     AC C9WDE3.1
#=GS B7TU51_HBV/1-352     AC B7TU51.1
#=GS C7AYU1_HBV/1-354     AC C7AYU1.1
#=GS E0D2T3_HBV/1-354     AC E0D2T3.1
#=GS H1ACY0_HBV/1-352     AC H1ACY0.1
#=GS Q5R2Q3_HBV/1-341     AC Q5R2Q3.1
#=GS Q91EI0_HBV/1-354     AC Q91EI0.1
#=GS B2LSL6_HBV/1-352     AC B2LSL6.1
#=GS B7TUL7_HBV/1-352     AC B7TUL7.1
#=GS A9QPW2_HBV/1-351     AC A9QPW2.1
#=GS Q3ZKJ4_HBV/1-351     AC Q3ZKJ4.1
#=GS I0C985_HBV/1-351     AC I0C985.1
#=GS G4XMF5_HBV/1-352     AC G4XMF5.1
#=GS I0C8V9_HBV/1-354     AC I0C8V9.1
#=GS I0DCP2_HBV/1-328     AC I0DCP2.1
#=GS F1AET9_HBV/1-354     AC F1AET9.1
#=GS H6WFD0_HBV/1-112     AC H6WFD0.1
#=GS B2CSC6_HBV/1-352     AC B2CSC6.1
#=GS G4XI63_HBV/1-160     AC G4XI63.1
#=GS Q20BV7_HBV/1-57      AC Q20BV7.1
#=GS F5C0M5_HBV/1-354     AC F5C0M5.1
#=GS C1K205_HBV/1-342     AC C1K205.1
#=GS B5M5J0_HBV/1-352     AC B5M5J0.1
#=GS DPOL_HBVD5/1-341     AC P0C679.1
#=GS Q00K60_HBV/1-352     AC Q00K60.1
#=GS G1E8Q2_HBV/1-341     AC G1E8Q2.1
#=GS I0C8S3_HBV/1-341     AC I0C8S3.1
#=GS A5LG34_HBV/1-352     AC A5LG34.1
#=GS B0FC31_HBV/1-352     AC B0FC31.1
#=GS I0DE20_HBV/1-328     AC I0DE20.1
#=GS B5M560_HBV/1-352     AC B5M560.1
#=GS D5MSI1_HBV/1-343     AC D5MSI1.1
#=GS B5BPT8_HBV/1-352     AC B5BPT8.1
#=GS E5RD93_HBV/1-352     AC E5RD93.1
#=GS I0C8F2_HBV/1-354     AC I0C8F2.1
#=GS Q75TL6_HBV/1-341     AC Q75TL6.1
#=GS G1E842_HBV/1-341     AC G1E842.1
#=GS B9VKT9_HBV/1-352     AC B9VKT9.1
#=GS G4XHZ6_HBV/1-160     AC G4XHZ6.1
#=GS Q2F501_HBV/271-320   AC Q2F501.1
#=GS G4XI80_HBV/1-54      AC G4XI80.1
#=GS I0C8F5_HBV/1-354     AC I0C8F5.1
#=GS F5C1A6_HBV/1-354     AC F5C1A6.1
#=GS B5TFG5_HBV/1-112     AC B5TFG5.1
#=GS I0C9G1_HBV/1-352     AC I0C9G1.1
#=GS I0DD97_HBV/1-328     AC I0DD97.1
#=GS Q1PCY0_HBV/1-352     AC Q1PCY0.1
#=GS C5WK02_HBV/1-352     AC C5WK02.1
#=GS B7TV41_HBV/1-352     AC B7TV41.1
#=GS D0E698_HBV/1-352     AC D0E698.1
#=GS Q8V1J2_HBV/1-352     AC Q8V1J2.1
#=GS D0U3Y5_HBV/1-354     AC D0U3Y5.1
#=GS G1E8A7_HBV/1-341     AC G1E8A7.1
#=GS Q6XGT3_HBV/1-354     AC Q6XGT3.1
#=GS B7TUK6_HBV/1-352     AC B7TUK6.1
#=GS B5M5W6_HBV/1-352     AC B5M5W6.1
#=GS Q9WP81_HBV/207-289   AC Q9WP81.1
#=GS F5C178_HBV/1-354     AC F5C178.1
#=GS A5JIK3_HBV/1-112     AC A5JIK3.1
#=GS Q461A0_HBV/1-351     AC Q461A0.1
#=GS A5JI17_HBV/1-112     AC A5JI17.1
#=GS Q7TDS4_HBV/1-340     AC Q7TDS4.1
#=GS I0C978_HBV/1-354     AC I0C978.1
#=GS I0C8T2_HBV/1-341     AC I0C8T2.1
#=GS D6QVH6_HBV/1-352     AC D6QVH6.1
#=GS A6MFW8_HBV/1-352     AC A6MFW8.1
#=GS A9QPV5_HBV/1-351     AC A9QPV5.1
#=GS D2U650_HBV/1-351     AC D2U650.1
#=GS I0C927_HBV/1-354     AC I0C927.1
#=GS D5LF64_HBV/1-352     AC D5LF64.1
#=GS I0C8B1_HBV/1-354     AC I0C8B1.1
#=GS Q765Y0_HBV/1-337     AC Q765Y0.1
#=GS H9XQL1_HBV/1-91      AC H9XQL1.1
#=GS C7DM31_HBV/1-342     AC C7DM31.1
#=GS B3IWX1_HBV/1-351     AC B3IWX1.1
#=GS Q6XGQ5_HBV/1-354     AC Q6XGQ5.1
#=GS G9G8U2_HBV/1-341     AC G9G8U2.1
#=GS B2Y6W0_HBV/1-341     AC B2Y6W0.1
#=GS F5C0Y3_HBV/1-354     AC F5C0Y3.1
#=GS Q0PMK6_HBV/1-352     AC Q0PMK6.1
#=GS I0DE16_HBV/1-317     AC I0DE16.1
#=GS B6CJ06_HBV/1-354     AC B6CJ06.1
#=GS E5RD17_HBV/1-352     AC E5RD17.1
#=GS Q8B4D1_HBV/1-325     AC Q8B4D1.1
#=GS D0E5V2_HBV/1-352     AC D0E5V2.1
#=GS F5C0T7_HBV/1-351     AC F5C0T7.1
#=GS A7L9Y6_HBV/1-352     AC A7L9Y6.1
#=GS I0C9D6_HBV/1-334     AC I0C9D6.1
#=GS H6UGH3_HBV/1-341     AC H6UGH3.1
#=GS D2JMK5_HBV/1-352     AC D2JMK5.1
#=GS C9WDK0_HBV/1-351     AC C9WDK0.1
#=GS Q4W611_HBV/1-352     AC Q4W611.1
#=GS A7L371_HBV/1-30      AC A7L371.1
#=GS D3YFZ1_HBV/1-341     AC D3YFZ1.1
#=GS A7YEX4_HBV/1-352     AC A7YEX4.1
#=GS G1E7G5_HBV/1-341     AC G1E7G5.1
#=GS C3W4A6_HBV/1-341     AC C3W4A6.1
#=GS C7AYS4_HBV/1-354     AC C7AYS4.1
#=GS G4XI49_HBV/1-160     AC G4XI49.1
#=GS C3W4C4_HBV/1-341     AC C3W4C4.1
#=GS I0DGG9_HBV/1-352     AC I0DGG9.1
#=GS B5TF22_HBV/1-112     AC B5TF22.1
#=GS Q4KRF5_HBV/1-354     AC Q4KRF5.1
#=GS H9XQD4_HBV/1-91      AC H9XQD4.1
#=GS Q7T4V1_HBV/1-341     AC Q7T4V1.1
#=GS Q67859_HBV/1-305     AC Q67859.1
#=GS D2U602_HBV/1-351     AC D2U602.1
#=GS Q2F4Y2_HBV/1-346     AC Q2F4Y2.1
#=GS G1E8G5_HBV/1-341     AC G1E8G5.1
#=GS G1E7V1_HBV/1-341     AC G1E7V1.1
#=GS I0DCV9_HBV/1-328     AC I0DCV9.1
#=GS B5TF93_HBV/1-112     AC B5TF93.1
#=GS F2WS92_HBV/1-352     AC F2WS92.1
#=GS D0EEB3_HBV/1-354     AC D0EEB3.1
#=GS B5M5Z4_HBV/1-352     AC B5M5Z4.1
#=GS I0DE12_HBV/1-328     AC I0DE12.1
#=GS Q8BC37_HBV/1-31      AC Q8BC37.1
#=GS Q1HHA3_HBV/1-341     AC Q1HHA3.1
#=GS E3Q0N4_HBV/1-352     AC E3Q0N4.1
#=GS G9G8R0_HBV/1-341     AC G9G8R0.1
#=GS B5M583_HBV/1-352     AC B5M583.1
#=GS I0C8V6_HBV/1-354     AC I0C8V6.1
#=GS Q20BR3_HBV/1-56      AC Q20BR3.1
#=GS E0D2U5_HBV/1-354     AC E0D2U5.1
#=GS I0DCU0_HBV/1-328     AC I0DCU0.1
#=GS Q2AC10_HBV/1-352     AC Q2AC10.1
#=GS H3K3H9_HBV/1-347     AC H3K3H9.1
#=GS D0EYX8_HBV/1-341     AC D0EYX8.1
#=GS I0DDL7_HBV/1-312     AC I0DDL7.1
#=GS I0DD21_HBV/1-328     AC I0DD21.1
#=GS F5C0X3_HBV/1-354     AC F5C0X3.1
#=GS C7AYN8_HBV/1-354     AC C7AYN8.1
#=GS C3W457_HBV/1-341     AC C3W457.1
#=GS I0DDQ3_HBV/1-317     AC I0DDQ3.1
#=GS Q9WFB2_9HEPA/1-365   AC Q9WFB2.1
#=GS G1C8L7_HBV/1-341     AC G1C8L7.1
#=GS H6V5I8_HBV/1-352     AC H6V5I8.1
#=GS H6V5R4_HBV/1-349     AC H6V5R4.1
#=GS C6F5B1_HBV/1-352     AC C6F5B1.1
#=GS I0C8B2_HBV/1-354     AC I0C8B2.1
#=GS B5A2I4_HBV/1-352     AC B5A2I4.1
#=GS G1E7Q9_HBV/198-316   AC G1E7Q9.1
#=GS C7AYT5_HBV/1-354     AC C7AYT5.1
#=GS A1ILJ8_HBV/1-352     AC A1ILJ8.1
#=GS Q404F8_HBV/1-341     AC Q404F8.1
#=GS Q91S93_HBV/1-352     AC Q91S93.1
#=GS G4XMG7_HBV/1-352     AC G4XMG7.1
#=GS E9L2L9_HBV/1-354     AC E9L2L9.1
#=GS B5BPI1_HBV/1-352     AC B5BPI1.1
#=GS I0DGJ4_HBV/1-352     AC I0DGJ4.1
#=GS I0DG95_HBV/1-352     AC I0DG95.1
#=GS C5WJZ4_HBV/1-352     AC C5WJZ4.1
#=GS G9G990_HBV/1-341     AC G9G990.1
#=GS Q2MLQ4_HBV/1-341     AC Q2MLQ4.1
#=GS F5C0U1_HBV/1-351     AC F5C0U1.1
#=GS H6WF86_HBV/1-112     AC H6WF86.1
#=GS C7AYP4_HBV/1-354     AC C7AYP4.1
#=GS H9XQI6_HBV/1-91      AC H9XQI6.1
#=GS B5M5A5_HBV/1-352     AC B5M5A5.1
#=GS D3TIN7_HBV/1-349     AC D3TIN7.1
#=GS I0C8A9_HBV/1-354     AC I0C8A9.1
#=GS H6WFM1_HBV/1-112     AC H6WFM1.1
#=GS B5MEW9_HBV/1-352     AC B5MEW9.1
#=GS E5RPT5_HBV/1-343     AC E5RPT5.1
#=GS I0DCM2_HBV/1-328     AC I0DCM2.1
#=GS F4ZCA9_HBV/1-49      AC F4ZCA9.1
#=GS D0EDY8_HBV/1-354     AC D0EDY8.1
#=GS F1AES6_HBV/1-354     AC F1AES6.1
#=GS G3XGU4_HBV/1-352     AC G3XGU4.1
#=GS G1E8N2_HBV/1-341     AC G1E8N2.1
#=GS I0C9A2_HBV/1-341     AC I0C9A2.1
#=GS B7TUD1_HBV/1-352     AC B7TUD1.1
#=GS Q9DH92_HBV/1-352     AC Q9DH92.1
#=GS DPOL_HBVA2/1-347     AC P03158.2
#=GS O39671_HBV/1-352     AC O39671.1
#=GS F5C197_HBV/1-354     AC F5C197.1
#=GS Q19SY2_HBV/1-341     AC Q19SY2.1
#=GS G3EQX6_HBV/1-48      AC G3EQX6.1
#=GS G3XH30_HBV/224-309   AC G3XH30.1
#=GS Q68RP0_HBV/1-352     AC Q68RP0.1
#=GS G1E7S1_HBV/1-341     AC G1E7S1.1
#=GS B5TFJ7_HBV/1-112     AC B5TFJ7.1
#=GS G3XGW4_HBV/1-343     AC G3XGW4.1
#=GS I0DE32_HBV/1-328     AC I0DE32.1
#=GS I0C8B4_HBV/1-354     AC I0C8B4.1
#=GS E5RPP3_HBV/1-352     AC E5RPP3.1
#=GS B3VLJ0_HBV/1-176     AC B3VLJ0.1
#=GS I0DDT7_HBV/1-328     AC I0DDT7.1
#=GS A6MG13_HBV/1-352     AC A6MG13.1
#=GS B6CIZ9_HBV/1-354     AC B6CIZ9.1
#=GS D3TKD6_HBV/1-352     AC D3TKD6.1
#=GS I0C960_HBV/1-354     AC I0C960.1
#=GS Q6R264_HBV/1-352     AC Q6R264.1
#=GS F5C0Y0_HBV/1-354     AC F5C0Y0.1
#=GS D3YGJ1_HBV/1-341     AC D3YGJ1.1
#=GS F5C189_HBV/1-354     AC F5C189.1
#=GS B7TV28_HBV/1-338     AC B7TV28.1
#=GS C7DMJ9_HBV/1-351     AC C7DMJ9.1
#=GS I0DE92_HBV/1-328     AC I0DE92.1
#=GS G4XHZ9_HBV/1-160     AC G4XHZ9.1
#=GS D0UDZ7_HBV/1-352     AC D0UDZ7.1
#=GS D0E5Q3_HBV/1-352     AC D0E5Q3.1
#=GS Q4FD49_HBV/1-352     AC Q4FD49.1
#=GS G1C8F5_HBV/1-341     AC G1C8F5.1
#=GS O91587_HBV/1-336     AC O91587.1
#=GS E5F0V9_HBV/1-49      AC E5F0V9.1
#=GS G4XI98_HBV/1-54      AC G4XI98.1
#=GS E9RGX5_HBV/1-341     AC E9RGX5.1
#=GS C6F576_HBV/1-354     AC C6F576.1
#=GS B5M5X6_HBV/1-352     AC B5M5X6.1
#=GS B0YPS7_HBV/1-354     AC B0YPS7.1
#=GS Q4FDE7_HBV/1-352     AC Q4FDE7.1
#=GS D2U678_HBV/1-351     AC D2U678.1
#=GS D5LBQ8_HBV/1-352     AC D5LBQ8.1
#=GS G3XGU8_HBV/1-352     AC G3XGU8.1
#=GS H9XRK4_HBV/1-91      AC H9XRK4.1
#=GS B5M525_HBV/1-346     AC B5M525.1
#=GS B4Y7D2_HBV/1-352     AC B4Y7D2.2
#=GS B2WSN8_HBV/1-352     AC B2WSN8.1
#=GS Q4KRA7_HBV/1-354     AC Q4KRA7.1
#=GS I0DGA5_HBV/1-352     AC I0DGA5.1
#=GS D3TK04_HBV/1-246     AC D3TK04.1
#=GS C1K1P4_HBV/1-352     AC C1K1P4.1
#=GS I0DGI3_HBV/1-352     AC I0DGI3.1
#=GS B5TF81_HBV/1-112     AC B5TF81.1
#=GS G3XGX4_HBV/1-343     AC G3XGX4.1
#=GS C1K1K9_HBV/1-73      AC C1K1K9.1
#=GS H6V5T4_HBV/1-352     AC H6V5T4.1
#=GS Q765V6_HBV/1-352     AC Q765V6.1
#=GS G3XLA4_HBV/1-352     AC G3XLA4.1
#=GS B5U8G8_HBV/34-99     AC B5U8G8.1
#=GS B9W3Z1_HBV/1-354     AC B9W3Z1.1
#=GS Q7THR0_HBV/1-352     AC Q7THR0.1
#=GS Q8B6N6_HBV/1-352     AC Q8B6N6.1
#=GS I0DDV3_HBV/1-308     AC I0DDV3.1
#=GS I0C8I8_HBV/1-335     AC I0C8I8.1
#=GS B0FD83_HBV/1-346     AC B0FD83.1
#=GS I0C8I5_HBV/1-350     AC I0C8I5.1
#=GS Q1PCY8_HBV/1-352     AC Q1PCY8.1
#=GS Q7TDR8_HBV/1-352     AC Q7TDR8.1
#=GS Q67892_HBV/1-341     AC Q67892.1
#=GS I0C8H7_HBV/1-354     AC I0C8H7.1
#=GS B5M666_HBV/1-352     AC B5M666.1
#=GS O91518_HBV/1-352     AC O91518.1
#=GS D5LFG0_HBV/1-352     AC D5LFG0.1
#=GS A7YEV5_HBV/1-352     AC A7YEV5.1
#=GS D0E5S5_HBV/1-352     AC D0E5S5.1
#=GS H9XQM9_HBV/1-91      AC H9XQM9.1
#=GS C7G2Z7_HBV/1-348     AC C7G2Z7.1
#=GS D0E5D7_HBV/1-352     AC D0E5D7.1
#=GS B0FD10_HBV/1-352     AC B0FD10.1
#=GS Q769H7_HBV/1-352     AC Q769H7.1
#=GS B1ABR0_HBV/1-236     AC B1ABR0.1
#=GS D0EEI3_HBV/1-354     AC D0EEI3.1
#=GS Q1JUS2_HBV/1-354     AC Q1JUS2.1
#=GS Q7T7X3_HBV/1-341     AC Q7T7X3.1
#=GS E9L5E9_HBV/1-352     AC E9L5E9.1
#=GS Q00K68_HBV/1-352     AC Q00K68.1
#=GS B2NI12_HBV/1-352     AC B2NI12.1
#=GS C1K185_HBV/1-352     AC C1K185.1
#=GS G1E7P0_HBV/1-341     AC G1E7P0.1
#=GS D3TK89_HBV/1-347     AC D3TK89.1
#=GS Q1PCX6_HBV/1-352     AC Q1PCX6.1
#=GS A5JI79_HBV/1-112     AC A5JI79.1
#=GS C1K222_HBV/298-330   AC C1K222.1
#=GS Q7TDR0_HBV/1-352     AC Q7TDR0.1
#=GS B5TXI1_HBV/1-352     AC B5TXI1.1
#=GS F5C0W4_HBV/1-354     AC F5C0W4.1
#=GS G4XHY6_HBV/1-160     AC G4XHY6.1
#=GS D9U5K7_HBV/1-352     AC D9U5K7.1
#=GS D0E585_HBV/1-352     AC D0E585.1
#=GS E5RPT9_HBV/1-343     AC E5RPT9.1
#=GS A6YM46_HBV/1-351     AC A6YM46.1
#=GS D2JMB6_HBV/1-352     AC D2JMB6.1
#=GS B5M518_HBV/1-352     AC B5M518.1
#=GS Q598R5_HBV/1-351     AC Q598R5.1
#=GS DPOL_HBVF3/1-352     AC Q99HS4.1
#=GS G4XIB0_HBV/1-130     AC G4XIB0.1
#=GS B1ABL4_HBV/1-238     AC B1ABL4.1
#=GS DPOL_HBVC3/1-352     AC P12933.2
#=GS H9N875_HBV/1-341     AC H9N875.1
#=GS Q00K80_HBV/1-352     AC Q00K80.1
#=GS Q9IR30_HBV/1-174     AC Q9IR30.1
#=GS I0C9A6_HBV/1-341     AC I0C9A6.1
#=GS H6UG53_HBV/1-341     AC H6UG53.1
#=GS E9L2R8_HBV/1-171     AC E9L2R8.1
#=GS G4XI65_HBV/1-160     AC G4XI65.1
#=GS D0E5X2_HBV/1-352     AC D0E5X2.1
#=GS DPOL_HBVH1/1-352     AC Q8JMY7.1
#=GS I0DGC2_HBV/1-352     AC I0DGC2.1
#=GS I0C879_HBV/1-354     AC I0C879.1
#=GS G4XIC1_HBV/1-114     AC G4XIC1.1
#=GS D3TK82_HBV/1-352     AC D3TK82.1
#=GS Q8QY53_HBV/1-352     AC Q8QY53.1
#=GS D3XGC0_HBV/1-351     AC D3XGC0.1
#=GS I0C8G5_HBV/1-354     AC I0C8G5.1
#=GS Q7T7V9_HBV/1-341     AC Q7T7V9.1
#=GS Q9YPU5_HBV/1-341     AC Q9YPU5.1
#=GS B2LWA6_HBV/1-337     AC B2LWA6.1
#=GS B0FCJ8_HBV/1-352     AC B0FCJ8.1
#=GS H6WFD4_HBV/1-112     AC H6WFD4.1
#=GS Q20C04_HBV/1-57      AC Q20C04.1
#=GS B4ZYW8_HBV/1-230     AC B4ZYW8.1
#=GS Q5KR43_HBV/1-352     AC Q5KR43.1
#=GS F5C104_HBV/1-354     AC F5C104.1
#=GS G1E8S8_HBV/1-341     AC G1E8S8.1
#=GS B4YLE4_HBV/1-341     AC B4YLE4.1
#=GS B0FCN1_HBV/1-352     AC B0FCN1.1
#=GS A5JI63_HBV/1-112     AC A5JI63.1
#=GS G3E5G4_HBV/1-341     AC G3E5G4.1
#=GS D9U581_HBV/1-352     AC D9U581.1
#=GS F5C106_HBV/1-354     AC F5C106.1
#=GS A8CEJ0_HBV/1-352     AC A8CEJ0.1
#=GS B5BPY6_HBV/1-352     AC B5BPY6.1
#=GS E0ZRS3_HBV/1-351     AC E0ZRS3.1
#=GS Q6XGW8_HBV/1-354     AC Q6XGW8.1
#=GS DPOL_HBVA3/1-354     AC P03159.1
#=GS D2JMZ0_HBV/1-352     AC D2JMZ0.1
#=GS E5RPP7_HBV/1-343     AC E5RPP7.1
#=GS I0C9I2_HBV/1-344     AC I0C9I2.1
#=GS Q9E9B2_HBV/1-352     AC Q9E9B2.1
#=GS B0YGK2_HBV/1-341     AC B0YGK2.1
#=GS G1E8B3_HBV/1-341     AC G1E8B3.1
#=GS G9HNR1_HBV/2-159     AC G9HNR1.1
#=GS H1ACV6_HBV/1-352     AC H1ACV6.1
#=GS G3E5F0_HBV/1-341     AC G3E5F0.1
#=GS B4YLF6_HBV/1-341     AC B4YLF6.1
#=GS C7DNA8_HBV/1-351     AC C7DNA8.1
#=GS Q05H96_HBV/1-340     AC Q05H96.1
#=GS G1E849_HBV/1-341     AC G1E849.1
#=GS C9WDM8_HBV/1-341     AC C9WDM8.1
#=GS A5HKP4_HBV/1-352     AC A5HKP4.1
#=GS D0E5H6_HBV/1-352     AC D0E5H6.1
#=GS D3YG03_HBV/1-341     AC D3YG03.1
#=GS G3XH16_HBV/1-332     AC G3XH16.1
#=GS D2U5Y6_HBV/1-351     AC D2U5Y6.1
#=GS E9L2S0_HBV/1-171     AC E9L2S0.1
#=GS I0DGH9_HBV/1-253     AC I0DGH9.1
#=GS E0ZR68_HBV/1-351     AC E0ZR68.1
#=GS F5C136_HBV/1-354     AC F5C136.1
#=GS D5MSF1_HBV/1-352     AC D5MSF1.1
#=GS C6F4S4_HBV/1-354     AC C6F4S4.1
#=GS Q20BT9_HBV/1-57      AC Q20BT9.1
#=GS D0E6K0_HBV/1-352     AC D0E6K0.1
#=GS D0E614_HBV/1-352     AC D0E614.1
#=GS Q2F512_HBV/227-312   AC Q2F512.1
#=GS I0C987_HBV/1-351     AC I0C987.1
#=GS DPOL_HBVA4/1-354     AC P17100.1
#=GS D0E5R8_HBV/1-352     AC D0E5R8.1
#=GS D5MSG9_HBV/1-343     AC D5MSG9.1
#=GS D0EEA6_HBV/1-354     AC D0EEA6.1
#=GS Q14U80_HBV/1-342     AC Q14U80.1
#=GS A5JIT6_HBV/1-112     AC A5JIT6.1
#=GS C9WDS4_HBV/1-351     AC C9WDS4.1
#=GS B4ZZ18_HBV/1-341     AC B4ZZ18.1
#=GS I0C858_HBV/1-354     AC I0C858.1
#=GS Q6XGU7_HBV/1-354     AC Q6XGU7.1
#=GS C3W3T0_HBV/1-345     AC C3W3T0.1
#=GS B1ABP1_HBV/1-352     AC B1ABP1.1
#=GS F5C0V6_HBV/1-354     AC F5C0V6.1
#=GS D5LD65_HBV/1-352     AC D5LD65.1
#=GS I0DDR1_HBV/245-280   AC I0DDR1.1
#=GS D7NKP9_HBV/1-341     AC D7NKP9.1
#=GS A5GZN8_HBV/1-352     AC A5GZN8.1
#=GS F5C0M4_HBV/1-354     AC F5C0M4.1
#=GS A5JHZ2_HBV/1-112     AC A5JHZ2.1
#=GS F2WS88_HBV/1-352     AC F2WS88.1
#=GS Q58W01_HBV/1-352     AC Q58W01.1
#=GS Q66400_9HEPA/51-413  AC Q66400.1
#=GS A5GZN0_HBV/1-352     AC A5GZN0.1
#=GS H9XRW5_HBV/1-91      AC H9XRW5.1
#=GS I0C999_HBV/1-341     AC I0C999.1
#=GS D0UDU4_HBV/1-352     AC D0UDU4.1
#=GS H6UGA5_HBV/1-341     AC H6UGA5.1
#=GS DPOL_HHBV/1-359      AC P13846.1
#=GS I0DCF9_HBV/1-328     AC I0DCF9.1
#=GS D7NL75_HBV/1-341     AC D7NL75.1
#=GS G4XME3_HBV/1-341     AC G4XME3.1
#=GS G3E5A1_HBV/1-341     AC G3E5A1.1
#=GS D7NKT5_HBV/1-341     AC D7NKT5.1
#=GS H6UGD0_HBV/1-341     AC H6UGD0.1
#=GS G1C893_HBV/1-341     AC G1C893.1
#=GS I0DC97_HBV/1-328     AC I0DC97.1
#=GS D0UE17_HBV/1-334     AC D0UE17.1
#=GS B9VKQ9_HBV/1-352     AC B9VKQ9.1
#=GS E5RD21_HBV/1-352     AC E5RD21.1
#=GS Q8QZP7_HBV/1-351     AC Q8QZP7.1
#=GS I0C865_HBV/1-354     AC I0C865.1
#=GS B5BPH3_HBV/1-352     AC B5BPH3.1
#=GS Q9YZU6_HBV/1-352     AC Q9YZU6.2
#=GS Q8B4P0_HBV/1-354     AC Q8B4P0.1
#=GS DPOL_WHV3/1-393      AC P12899.1
#=GS D0EEH7_HBV/1-354     AC D0EEH7.1
#=GS B0YJR7_HBV/1-351     AC B0YJR7.1
#=GS Q91C47_HBV/1-347     AC Q91C47.1
#=GS G3XGY8_HBV/1-343     AC G3XGY8.1
#=GS O72884_9HEPA/1-366   AC O72884.1
#=GS Q1T7C3_HBV/1-341     AC Q1T7C3.1
#=GS G1C8X1_HBV/1-341     AC G1C8X1.1
#=GS F5C0V9_HBV/1-354     AC F5C0V9.1
#=GS C6F541_HBV/1-354     AC C6F541.1
#=GS H9XQY7_HBV/1-91      AC H9XQY7.1
#=GS E5CYY8_HBV/1-352     AC E5CYY8.1
#=GS E5CZ75_HBV/1-341     AC E5CZ75.1
#=GS Q1PD08_HBV/1-352     AC Q1PD08.1
#=GS DPOL_HBVB5/1-352     AC Q9PX62.1
#=GS B3VLH5_HBV/1-165     AC B3VLH5.1
#=GS F5C0L5_HBV/1-354     AC F5C0L5.1
#=GS H6WFI6_HBV/1-112     AC H6WFI6.1
#=GS E3WCQ3_HBV/1-352     AC E3WCQ3.1
#=GS D3YG71_HBV/1-341     AC D3YG71.1
#=GS Q20BW3_HBV/1-57      AC Q20BW3.1
#=GS Q67908_HBV/1-49      AC Q67908.1
#=GS Q7T457_9HEPA/1-388   AC Q7T457.1
#=GS F5C193_HBV/1-354     AC F5C193.1
#=GS D3K2E6_HBV/1-352     AC D3K2E6.1
#=GS H6UMY9_HBV/1-341     AC H6UMY9.1
#=GS I0C859_HBV/1-354     AC I0C859.1
#=GS D2U674_HBV/1-351     AC D2U674.1
#=GS B5M624_HBV/1-352     AC B5M624.1
#=GS Q6XGH1_HBV/1-341     AC Q6XGH1.1
#=GS B5BPU2_HBV/1-352     AC B5BPU2.1
#=GS I0DGA7_HBV/1-352     AC I0DGA7.1
#=GS I0DDH7_HBV/1-328     AC I0DDH7.1
#=GS A4UBL5_HBV/1-63      AC A4UBL5.1
#=GS E9L2T4_HBV/1-171     AC E9L2T4.1
#=GS B5ATC8_HBV/1-276     AC B5ATC8.1
#=GS C7DY76_HBV/1-347     AC C7DY76.1
#=GS I0DGC1_HBV/1-352     AC I0DGC1.1
#=GS Q4FDH9_HBV/1-352     AC Q4FDH9.1
#=GS F5C0X7_HBV/1-354     AC F5C0X7.1
#=GS Q7THR7_HBV/243-314   AC Q7THR7.1
#=GS G1C945_HBV/1-341     AC G1C945.1
#=GS D8VCL9_HBV/300-332   AC D8VCL9.1
#=GS I0DGG5_HBV/1-352     AC I0DGG5.1
#=GS G1E7H8_HBV/1-341     AC G1E7H8.1
#=GS B3IWX5_HBV/1-351     AC B3IWX5.1
#=GS B7TTW3_HBV/1-352     AC B7TTW3.1
#=GS Q9WP81_HBV/1-214     AC Q9WP81.1
#=GS D5LFF4_HBV/1-352     AC D5LFF4.1
#=GS H6WFD8_HBV/1-112     AC H6WFD8.1
#=GS D0UDN4_HBV/1-352     AC D0UDN4.1
#=GS E5F0W3_HBV/1-49      AC E5F0W3.1
#=GS A5JIN8_HBV/1-112     AC A5JIN8.1
#=GS C6F4J0_HBV/1-354     AC C6F4J0.1
#=GS D5LD11_HBV/1-352     AC D5LD11.1
#=GS E0ZR93_HBV/1-351     AC E0ZR93.1
#=GS O91539_HBV/1-336     AC O91539.1
#=GS I0DDM4_HBV/1-328     AC I0DDM4.1
#=GS Q99HS0_HBV/1-352     AC Q99HS0.1
#=GS O91576_HBV/1-352     AC O91576.2
#=GS I0C8F3_HBV/1-354     AC I0C8F3.1
#=GS D5LCX0_HBV/1-352     AC D5LCX0.1
#=GS Q2L4J1_HBV/1-350     AC Q2L4J1.1
#=GS G4XMF1_HBV/1-352     AC G4XMF1.1
#=GS A5JID1_HBV/1-112     AC A5JID1.1
#=GS D5LCB0_HBV/1-352     AC D5LCB0.1
#=GS B5M580_HBV/1-352     AC B5M580.1
#=GS C1K1N0_HBV/1-352     AC C1K1N0.1
#=GS Q9QRQ9_HBV/136-174   AC Q9QRQ9.1
#=GS Q8UZL2_HBV/1-352     AC Q8UZL2.1
#=GS B5ASV9_HBV/1-352     AC B5ASV9.1
#=GS I0C8C8_HBV/1-354     AC I0C8C8.1
#=GS I0C8L8_HBV/1-335     AC I0C8L8.1
#=GS C7AYB1_HBV/1-354     AC C7AYB1.1
#=GS F5C7L8_HBV/1-352     AC F5C7L8.1
#=GS D2JMG5_HBV/1-352     AC D2JMG5.1
#=GS H6UGK3_HBV/1-341     AC H6UGK3.1
#=GS B2CY36_HBV/1-352     AC B2CY36.1
#=GS E0ZRW3_HBV/1-351     AC E0ZRW3.1
#=GS Q461C4_HBV/1-351     AC Q461C4.1
#=GS I0C8Y2_HBV/1-354     AC I0C8Y2.1
#=GS Q5U7U5_HBV/1-341     AC Q5U7U5.1
#=GS C1K169_HBV/1-352     AC C1K169.1
#=GS D9U5K0_HBV/1-352     AC D9U5K0.1
#=GS D3TJB7_HBV/1-352     AC D3TJB7.1
#=GS G9I480_9HEPA/1-366   AC G9I480.1
#=GS D0VXI9_HBV/1-352     AC D0VXI9.1
#=GS H2ER96_HBV/1-352     AC H2ER96.1
#=GS B5TFK5_HBV/1-112     AC B5TFK5.1
#=GS E9L2P3_HBV/1-171     AC E9L2P3.1
#=GS D0E6G0_HBV/1-352     AC D0E6G0.1
#=GS C3W494_HBV/231-308   AC C3W494.1
#=GS G9G937_HBV/1-342     AC G9G937.1
#=GS Q9DUH1_HBV/1-341     AC Q9DUH1.1
#=GS H6WFJ3_HBV/1-112     AC H6WFJ3.1
#=GS B5LXZ2_HBV/1-341     AC B5LXZ2.1
#=GS B5TFI1_HBV/1-112     AC B5TFI1.1
#=GS Q461B2_HBV/1-351     AC Q461B2.1
#=GS Q80H20_HBV/1-352     AC Q80H20.1
#=GS A8J482_HBV/1-352     AC A8J482.1
#=GS A9CM29_HBV/1-352     AC A9CM29.1
#=GS G9BNJ8_HBV/1-354     AC G9BNJ8.1
#=GS D2JMQ1_HBV/1-352     AC D2JMQ1.1
#=GS DPOL_HBVD2/1-341     AC P24024.1
#=GS C9WDI5_HBV/251-295   AC C9WDI5.1
#=GS Q918I7_HBV/1-352     AC Q918I7.1
#=GS I0C9C7_HBV/1-334     AC I0C9C7.1
#=GS G1E7E1_HBV/1-341     AC G1E7E1.1
#=GS I0DDI2_HBV/1-328     AC I0DDI2.1
#=GS D3TJC9_HBV/1-209     AC D3TJC9.1
#=GS D0E5C1_HBV/1-352     AC D0E5C1.1
#=GS B3V8T9_HBV/240-330   AC B3V8T9.1
#=GS Q19SX2_HBV/1-341     AC Q19SX2.1
#=GS Q1JUT4_HBV/1-352     AC Q1JUT4.1
#=GS B7TU69_HBV/1-352     AC B7TU69.1
#=GS C3W3V4_HBV/1-341     AC C3W3V4.1
#=GS D0UE77_HBV/1-352     AC D0UE77.1
#=GS D0UDV4_HBV/1-352     AC D0UDV4.1
#=GS Q20BU9_HBV/1-55      AC Q20BU9.1
#=GS Q9WP89_HBV/1-284     AC Q9WP89.1
#=GS B5M5J7_HBV/1-352     AC B5M5J7.1
#=GS Q4R1T1_HBV/1-354     AC Q4R1T1.1
#=GS D0VXH7_HBV/1-352     AC D0VXH7.1
#=GS B3VLJ9_HBV/1-176     AC B3VLJ9.1
#=GS E0ZRQ4_HBV/1-351     AC E0ZRQ4.1
#=GS E5RPW5_HBV/1-343     AC E5RPW5.1
#=GS A6MG62_HBV/1-352     AC A6MG62.1
#=GS B5M596_HBV/1-342     AC B5M596.1
#=GS H6UN21_HBV/1-341     AC H6UN21.1
#=GS B5M5B8_HBV/1-338     AC B5M5B8.1
#=GS E7EFC5_HBV/1-352     AC E7EFC5.1
#=GS Q6TMG8_9HEPA/1-367   AC Q6TMG8.1
#=GS Q8UYX7_HHBV/1-354    AC Q8UYX7.1
#=GS Q2MLR2_HBV/1-341     AC Q2MLR2.1
#=GS A8J4F6_HBV/1-333     AC A8J4F6.1
#=GS A7M6U1_HBV/1-352     AC A7M6U1.1
#=GS B0FD05_HBV/1-352     AC B0FD05.1
#=GS G1E7C9_HBV/1-341     AC G1E7C9.1
#=GS B5M5B0_HBV/1-238     AC B5M5B0.1
#=GS D0E662_HBV/1-352     AC D0E662.1
#=GS Q67908_HBV/271-390   AC Q67908.1
#=GS Q5DW13_HBV/1-352     AC Q5DW13.1
#=GS I0C901_HBV/1-354     AC I0C901.1
#=GS I0DDF8_HBV/1-317     AC I0DDF8.1
#=GS D5LB96_HBV/1-352     AC D5LB96.1
#=GS B5M5F2_HBV/1-352     AC B5M5F2.1
#=GS A5GZL8_HBV/1-352     AC A5GZL8.1
#=GS B2CY16_HBV/1-352     AC B2CY16.1
#=GS D0UEC0_HBV/1-352     AC D0UEC0.1
#=GS F5C0X2_HBV/1-354     AC F5C0X2.1
#=GS O71306_9HEPA/51-413  AC O71306.1
#=GS E5CZ31_HBV/1-352     AC E5CZ31.1
#=GS Q20BX7_HBV/1-57      AC Q20BX7.1
#=GS Q1XHF0_HBV/1-341     AC Q1XHF0.1
#=GS D0VXI5_HBV/1-352     AC D0VXI5.1
#=GS I0C8R9_HBV/1-231     AC I0C8R9.1
#=GS D3YG15_HBV/233-317   AC D3YG15.1
#=GS Q003Z3_HBV/1-352     AC Q003Z3.1
#=GS I0C957_HBV/1-354     AC I0C957.1
#=GS C7DMM6_HBV/1-351     AC C7DMM6.1
#=GS A5JHW8_HBV/1-112     AC A5JHW8.1
#=GS C7AYV3_HBV/1-354     AC C7AYV3.1
#=GS Q20BQ5_HBV/1-57      AC Q20BQ5.1
#=GS Q9WP84_HBV/1-339     AC Q9WP84.1
#=GS I0DCZ0_HBV/1-328     AC I0DCZ0.1
#=GS I0C8C2_HBV/1-354     AC I0C8C2.1
#=GS Q80J60_HBV/1-352     AC Q80J60.1
#=GS F5C0M3_HBV/1-354     AC F5C0M3.1
#=GS D2JMA6_HBV/1-352     AC D2JMA6.1
#=GS H6UN60_HBV/1-341     AC H6UN60.1
#=GS I0DDF0_HBV/1-328     AC I0DDF0.1
#=GS G1C8C0_HBV/1-341     AC G1C8C0.1
#=GS A5JHU0_HBV/1-112     AC A5JHU0.1
#=GS B5M4X7_HBV/1-352     AC B5M4X7.1
#=GS C3W463_HBV/1-340     AC C3W463.1
#=GS I0C8F7_HBV/1-354     AC I0C8F7.1
#=GS I0C8D3_HBV/1-354     AC I0C8D3.1
#=GS Q2L4N3_HBV/1-341     AC Q2L4N3.1
#=GS E5CZ65_HBV/1-352     AC E5CZ65.1
#=GS A6MG20_HBV/1-352     AC A6MG20.1
#=GS D2JMD6_HBV/1-352     AC D2JMD6.1
#=GS Q2F4Y9_HBV/1-351     AC Q2F4Y9.1
#=GS E5RPT3_HBV/1-343     AC E5RPT3.1
#=GS I0C8Q6_HBV/226-280   AC I0C8Q6.1
#=GS Q9IX81_HBV/1-35      AC Q9IX81.1
#=GS D6QVW3_HBV/1-352     AC D6QVW3.1
#=GS F5C155_HBV/1-354     AC F5C155.1
#=GS I0C8I4_HBV/1-350     AC I0C8I4.1
#=GS O11885_HBV/1-341     AC O11885.1
#=GS Q9YPU9_HBV/1-341     AC Q9YPU9.1
#=GS Q5U7T9_HBV/1-341     AC Q5U7T9.1
#=GS Q2L4L4_HBV/1-341     AC Q2L4L4.1
#=GS DPOL_HBVF4/1-352     AC Q99HR5.1
#=GS D2JMM7_HBV/1-352     AC D2JMM7.1
#=GS G8CQJ4_HBV/1-49      AC G8CQJ4.1
#=GS A5JIS0_HBV/1-112     AC A5JIS0.1
#=GS F5C1D1_HBV/1-341     AC F5C1D1.1
#=GS E0ZS19_HBV/1-354     AC E0ZS19.1
#=GS C3W3T6_HBV/1-341     AC C3W3T6.1
#=GS I0C874_HBV/1-354     AC I0C874.1
#=GS O39882_HBV/1-352     AC O39882.1
#=GS Q4W6F6_HBV/1-346     AC Q4W6F6.1
#=GS F1AEW6_HBV/1-354     AC F1AEW6.1
#=GS G4XI11_HBV/1-159     AC G4XI11.1
#=GS B7TUD7_HBV/1-352     AC B7TUD7.1
#=GS D3YG64_HBV/1-341     AC D3YG64.1
#=GS F5C0R5_HBV/1-351     AC F5C0R5.1
#=GS Q8JVC9_HBV/1-352     AC Q8JVC9.1
#=GS G4XI23_HBV/1-160     AC G4XI23.1
#=GS O91572_HBV/1-352     AC O91572.1
#=GS I0DDZ6_HBV/1-328     AC I0DDZ6.1
#=GS D0UDX7_HBV/1-350     AC D0UDX7.1
#=GS G0VSG3_HBV/1-354     AC G0VSG3.1
#=GS G1C8B4_HBV/270-319   AC G1C8B4.1
#=GS I0DCZ7_HBV/1-311     AC I0DCZ7.1
#=GS Q00K64_HBV/1-352     AC Q00K64.1
#=GS D9U5A1_HBV/1-352     AC D9U5A1.1
#=GS I0C868_HBV/1-354     AC I0C868.1
#=GS B2LRY3_HBV/1-352     AC B2LRY3.1
#=GS G4XHW3_HBV/1-160     AC G4XHW3.1
#=GS Q2EX95_HBV/1-68      AC Q2EX95.1
#=GS E3Q0L4_HBV/1-352     AC E3Q0L4.1
#=GS H9XQL4_HBV/1-91      AC H9XQL4.1
#=GS I0DGH7_HBV/1-300     AC I0DGH7.1
#=GS Q7TDQ4_HBV/1-352     AC Q7TDQ4.1
#=GS Q9IF40_HBV/1-341     AC Q9IF40.1
#=GS Q2F4Z7_HBV/1-351     AC Q2F4Z7.1
#=GS F5C162_HBV/1-354     AC F5C162.1
#=GS Q5R2Q7_HBV/1-341     AC Q5R2Q7.1
#=GS B5M577_HBV/1-352     AC B5M577.1
#=GS B7TV64_HBV/1-352     AC B7TV64.1
#=GS B9VJX0_HBV/1-240     AC B9VJX0.1
#=GS DPOL_HBVGB/1-341     AC P87744.1
#=GS Q762E7_HBV/1-352     AC Q762E7.1
#=GS E5RPS7_HBV/1-343     AC E5RPS7.1
#=GS Q80MM5_HBV/1-340     AC Q80MM5.1
#=GS D0E5P5_HBV/1-352     AC D0E5P5.1
#=GS D9U1N6_HBV/1-352     AC D9U1N6.1
#=GS A5JIQ8_HBV/1-112     AC A5JIQ8.1
#=GS Q9YKD1_HBV/1-341     AC Q9YKD1.1
#=GS I0DGK9_HBV/1-352     AC I0DGK9.1
#=GS G4XI83_HBV/1-54      AC G4XI83.1
#=GS I0DGA8_HBV/1-352     AC I0DGA8.1
#=GS D4QGI3_HBV/1-341     AC D4QGI3.1
#=GS B5BUS8_HBV/1-354     AC B5BUS8.1
#=GS D6QVZ1_HBV/1-352     AC D6QVZ1.1
#=GS C3W4L2_HBV/1-341     AC C3W4L2.1
#=GS E3VLB8_HBV/1-341     AC E3VLB8.1
#=GS I0C8E6_HBV/1-354     AC I0C8E6.1
#=GS E5L514_9HEPA/1-367   AC E5L514.1
#=GS Q20C16_HBV/1-55      AC Q20C16.1
#=GS F5C114_HBV/279-320   AC F5C114.1
#=GS C3W421_HBV/1-341     AC C3W421.1
#=GS A9QQ00_HBV/1-350     AC A9QQ00.1
#=GS Q20BW9_HBV/1-55      AC Q20BW9.1
#=GS A8J464_HBV/1-352     AC A8J464.1
#=GS Q20BX3_HBV/1-55      AC Q20BX3.1
#=GS H6WFN6_HBV/1-112     AC H6WFN6.1
#=GS B9VKJ2_HBV/264-303   AC B9VKJ2.1
#=GS C0IR97_HBV/1-352     AC C0IR97.1
#=GS I0C8Y0_HBV/1-354     AC I0C8Y0.1
#=GS D2X5F1_HBV/13-171    AC D2X5F1.1
#=GS D0E682_HBV/1-352     AC D0E682.1
#=GS C1K1P3_HBV/1-174     AC C1K1P3.1
#=GS A3F6I3_HBV/1-354     AC A3F6I3.1
#=GS B5TXY8_HBV/1-352     AC B5TXY8.1
#=GS Q9IXE4_HBV/1-52      AC Q9IXE4.1
#=GS Q00KA4_HBV/1-352     AC Q00KA4.1
#=GS B3IWW7_HBV/1-352     AC B3IWW7.1
#=GS C7DMP5_HBV/1-30      AC C7DMP5.1
#=GS B5TF41_HBV/1-112     AC B5TF41.1
#=GS C7DMD8_HBV/1-351     AC C7DMD8.1
#=GS D3TJD5_HBV/205-305   AC D3TJD5.1
#=GS I0C8U7_HBV/1-354     AC I0C8U7.1
#=GS Q6W5D1_HBV/1-352     AC Q6W5D1.1
#=GS D0E602_HBV/1-341     AC D0E602.1
#=GS F5C0K1_HBV/1-354     AC F5C0K1.1
#=GS A8IER8_HBV/1-52      AC A8IER8.1
#=GS C7AYQ6_HBV/1-354     AC C7AYQ6.1
#=GS B5M511_HBV/1-346     AC B5M511.1
#=GS I0DDA9_HBV/1-328     AC I0DDA9.1
#=GS I0C8B8_HBV/1-354     AC I0C8B8.1
#=GS H9XR50_HBV/1-91      AC H9XR50.1
#=GS F5C0V8_HBV/1-354     AC F5C0V8.1
#=GS B7TU45_HBV/1-352     AC B7TU45.1
#=GS E2FIM0_HBV/1-352     AC E2FIM0.1
#=GS O91527_HBV/1-352     AC O91527.1
#=GS I0C8I3_HBV/1-350     AC I0C8I3.1
#=GS I0DE56_HBV/1-328     AC I0DE56.1
#=GS Q91C40_HBV/1-347     AC Q91C40.1
#=GS I0C8R7_HBV/226-280   AC I0C8R7.1
#=GS A5JI13_HBV/1-112     AC A5JI13.1
#=GS G9G9T6_HBV/1-326     AC G9G9T6.1
#=GS D3Y5R6_HBV/1-352     AC D3Y5R6.1
#=GS F5C135_HBV/1-354     AC F5C135.1
#=GS Q58VZ0_HBV/1-352     AC Q58VZ0.1
#=GS G1C8R5_HBV/1-341     AC G1C8R5.1
#=GS Q6XGM0_HBV/1-354     AC Q6XGM0.1
#=GS C7DQQ0_HBV/1-341     AC C7DQQ0.1
#=GS D5LC90_HBV/1-352     AC D5LC90.1
#=GS I0DG91_HBV/1-352     AC I0DG91.1
#=GS F5C1T4_HBV/1-354     AC F5C1T4.1
#=GS I0DGI9_HBV/1-352     AC I0DGI9.1
#=GS Q9WP55_HBV/1-346     AC Q9WP55.1
#=GS B5TFL7_HBV/1-112     AC B5TFL7.1
#=GS D4QGJ0_HBV/1-352     AC D4QGJ0.1
#=GS I0DC93_HBV/1-328     AC I0DC93.1
#=GS G4XI27_HBV/1-160     AC G4XI27.1
#=GS Q5R2R3_HBV/1-341     AC Q5R2R3.1
#=GS I0DCB7_HBV/1-328     AC I0DCB7.1
#=GS G1C8J0_HBV/1-341     AC G1C8J0.1
#=GS E5CZ12_HBV/1-352     AC E5CZ12.1
#=GS E5RPS3_HBV/1-343     AC E5RPS3.1
#=GS B5B4M3_HBV/1-352     AC B5B4M3.1
#=GS A5JJ26_HBV/67-125    AC A5JJ26.1
#=GS I0DGK7_HBV/263-352   AC I0DGK7.1
#=GS G4XI15_HBV/1-160     AC G4XI15.1
#=GS D3TKF0_HBV/1-352     AC D3TKF0.1
#=GS I0DCT6_HBV/1-328     AC I0DCT6.1
#=GS Q8JXG2_HBV/1-349     AC Q8JXG2.1
#=GS B2LW86_HBV/1-352     AC B2LW86.1
#=GS Q80H29_HBV/1-352     AC Q80H29.1
#=GS Q4FDF9_HBV/1-352     AC Q4FDF9.1
#=GS B5M627_HBV/1-352     AC B5M627.1
#=GS I0C916_HBV/1-354     AC I0C916.1
#=GS Q9YPV3_HBV/1-341     AC Q9YPV3.1
#=GS I0C8V5_HBV/1-354     AC I0C8V5.1
#=GS I0C8T5_HBV/1-341     AC I0C8T5.1
#=GS B5M5H1_HBV/1-351     AC B5M5H1.1
#=GS D5LFK2_HBV/1-352     AC D5LFK2.1
#=GS D5LBD7_HBV/1-352     AC D5LBD7.1
#=GS A5JI11_HBV/1-88      AC A5JI11.1
#=GS I0C8G8_HBV/1-354     AC I0C8G8.1
#=GS Q7TDS9_HBV/1-352     AC Q7TDS9.1
#=GS D9U5F5_HBV/1-346     AC D9U5F5.1
#=GS F5C119_HBV/280-320   AC F5C119.1
#=GS G4XI29_HBV/1-160     AC G4XI29.1
#=GS D0UDX3_HBV/1-352     AC D0UDX3.1
#=GS G3XH00_HBV/1-343     AC G3XH00.1
#=GS H9XQX6_HBV/1-91      AC H9XQX6.1
#=GS Q9IXE7_HBV/1-52      AC Q9IXE7.1
#=GS B5U717_HBV/1-341     AC B5U717.1
#=GS B7TUJ3_HBV/1-352     AC B7TUJ3.1
#=GS H3K3F1_HBV/1-352     AC H3K3F1.1
#=GS I0C8Y8_HBV/1-354     AC I0C8Y8.1
#=GS D3TIL0_HBV/284-316   AC D3TIL0.1
#=GS Q20BY7_HBV/1-56      AC Q20BY7.1
#=GS I0C8M7_HBV/1-335     AC I0C8M7.1
#=GS I0DE60_HBV/1-328     AC I0DE60.1
#=GS F5C118_HBV/280-320   AC F5C118.1
#=GS B0FC76_HBV/1-352     AC B0FC76.1
#=GS Q5EDS5_HBV/1-276     AC Q5EDS5.1
#=GS E0ZRN3_HBV/1-351     AC E0ZRN3.1
#=GS G1E8R6_HBV/1-341     AC G1E8R6.1
#=GS B0FCB7_HBV/1-352     AC B0FCB7.1
#=GS Q4KRD8_HBV/1-354     AC Q4KRD8.1
#=GS B7TUA2_HBV/1-352     AC B7TUA2.1
#=GS G4XHY9_HBV/1-160     AC G4XHY9.1
#=GS D0UDV9_HBV/1-352     AC D0UDV9.1
#=GS A6YM40_HBV/1-351     AC A6YM40.1
#=GS A4F540_HBV/1-354     AC A4F540.1
#=GS B3VLJ6_HBV/1-176     AC B3VLJ6.1
#=GS B7TUH6_HBV/1-352     AC B7TUH6.1
#=GS B7TTB0_HBV/1-352     AC B7TTB0.1
#=GS C9WDM2_HBV/1-341     AC C9WDM2.1
#=GS I0DGJ9_HBV/1-347     AC I0DGJ9.1
#=GS H6WF38_HBV/1-112     AC H6WF38.1
#=GS H6UGN2_HBV/1-341     AC H6UGN2.1
#=GS Q5F4J1_HBV/1-346     AC Q5F4J1.1
#=GS C7AYD1_HBV/1-354     AC C7AYD1.1
#=GS F5C110_HBV/1-354     AC F5C110.1
#=GS F5C1B4_HBV/1-354     AC F5C1B4.1
#=GS D3GE60_HBV/1-352     AC D3GE60.1
#=GS Q91HP6_9HEPA/1-367   AC Q91HP6.1
#=GS E5RPU9_HBV/1-343     AC E5RPU9.1
#=GS D0EED2_HBV/1-354     AC D0EED2.1
#=GS C6F4Y7_HBV/1-354     AC C6F4Y7.1
#=GS B5TXJ3_HBV/1-347     AC B5TXJ3.1
#=GS Q91IF5_HBV/2-161     AC Q91IF5.1
#=GS F5C194_HBV/1-354     AC F5C194.1
#=GS A7L367_HBV/1-30      AC A7L367.1
#=GS C1K1S7_HBV/1-352     AC C1K1S7.1
#=GS F5C0T0_HBV/1-351     AC F5C0T0.1
#=GS I0DDK1_HBV/1-328     AC I0DDK1.1
#=GS D0E5L6_HBV/1-352     AC D0E5L6.1
#=GS C7DMB7_HBV/1-351     AC C7DMB7.1
#=GS Q598Q4_HBV/1-351     AC Q598Q4.1
#=GS A5GZM6_HBV/1-352     AC A5GZM6.1
#=GS B5TFI9_HBV/1-112     AC B5TFI9.1
#=GS D0E669_HBV/1-352     AC D0E669.1
#=GS A5JIR2_HBV/1-112     AC A5JIR2.1
#=GS I0C8S7_HBV/1-341     AC I0C8S7.1
#=GS B2LW98_HBV/185-286   AC B2LW98.1
#=GS B4YLK8_HBV/1-341     AC B4YLK8.1
#=GS G9G9D2_HBV/1-341     AC G9G9D2.1
#=GS B5BPJ3_HBV/1-352     AC B5BPJ3.1
#=GS Q03766_HBV/1-352     AC Q03766.1
#=GS F5C174_HBV/1-354     AC F5C174.1
#=GS I0C8J9_HBV/1-335     AC I0C8J9.1
#=GS G9G911_HBV/1-335     AC G9G911.1
#=GS I0C9C2_HBV/1-334     AC I0C9C2.1
#=GS D6QVJ0_HBV/1-352     AC D6QVJ0.1
#=GS H6WF18_HBV/1-112     AC H6WF18.1
#=GS D3K2D9_HBV/1-352     AC D3K2D9.1
#=GS B4Y7G6_HBV/1-352     AC B4Y7G6.2
#=GS G3E5J2_HBV/1-341     AC G3E5J2.1
#=GS G1C8I3_HBV/1-341     AC G1C8I3.1
#=GS D0E5T3_HBV/1-352     AC D0E5T3.1
#=GS G1E7S7_HBV/1-341     AC G1E7S7.1
#=GS C7DMJ2_HBV/1-351     AC C7DMJ2.1
#=GS I0DD05_HBV/1-323     AC I0DD05.1
#=GS F5C0M7_HBV/1-348     AC F5C0M7.1
#=GS H9XQZ1_HBV/1-91      AC H9XQZ1.1
#=GS B0FC45_HBV/1-352     AC B0FC45.1
#=GS H6UGD7_HBV/1-341     AC H6UGD7.1
#=GS DPOL_HBVC5/1-352     AC P03157.1
#=GS F5C141_HBV/1-354     AC F5C141.1
#=GS Q9E6T2_HBV/1-352     AC Q9E6T2.1
#=GS I0DGJ5_HBV/1-192     AC I0DGJ5.1
#=GS Q9QN52_HBV/1-352     AC Q9QN52.1
#=GS E0ZRI8_HBV/1-351     AC E0ZRI8.1
#=GS Q9IX66_HBV/1-52      AC Q9IX66.1
#=GS Q7TDS7_HBV/1-352     AC Q7TDS7.1
#=GS G4XIA2_HBV/1-130     AC G4XIA2.1
#=GS Q8B4G8_HBV/1-354     AC Q8B4G8.1
#=GS Q2F512_HBV/1-232     AC Q2F512.1
#=GS D9U1K8_HBV/1-352     AC D9U1K8.1
#=GS F5HRF4_HBV/1-352     AC F5HRF4.1
#=GS Q6XGK6_HBV/1-341     AC Q6XGK6.1
#=GS G4XMK3_HBV/1-352     AC G4XMK3.1
#=GS H9XRD4_HBV/1-91      AC H9XRD4.1
#=GS G4XI43_HBV/1-144     AC G4XI43.1
#=GS I0DGE1_HBV/1-352     AC I0DGE1.1
#=GS B7TUT7_HBV/1-352     AC B7TUT7.1
#=GS C6F5D9_HBV/1-354     AC C6F5D9.1
#=GS F5C148_HBV/1-354     AC F5C148.1
#=GS I0DCE0_HBV/1-249     AC I0DCE0.1
#=GS Q20BS1_HBV/1-52      AC Q20BS1.1
#=GS B7TTG1_HBV/1-352     AC B7TTG1.1
#=GS B4Y4L4_HBV/1-352     AC B4Y4L4.1
#=GS F5C0R1_HBV/1-351     AC F5C0R1.1
#=GS D2JMD1_HBV/1-352     AC D2JMD1.1
#=GS B7TV77_HBV/1-352     AC B7TV77.1
#=GS B7TU04_HBV/1-352     AC B7TU04.1
#=GS I0DGK4_HBV/1-352     AC I0DGK4.1
#=GS I0DDF4_HBV/1-317     AC I0DDF4.1
#=GS Q4FDI3_HBV/1-352     AC Q4FDI3.1
#=GS G3XGT6_HBV/1-352     AC G3XGT6.1
#=GS C7DSK6_HBV/1-341     AC C7DSK6.1
#=GS Q9WP94_HBV/1-354     AC Q9WP94.1
#=GS D5LCV4_HBV/1-352     AC D5LCV4.1
#=GS B7TUR2_HBV/1-352     AC B7TUR2.1
#=GS D3YGI5_HBV/1-341     AC D3YGI5.1
#=GS I0DD93_HBV/1-328     AC I0DD93.1
#=GS Q8B5R0_HBV/1-190     AC Q8B5R0.1
#=GS G3XGY2_HBV/1-343     AC G3XGY2.1
#=GS C9WDH9_HBV/1-337     AC C9WDH9.1
#=GS Q20BU3_HBV/1-57      AC Q20BU3.1
#=GS Q4FDA3_HBV/1-352     AC Q4FDA3.1
#=GS G1E7E7_HBV/1-253     AC G1E7E7.1
#=GS B5B492_HBV/234-291   AC B5B492.1
#=GS A6MG26_HBV/1-352     AC A6MG26.1
#=GS D3YGH9_HBV/1-341     AC D3YGH9.1
#=GS C7DM58_HBV/1-351     AC C7DM58.1
#=GS E5RPX9_HBV/1-343     AC E5RPX9.1
#=GS D7NKS3_HBV/1-341     AC D7NKS3.1
#=GS D3YG27_HBV/1-241     AC D3YG27.1
#=GS E9L2F7_HBV/1-171     AC E9L2F7.1
#=GS B9VL17_HBV/1-352     AC B9VL17.1
#=GS D2X4R6_HBV/157-195   AC D2X4R6.1
#=GS A1BLQ5_HBV/1-52      AC A1BLQ5.1
#=GS H3K3D7_HBV/1-354     AC H3K3D7.1
#=GS Q80J87_HBV/1-352     AC Q80J87.1
#=GS D5LEI9_HBV/1-352     AC D5LEI9.1
#=GS DPOL_HBVF1/1-352     AC Q05486.1
#=GS F5C0R6_HBV/1-351     AC F5C0R6.1
#=GS I0C8J4_HBV/1-350     AC I0C8J4.1
#=GS C7AYN1_HBV/1-352     AC C7AYN1.1
#=GS I0DC70_HBV/1-328     AC I0DC70.1
#=GS F5C0Z8_HBV/1-354     AC F5C0Z8.1
#=GS Q96846_HBV/1-341     AC Q96846.1
#=GS A9CM37_HBV/1-352     AC A9CM37.1
#=GS Q91IN8_HBV/201-320   AC Q91IN8.1
#=GS E0ZRY7_HBV/1-351     AC E0ZRY7.1
#=GS D0E5N8_HBV/1-352     AC D0E5N8.1
#=GS D5LBS5_HBV/1-352     AC D5LBS5.1
#=GS B2LRW3_HBV/1-352     AC B2LRW3.1
#=GS Q9WRK2_HBV/1-354     AC Q9WRK2.1
#=GS I0C8Z2_HBV/1-354     AC I0C8Z2.1
#=GS Q9WNS2_HBV/1-341     AC Q9WNS2.1
#=GS E9L5C8_HBV/1-352     AC E9L5C8.1
#=GS B9VKT5_HBV/1-352     AC B9VKT5.1
#=GS Q80GV8_HBV/1-352     AC Q80GV8.1
#=GS G4XI33_HBV/1-160     AC G4XI33.1
#=GS B5TFJ3_HBV/1-112     AC B5TFJ3.1
#=GS A5JI83_HBV/1-112     AC A5JI83.1
#=GS B1ABN4_HBV/1-352     AC B1ABN4.1
#=GS D0EEM5_HBV/1-354     AC D0EEM5.1
#=GS G4XHW5_HBV/1-160     AC G4XHW5.1
#=GS B8PTG6_HBV/1-341     AC B8PTG6.1
#=GS I0C995_HBV/1-341     AC I0C995.1
#=GS Q918J6_HBV/1-352     AC Q918J6.1
#=GS B9VKG4_HBV/1-348     AC B9VKG4.1
#=GS Q4FDB1_HBV/1-352     AC Q4FDB1.1
#=GS I0C8A0_HBV/1-354     AC I0C8A0.1
#=GS DPOL_GSHV/1-390      AC P03161.1
#=GS D7NKR7_HBV/1-341     AC D7NKR7.1
#=GS C7DM10_HBV/1-341     AC C7DM10.1
#=GS H9XRI1_HBV/1-91      AC H9XRI1.1
#=GS A5LG66_HBV/1-352     AC A5LG66.1
#=GS G1C8D4_HBV/1-341     AC G1C8D4.1
#=GS B0FCJ1_HBV/1-352     AC B0FCJ1.1
#=GS I0DGB6_HBV/1-352     AC I0DGB6.1
#=GS F5C7N9_HBV/1-352     AC F5C7N9.1
#=GS G1E7Q9_HBV/1-220     AC G1E7Q9.1
#=GS Q56J18_HBV/1-341     AC Q56J18.1
#=GS F5C113_HBV/280-320   AC F5C113.1
#=GS D3YFX2_HBV/1-341     AC D3YFX2.1
#=GS C7DMN8_HBV/1-351     AC C7DMN8.1
#=GS G9G9R4_HBV/1-341     AC G9G9R4.1
#=GS I0DDZ4_HBV/1-239     AC I0DDZ4.1
#=GS I0C895_HBV/1-354     AC I0C895.1
#=GS F5C0T3_HBV/1-351     AC F5C0T3.1
#=GS D9U1P3_HBV/1-352     AC D9U1P3.1
#=GS F5C140_HBV/1-354     AC F5C140.1
#=GS B5TFA9_HBV/1-112     AC B5TFA9.1
#=GS D5LBV7_HBV/1-352     AC D5LBV7.1
#=GS C1K1L0_HBV/233-291   AC C1K1L0.1
#=GS D0EDS9_HBV/1-340     AC D0EDS9.1
#=GS Q70B75_HBV/1-109     AC Q70B75.1
#=GS Q9QAD0_HBV/1-352     AC Q9QAD0.1
#=GS I0C9D0_HBV/1-334     AC I0C9D0.1
#=GS DPOL_HPBDC/1-369     AC P30028.1
#=GS C3W4B8_HBV/1-341     AC C3W4B8.1
#=GS F5C154_HBV/1-354     AC F5C154.1
#=GS G3XH32_HBV/1-332     AC G3XH32.1
#=GS G3XH26_HBV/1-332     AC G3XH26.1
#=GS H1ACY8_HBV/1-352     AC H1ACY8.1
#=GS B3V8T2_HBV/1-352     AC B3V8T2.1
#=GS I0C9E4_HBV/1-338     AC I0C9E4.1
#=GS H9XRV7_HBV/1-91      AC H9XRV7.1
#=GS G4XHZ4_HBV/1-160     AC G4XHZ4.1
#=GS Q8B4B8_HBV/1-341     AC Q8B4B8.1
#=GS F5C126_HBV/1-354     AC F5C126.1
#=GS F5C107_HBV/1-354     AC F5C107.1
#=GS C3W4K6_HBV/1-341     AC C3W4K6.1
#=GS F5C186_HBV/1-354     AC F5C186.1
#=GS DPOL_HBVA9/1-354     AC Q4R1R9.1
#=GS B5TXK7_HBV/1-352     AC B5TXK7.1
#=GS D0E6C2_HBV/1-352     AC D0E6C2.1
#=GS B7TUN6_HBV/1-352     AC B7TUN6.1
#=GS F5C125_HBV/1-354     AC F5C125.1
#=GS F5C124_HBV/1-354     AC F5C124.1
#=GS I0DDE6_HBV/1-328     AC I0DDE6.1
#=GS A1BLV0_HBV/1-52      AC A1BLV0.1
#=GS H9XQS5_HBV/1-91      AC H9XQS5.1
#=GS H6UGB1_HBV/1-341     AC H6UGB1.1
#=GS I0C8R9_HBV/226-280   AC I0C8R9.1
#=GS A6MGC5_HBV/1-352     AC A6MGC5.1
#=GS B1ABM2_HBV/1-240     AC B1ABM2.1
#=GS B2Y6X4_HBV/1-341     AC B2Y6X4.1
#=GS I0DDQ2_HBV/1-164     AC I0DDQ2.1
#=GS G3XGW8_HBV/1-343     AC G3XGW8.1
#=GS Q6XGL3_HBV/1-354     AC Q6XGL3.1
#=GS G4XIA4_HBV/1-130     AC G4XIA4.1
#=GS B5TXU7_HBV/1-352     AC B5TXU7.1
#=GS B5BPS3_HBV/1-352     AC B5BPS3.1
#=GS O91529_HBV/1-352     AC O91529.1
#=GS D3XGB0_HBV/1-351     AC D3XGB0.1
#=GS Q4FDL4_HBV/1-352     AC Q4FDL4.1
#=GS I0C8R4_HBV/226-280   AC I0C8R4.1
#=GS B9VL01_HBV/1-352     AC B9VL01.1
#=GS H6WFN2_HBV/1-112     AC H6WFN2.1
#=GS Q8B5R2_HBV/1-203     AC Q8B5R2.1
#=GS C7AY60_HBV/1-354     AC C7AY60.1
#=GS A0FDU8_HBV/180-317   AC A0FDU8.1
#=GS D5LEF4_HBV/1-352     AC D5LEF4.1
#=GS G1E8J9_HBV/1-327     AC G1E8J9.1
#=GS B5M5Y4_HBV/1-352     AC B5M5Y4.1
#=GS I0DGI2_HBV/1-352     AC I0DGI2.1
#=GS A9QPZ4_HBV/1-351     AC A9QPZ4.1
#=GS D9U5E2_HBV/1-352     AC D9U5E2.1
#=GS B9VKK3_HBV/1-352     AC B9VKK3.1
#=GS D2JMZ4_HBV/1-352     AC D2JMZ4.1
#=GS D0E596_HBV/1-352     AC D0E596.1
#=GS D3YGF5_HBV/1-341     AC D3YGF5.1
#=GS Q7TG38_9HEPA/51-413  AC Q7TG38.1
#=GS Q4JQG7_HBV/1-354     AC Q4JQG7.1
#=GS B9VKL9_HBV/1-352     AC B9VKL9.1
#=GS I0DGK8_HBV/1-352     AC I0DGK8.1
#=GS H9XSY3_HBV/1-77      AC H9XSY3.1
#=GS Q8B4F2_HBV/1-352     AC Q8B4F2.1
#=GS C7DMX3_HBV/1-351     AC C7DMX3.1
#=GS F5C116_HBV/1-285     AC F5C116.1
#=GS A5GZJ2_HBV/1-352     AC A5GZJ2.1
#=GS Q8JN05_HBV/1-352     AC Q8JN05.1
#=GS Q20C22_HBV/1-57      AC Q20C22.1
#=GS G1E883_HBV/1-341     AC G1E883.1
#=GS H6UNA4_HBV/1-341     AC H6UNA4.1
#=GS Q0PMM3_HBV/1-352     AC Q0PMM3.1
#=GS C7AYZ3_HBV/1-354     AC C7AYZ3.1
#=GS D3TJE1_HBV/205-306   AC D3TJE1.1
#=GS B1ABL0_HBV/1-240     AC B1ABL0.1
#=GS B9VK70_HBV/1-352     AC B9VK70.1
#=GS Q19SY8_HBV/1-341     AC Q19SY8.1
#=GS C7DN68_HBV/1-351     AC C7DN68.1
#=GS Q20C28_HBV/1-57      AC Q20C28.1
#=GS D3TK04_HBV/237-280   AC D3TK04.1
#=GS B5B4C0_HBV/234-291   AC B5B4C0.1
#=GS B5M5L5_HBV/1-352     AC B5M5L5.1
#=GS I0C9F0_HBV/1-352     AC I0C9F0.1
#=GS I0C898_HBV/1-354     AC I0C898.1
#=GS C1K1J8_HBV/1-352     AC C1K1J8.1
#=GS D0E5K7_HBV/1-352     AC D0E5K7.1
#=GS E5RD25_HBV/1-352     AC E5RD25.1
#=GS B5M5K4_HBV/1-352     AC B5M5K4.1
#=GS B5TF61_HBV/1-112     AC B5TF61.1
#=GS Q20BP1_HBV/1-57      AC Q20BP1.1
#=GS D0E599_HBV/1-352     AC D0E599.1
#=GS B3VLG6_HBV/1-176     AC B3VLG6.1
#=GS Q81134_HBV/1-352     AC Q81134.1
#=GS B1Q2X0_HBVDR/1-352   AC B1Q2X0.1
#=GS B4YL57_HBV/1-239     AC B4YL57.1
#=GS C7AYK1_HBV/1-348     AC C7AYK1.1
#=GS C7DMR8_HBV/1-351     AC C7DMR8.1
#=GS D0E5W8_HBV/1-352     AC D0E5W8.1
#=GS I0C8T3_HBV/1-341     AC I0C8T3.1
#=GS I0DDD8_HBV/1-328     AC I0DDD8.1
#=GS I0C880_HBV/1-354     AC I0C880.1
#=GS B5ASZ2_HBV/1-352     AC B5ASZ2.1
#=GS I0DGB7_HBV/1-352     AC I0DGB7.1
#=GS Q7TDP8_HBV/1-352     AC Q7TDP8.1
#=GS Q8JXJ8_HBV/1-354     AC Q8JXJ8.1
#=GS H9XQY0_HBV/1-91      AC H9XQY0.1
#=GS B4YL91_HBV/1-341     AC B4YL91.1
#=GS F5C0V3_HBV/1-354     AC F5C0V3.1
#=GS Q20BV1_HBV/1-57      AC Q20BV1.1
#=GS I0C8B6_HBV/1-354     AC I0C8B6.1
#=GS B9VL52_HBV/1-352     AC B9VL52.1
#=GS D0EE74_HBV/1-354     AC D0EE74.1
#=GS G9G9C5_HBV/1-341     AC G9G9C5.1
#=GS B4YKY3_HBV/1-341     AC B4YKY3.1
#=GS Q9YQ41_HBV/1-167     AC Q9YQ41.1
#=GS F5C1C4_HBV/1-341     AC F5C1C4.1
#=GS B7TT97_HBV/1-352     AC B7TT97.1
#=GS F5C187_HBV/1-354     AC F5C187.1
#=GS G1E8J2_HBV/226-280   AC G1E8J2.1
#=GS D6QVX7_HBV/1-352     AC D6QVX7.1
#=GS I0C8U5_HBV/1-354     AC I0C8U5.1
#=GS D0EDV5_HBV/1-341     AC D0EDV5.1
#=GS D0UDT9_HBV/1-352     AC D0UDT9.1
#=GS D2JMF1_HBV/1-352     AC D2JMF1.1
#=GS D0E6K8_HBV/1-352     AC D0E6K8.1
#=GS F5C0H4_HBV/1-341     AC F5C0H4.1
#=GS G9G956_HBV/1-341     AC G9G956.1
#=GS D0E5W0_HBV/1-352     AC D0E5W0.1
#=GS I0C8J0_HBV/1-335     AC I0C8J0.1
#=GS I0C9B6_HBV/1-334     AC I0C9B6.1
#=GS I0C9H8_HBV/1-344     AC I0C9H8.1
#=GS A8IET3_HBV/1-52      AC A8IET3.1
#=GS C1K1Y8_HBV/1-342     AC C1K1Y8.1
#=GS Q8B5Q5_HBV/1-190     AC Q8B5Q5.1
#=GS Q8V1H4_HBV/269-304   AC Q8V1H4.1
#=GS B5M5H8_HBV/1-352     AC B5M5H8.1
#=GS I0C993_HBV/1-341     AC I0C993.1
#=GS D9U5N3_HBV/283-316   AC D9U5N3.1
#=GS B7TU95_HBV/1-352     AC B7TU95.1
#=GS B5M612_HBV/1-352     AC B5M612.1
#=GS C7DQQ6_HBV/1-354     AC C7DQQ6.1
#=GS F5C190_HBV/1-354     AC F5C190.1
#=GS I0DD36_HBV/1-317     AC I0DD36.1
#=GS D8KY01_HBV/1-352     AC D8KY01.1
#=GS Q8QXQ1_HBV/1-341     AC Q8QXQ1.1
#=GS Q805P7_HBV/1-352     AC Q805P7.1
#=GS Q8B4F4_HBV/1-352     AC Q8B4F4.1
#=GS H6UN41_HBV/1-341     AC H6UN41.1
#=GS Q68RP3_HBV/1-352     AC Q68RP3.1
#=GS I0C8Q9_HBV/1-228     AC I0C8Q9.1
#=GS C0IMV0_HBV/1-354     AC C0IMV0.1
#=GS D0EEC6_HBV/1-354     AC D0EEC6.1
#=GS Q6XGS6_HBV/1-354     AC Q6XGS6.1
#=GS D7NKX7_HBV/1-341     AC D7NKX7.1
#=GS Q91IF4_HBV/2-161     AC Q91IF4.1
#=GS I0DE52_HBV/1-328     AC I0DE52.1
#=GS H9XQD0_HBV/1-91      AC H9XQD0.1
#=GS Q5U7V1_HBV/1-341     AC Q5U7V1.1
#=GS H6V5M0_HBV/1-341     AC H6V5M0.1
#=GS H6UG89_HBV/1-341     AC H6UG89.1
#=GS I0C944_HBV/1-354     AC I0C944.1
#=GS D2U638_HBV/1-351     AC D2U638.1
#=GS B5M5V2_HBV/278-311   AC B5M5V2.1
#=GS D4QGJ9_HBV/1-341     AC D4QGJ9.1
#=GS D6QW38_HBV/1-352     AC D6QW38.1
#=GS D6QVM7_HBV/1-352     AC D6QVM7.1
#=GS A5JJ33_HBV/1-180     AC A5JJ33.1
#=GS F5C121_HBV/280-320   AC F5C121.1
#=GS C7DSH8_HBV/1-341     AC C7DSH8.1
#=GS B4ZYW3_HBV/1-340     AC B4ZYW3.1
#=GS I0DE72_HBV/1-328     AC I0DE72.1
#=GS C7AYR8_HBV/1-354     AC C7AYR8.1
#=GS A9QPX4_HBV/1-351     AC A9QPX4.1
#=GS F5C0J0_HBV/1-341     AC F5C0J0.1
#=GS G9G9S0_HBV/199-326   AC G9G9S0.1
#=GS Q9QMK1_HBV/1-352     AC Q9QMK1.1
#=GS B5BPV0_HBV/1-340     AC B5BPV0.1
#=GS B9VKB0_HBV/1-352     AC B9VKB0.1
#=GS F4ZCB9_HBV/1-49      AC F4ZCB9.1
#=GS I0DD25_HBV/1-328     AC I0DD25.1
#=GS Q2F509_HBV/1-351     AC Q2F509.1
#=GS B7TUE8_HBV/1-341     AC B7TUE8.1
#=GS Q3ZKP1_HBV/1-351     AC Q3ZKP1.1
#=GS Q4FD83_HBV/1-352     AC Q4FD83.1
#=GS Q20BR9_HBV/1-57      AC Q20BR9.1
#=GS B5M5U4_HBV/1-352     AC B5M5U4.1
#=GS A6MFZ8_HBV/1-352     AC A6MFZ8.1
#=GS I0DGI0_HBV/1-352     AC I0DGI0.1
#=GS Q67907_HBV/541-832   AC Q67907.1
#=GS H9XR86_HBV/1-91      AC H9XR86.1
#=GS C7DY93_HBV/1-347     AC C7DY93.1
#=GS I0C8M9_HBV/1-335     AC I0C8M9.1
#=GS G4XI71_HBV/1-160     AC G4XI71.1
#=GS B2CS92_HBV/1-352     AC B2CS92.1
#=GS I0C8E5_HBV/1-354     AC I0C8E5.1
#=GS Q6T6J6_9HEPA/1-367   AC Q6T6J6.1
#=GS D0UE54_HBV/1-352     AC D0UE54.1
#=GS B9VKV1_HBV/1-352     AC B9VKV1.1
#=GS A5JJ26_HBV/1-74      AC A5JJ26.1
#=GS Q5EDT7_HBV/1-341     AC Q5EDT7.1
#=GS D0E5U9_HBV/1-352     AC D0E5U9.1
#=GS D0E6G8_HBV/1-352     AC D0E6G8.1
#=GS A5JIG3_HBV/1-112     AC A5JIG3.1
#=GS F5C105_HBV/1-354     AC F5C105.1
#=GS B5B4H6_HBV/234-291   AC B5B4H6.1
#=GS D3TIG1_HBV/1-352     AC D3TIG1.1
#=GS B7TTZ3_HBV/1-352     AC B7TTZ3.1
#=GS F5C1B1_HBV/1-354     AC F5C1B1.1
#=GS F5C0V5_HBV/1-354     AC F5C0V5.1
#=GS Q4R1R4_HBV/1-38      AC Q4R1R4.1
#=GS Q20C00_HBV/1-53      AC Q20C00.1
#=GS D3YGH3_HBV/1-341     AC D3YGH3.1
#=GS I0C8P2_HBV/226-280   AC I0C8P2.1
#=GS B9VL41_HBV/240-290   AC B9VL41.1
#=GS Q8B4D3_HBV/1-328     AC Q8B4D3.1
#=GS G1C932_HBV/1-341     AC G1C932.1
#=GS Q77BG8_HBV/1-167     AC Q77BG8.1
#=GS C6FHW4_HBV/1-354     AC C6FHW4.1
#=GS Q7TDQ7_HBV/1-352     AC Q7TDQ7.1
#=GS D0E5F4_HBV/1-352     AC D0E5F4.1
#=GS I0C872_HBV/1-354     AC I0C872.1
#=GS B2LW81_HBV/1-352     AC B2LW81.1
#=GS B5B4N0_HBV/1-352     AC B5B4N0.1
#=GS Q77BF3_HBV/1-167     AC Q77BF3.1
#=GS B3IWV1_HBV/1-352     AC B3IWV1.1
#=GS D2JMS8_HBV/1-352     AC D2JMS8.1
#=GS B5B4I2_HBV/233-291   AC B5B4I2.1
#=GS B4YTA9_HBV/1-352     AC B4YTA9.1
#=GS I0DD01_HBV/1-328     AC I0DD01.1
#=GS Q2I359_HBV/1-341     AC Q2I359.1
#=GS F5C1T3_HBV/1-352     AC F5C1T3.1
#=GS D3TK50_HBV/1-352     AC D3TK50.1
#=GS Q9E8K6_HBV/1-352     AC Q9E8K6.1
#=GS C7DNI1_HBV/1-351     AC C7DNI1.1
#=GS A9PLI8_HBV/2-43      AC A9PLI8.1
#=GS G4XHZ0_HBV/1-160     AC G4XHZ0.1
#=GS C7AYR2_HBV/1-354     AC C7AYR2.1
#=GS B7TUU4_HBV/1-352     AC B7TUU4.1
#=GS A5JHY0_HBV/1-112     AC A5JHY0.1
#=GS H9XRL2_HBV/1-91      AC H9XRL2.1
#=GS G9G9F3_HBV/1-230     AC G9G9F3.1
#=GS Q81096_HBV/1-354     AC Q81096.1
#=GS C9WDT1_HBV/1-351     AC C9WDT1.1
#=GS H9XQU4_HBV/1-91      AC H9XQU4.1
#=GS B0FCN7_HBV/1-352     AC B0FCN7.1
#=GS H6WFH8_HBV/1-112     AC H6WFH8.1
#=GS I0C8S4_HBV/1-341     AC I0C8S4.1
#=GS D5LCJ4_HBV/1-352     AC D5LCJ4.1
#=GS Q91C53_HBV/1-347     AC Q91C53.1
#=GS H9XRU1_HBV/1-91      AC H9XRU1.1
#=GS Q9WP77_HBV/1-352     AC Q9WP77.1
#=GS H9XSY7_HBV/3-69      AC H9XSY7.1
#=GS Q9WP89_HBV/281-328   AC Q9WP89.1
#=GS B5M530_HBV/1-249     AC B5M530.1
#=GS I0DEA0_HBV/1-210     AC I0DEA0.1
#=GS B5M508_HBV/1-352     AC B5M508.1
#=GS C7DN16_HBV/1-351     AC C7DN16.1
#=GS E0ZRC0_HBV/1-351     AC E0ZRC0.1
#=GS I0C8Y6_HBV/1-354     AC I0C8Y6.1
#=GS C7DMI5_HBV/1-351     AC C7DMI5.1
#=GS E5RPR3_HBV/1-343     AC E5RPR3.1
#=GS H9XRH7_HBV/1-91      AC H9XRH7.1
#=GS E5RPW7_HBV/1-332     AC E5RPW7.1
#=GS I0DD44_HBV/1-327     AC I0DD44.1
#=GS D0E5A9_HBV/1-352     AC D0E5A9.1
#=GS C3W415_HBV/1-341     AC C3W415.1
#=GS F5C0R9_HBV/1-351     AC F5C0R9.1
#=GS A6MG86_HBV/1-352     AC A6MG86.1
#=GS E5CZ16_HBV/1-352     AC E5CZ16.1
#=GS D2JML4_HBV/1-352     AC D2JML4.1
#=GS C1K200_HBV/234-291   AC C1K200.1
#=GS A8J4D8_HBV/1-352     AC A8J4D8.1
#=GS F5C7J7_HBV/1-352     AC F5C7J7.1
#=GS E5F0W2_HBV/1-49      AC E5F0W2.1
#=GS O91536_HBV/1-352     AC O91536.1
#=GS G3E5E3_HBV/1-341     AC G3E5E3.1
#=GS I0C8Q2_HBV/1-341     AC I0C8Q2.1
#=GS F5C0J6_HBV/1-341     AC F5C0J6.1
#=GS I0DCX4_HBV/1-328     AC I0DCX4.1
#=GS F5C0R7_HBV/1-351     AC F5C0R7.1
#=GS A5JIK7_HBV/1-112     AC A5JIK7.1
#=GS G1C959_HBV/1-341     AC G1C959.1
#=GS B9VKU3_HBV/1-352     AC B9VKU3.1
#=GS F5C144_HBV/1-354     AC F5C144.1
#=GS I0DGK2_HBV/1-352     AC I0DGK2.1
#=GS H9XQJ3_HBV/1-91      AC H9XQJ3.1
#=GS G3XGX2_HBV/1-343     AC G3XGX2.1
#=GS A9CM66_HBV/1-184     AC A9CM66.1
#=GS G1E7Y7_HBV/1-341     AC G1E7Y7.1
#=GS G1C8K4_HBV/1-341     AC G1C8K4.1
#=GS E3WCQ7_HBV/1-352     AC E3WCQ7.1
#=GS I0DCH9_HBV/1-317     AC I0DCH9.1
#=GS Q4FDL8_HBV/1-352     AC Q4FDL8.1
#=GS A1YTL7_HBV/1-352     AC A1YTL7.1
#=GS A7L373_HBV/1-30      AC A7L373.1
#=GS G3GDQ1_HBV/1-352     AC G3GDQ1.1
#=GS I0DCQ4_HBV/1-328     AC I0DCQ4.1
#=GS E0ZRX5_HBV/1-351     AC E0ZRX5.1
#=GS E5RPQ1_HBV/1-329     AC E5RPQ1.1
#=GS H9XRI5_HBV/1-91      AC H9XRI5.1
#=GS B3IWW3_HBV/1-352     AC B3IWW3.1
#=GS G3XGZ6_HBV/1-343     AC G3XGZ6.1
#=GS A8IEU0_HBV/1-52      AC A8IEU0.1
#=GS DPOL_HBVD4/1-341     AC Q9QMI1.1
#=GS B5TF26_HBV/1-112     AC B5TF26.1
#=GS B3V8U4_HBV/289-321   AC B3V8U4.1
#=GS Q67889_HBV/1-341     AC Q67889.1
#=GS H6UN84_HBV/1-343     AC H6UN84.1
#=GS I0C8P6_HBV/1-341     AC I0C8P6.1
#=GS B5AT39_HBV/1-352     AC B5AT39.1
#=GS B9VJW2_HBV/1-352     AC B9VJW2.1
#=GS I0DD40_HBV/1-317     AC I0DD40.1
#=GS Q765Y3_HBV/1-352     AC Q765Y3.1
#=GS B9W3Z5_HBV/1-354     AC B9W3Z5.1
#=GS F5C0Y5_HBV/1-354     AC F5C0Y5.1
#=GS I0DGJ0_HBV/1-352     AC I0DGJ0.1
#=GS B5TF97_HBV/1-112     AC B5TF97.1
#=GS D0EZ04_HBV/1-341     AC D0EZ04.1
#=GS H6UN29_HBV/1-341     AC H6UN29.1
#=GS C7DM65_HBV/1-351     AC C7DM65.1
#=GS I0DCC1_HBV/1-328     AC I0DCC1.1
#=GS H6UNC0_HBV/1-341     AC H6UNC0.1
#=GS F5C101_HBV/1-354     AC F5C101.1
#=GS F5C1A2_HBV/1-354     AC F5C1A2.1
#=GS Q5R2N1_HBV/1-352     AC Q5R2N1.1
#=GS I0DE40_HBV/1-317     AC I0DE40.1
#=GS D2X3V7_HBV/2-74      AC D2X3V7.1
#=GS F5C0T4_HBV/1-351     AC F5C0T4.1
#=GS Q461A4_HBV/1-351     AC Q461A4.1
#=GS I0C8H6_HBV/1-354     AC I0C8H6.1
#=GS A5JIT2_HBV/1-112     AC A5JIT2.1
#=GS G1C8U3_HBV/1-341     AC G1C8U3.1
#=GS I0C8C9_HBV/1-354     AC I0C8C9.1
#=GS D9U5N3_HBV/1-285     AC D9U5N3.1
#=GS Q1PCZ2_HBV/1-352     AC Q1PCZ2.1
#=GS D0E581_HBV/1-352     AC D0E581.1
#=GS C9WD94_HBV/1-341     AC C9WD94.1
#=GS C9WDT8_HBV/1-347     AC C9WDT8.1
#=GS Q80SD6_HBV/1-341     AC Q80SD6.1
#=GS Q9QMI5_HBV/1-352     AC Q9QMI5.1
#=GS Q77BG6_HBV/1-167     AC Q77BG6.1
#=GS D9U1M2_HBV/1-352     AC D9U1M2.1
#=GS H9XR18_HBV/1-91      AC H9XR18.1
#=GS Q8B4F0_HBV/1-234     AC Q8B4F0.1
#=GS D0E6J2_HBV/1-352     AC D0E6J2.1
#=GS DPOL_WHV4/1-393      AC P12898.1
#=GS A8J473_HBV/1-352     AC A8J473.1
#=GS H9XQF8_HBV/1-91      AC H9XQF8.1
#=GS D0E6E8_HBV/1-352     AC D0E6E8.1
#=GS I0DDX8_HBV/1-328     AC I0DDX8.1
#=GS D5MSH9_HBV/1-343     AC D5MSH9.1
#=GS E5RPU7_HBV/1-343     AC E5RPU7.1
#=GS Q9IXF3_HBV/1-52      AC Q9IXF3.1
#=GS H9XR42_HBV/1-91      AC H9XR42.1
#=GS C6F5C5_HBV/1-354     AC C6F5C5.1
#=GS B9VKW4_HBV/1-352     AC B9VKW4.1
#=GS D5LD25_HBV/1-352     AC D5LD25.1
#=GS Q67929_HBV/1-291     AC Q67929.1
#=GS Q5Y2B9_HBV/1-354     AC Q5Y2B9.1
#=GS G3XGY6_HBV/1-343     AC G3XGY6.1
#=GS Q67833_HBV/1-94      AC Q67833.1
#=GS E9L2G3_HBV/1-171     AC E9L2G3.1
#=GS Q8B464_HBV/25-108    AC Q8B464.1
#=GS Q9IR28_HBV/1-174     AC Q9IR28.1
#=GS Q5EDQ1_HBV/1-354     AC Q5EDQ1.1
#=GS E0D3B7_HBV/1-352     AC E0D3B7.1
#=GS G3XH10_HBV/1-343     AC G3XH10.1
#=GS H6UG63_HBV/1-341     AC H6UG63.1
#=GS E5CYX7_HBV/1-352     AC E5CYX7.1
#=GS B3GSV7_HBV/1-354     AC B3GSV7.1
#=GS G1E7W9_HBV/1-341     AC G1E7W9.1
#=GS B4YKQ0_HBV/1-354     AC B4YKQ0.1
#=GS Q461D2_HBV/1-351     AC Q461D2.1
#=GS B9VKH6_HBV/1-352     AC B9VKH6.1
#=GS D0E5F7_HBV/1-352     AC D0E5F7.1
#=GS I0C935_HBV/1-354     AC I0C935.1
#=GS A7YEW7_HBV/1-352     AC A7YEW7.1
#=GS G9BNK2_HBV/291-323   AC G9BNK2.1
#=GS Q918N6_9HEPA/1-391   AC Q918N6.1
#=GS I0DE28_HBV/1-328     AC I0DE28.1
#=GS I0C8Z4_HBV/1-354     AC I0C8Z4.1
#=GS F5C0K4_HBV/1-354     AC F5C0K4.1
#=GS D5MSH1_HBV/1-343     AC D5MSH1.1
#=GS C9WE55_HBV/1-346     AC C9WE55.1
#=GS E7CU87_HBV/1-352     AC E7CU87.1
#=GS G9HVG1_HBV/1-352     AC G9HVG1.1
#=GS B5TF14_HBV/1-112     AC B5TF14.1
#=GS G3XKW5_HBV/1-352     AC G3XKW5.1
#=GS I0C8K7_HBV/1-350     AC I0C8K7.1
#=GS H6UN92_HBV/1-340     AC H6UN92.1
#=GS B5M557_HBV/1-352     AC B5M557.1
#=GS H9XQS9_HBV/1-91      AC H9XQS9.1
#=GS D0UDP9_HBV/1-352     AC D0UDP9.1
#=GS Q5DVZ8_HBV/1-352     AC Q5DVZ8.1
#=GS F5C0L8_HBV/1-354     AC F5C0L8.1
#=GS I0DG93_HBV/1-352     AC I0DG93.1
#=GS B5BPX4_HBV/1-352     AC B5BPX4.1
#=GS H6WFA2_HBV/1-112     AC H6WFA2.1
#=GS B5M574_HBV/1-352     AC B5M574.1
#=GS C7AYY7_HBV/1-354     AC C7AYY7.1
#=GS I0C8F8_HBV/1-354     AC I0C8F8.1
#=GS E5F0W4_HBV/1-49      AC E5F0W4.1
#=GS I0C930_HBV/1-354     AC I0C930.1
#=GS I0DGK1_HBV/1-352     AC I0DGK1.1
#=GS H6WFH4_HBV/1-112     AC H6WFH4.1
#=GS I0DDN6_HBV/1-328     AC I0DDN6.1
#=GS D3TJX6_HBV/1-352     AC D3TJX6.1
#=GS G4XHY0_HBV/1-130     AC G4XHY0.1
#=GS F5C1T2_HBV/1-343     AC F5C1T2.1
#=GS H9N855_HBV/1-341     AC H9N855.1
#=GS Q9QAF6_HBV/1-341     AC Q9QAF6.1
#=GS D0E5I6_HBV/1-352     AC D0E5I6.1
#=GS B5M5K0_HBV/1-352     AC B5M5K0.1
#=GS I0C8G4_HBV/1-354     AC I0C8G4.1
#=GS I0DDG2_HBV/1-328     AC I0DDG2.1
#=GS E5CYY2_HBV/1-352     AC E5CYY2.1
#=GS F5C115_HBV/1-285     AC F5C115.1
#=GS D2JMB1_HBV/1-352     AC D2JMB1.1
#=GS B5B4B4_HBV/233-291   AC B5B4B4.1
#=GS G9G8L2_HBV/1-341     AC G9G8L2.1
#=GS D0UDR4_HBV/1-352     AC D0UDR4.1
#=GS I0C8K3_HBV/1-335     AC I0C8K3.1
#=GS Q8B4D2_HBV/1-325     AC Q8B4D2.1
#=GS B5BPP5_HBV/1-352     AC B5BPP5.1
#=GS I0C9D2_HBV/1-334     AC I0C9D2.1
#=GS B5B4P4_HBV/1-352     AC B5B4P4.1
#=GS Q9QMK4_HBV/1-352     AC Q9QMK4.1
#=GS G1E835_HBV/1-341     AC G1E835.1
#=GS B9VK78_HBV/1-352     AC B9VK78.1
#=GS H6UGE2_HBV/1-341     AC H6UGE2.1
#=GS H9N867_HBV/1-341     AC H9N867.1
#=GS Q8B463_HBV/25-108    AC Q8B463.1
#=GS A5GZJ9_HBV/1-352     AC A5GZJ9.1
#=GS A5JHQ1_HBV/1-112     AC A5JHQ1.1
#=GS B4ZYW8_HBV/226-280   AC B4ZYW8.1
#=GS I0C8Y7_HBV/1-354     AC I0C8Y7.1
#=GS B4ZYY6_HBV/1-341     AC B4ZYY6.1
#=GS Q9IXC3_HBV/1-52      AC Q9IXC3.1
#=GS B4ZYZ9_HBV/1-352     AC B4ZYZ9.1
#=GS C3W4K0_HBV/1-341     AC C3W4K0.1
#=GS I0DGJ3_HBV/1-352     AC I0DGJ3.1
#=GS C3W4F6_HBV/1-341     AC C3W4F6.1
#=GS H9XQW4_HBV/1-91      AC H9XQW4.1
#=GS D2JZX4_HBV/1-352     AC D2JZX4.1
#=GS H6WFB0_HBV/1-112     AC H6WFB0.1
#=GS G9G984_HBV/1-255     AC G9G984.1
#=GS A5JIS8_HBV/1-112     AC A5JIS8.1
#=GS D0EE86_HBV/1-354     AC D0EE86.1
#=GS Q9IXF0_HBV/1-52      AC Q9IXF0.1
#=GS E5RPV1_HBV/1-343     AC E5RPV1.1
#=GS I0DDJ3_HBV/1-328     AC I0DDJ3.1
#=GS C7DMB1_HBV/1-351     AC C7DMB1.1
#=GS Q06AN8_HBV/1-352     AC Q06AN8.1
#=GS D0UE95_HBV/1-352     AC D0UE95.1
#=GS Q20BP5_HBV/1-57      AC Q20BP5.1
#=GS E5RPP5_HBV/1-343     AC E5RPP5.1
#=GS I0DCA5_HBV/1-327     AC I0DCA5.1
#=GS B1ABL0_HBV/233-291   AC B1ABL0.1
#=GS B9VL05_HBV/1-352     AC B9VL05.1
#=GS G0YVN1_HBV/1-341     AC G0YVN1.1
#=GS D9U5H0_HBV/1-351     AC D9U5H0.1
#=GS C7DM17_HBV/1-351     AC C7DM17.1
#=GS F5C1M1_HBV/1-336     AC F5C1M1.1
#=GS D0E6D2_HBV/1-352     AC D0E6D2.1
#=GS B4YL31_HBV/1-341     AC B4YL31.1
#=GS B5TFA5_HBV/1-112     AC B5TFA5.1
#=GS F5C0Q8_HBV/1-351     AC F5C0Q8.1
#=GS B9VL72_HBV/1-215     AC B9VL72.1
#=GS Q1JUT8_HBV/1-352     AC Q1JUT8.1
#=GS G9G8Z1_HBV/1-341     AC G9G8Z1.1
#=GS D9U559_HBV/1-347     AC D9U559.1
#=GS G1E8M5_HBV/1-341     AC G1E8M5.1
#=GS B5TXW7_HBV/1-352     AC B5TXW7.1
#=GS B7TU25_HBV/1-352     AC B7TU25.1
#=GS Q5SDJ8_HBV/1-347     AC Q5SDJ8.1
#=GS A5JI51_HBV/1-112     AC A5JI51.1
#=GS F5C0H1_HBV/1-341     AC F5C0H1.1
#=GS A5GZI8_HBV/1-352     AC A5GZI8.1
#=GS F5C1M8_HBV/1-341     AC F5C1M8.1
#=GS Q70B87_HBV/1-105     AC Q70B87.1
#=GS Q68RN5_HBV/1-351     AC Q68RN5.1
#=GS B0FCA2_HBV/279-321   AC B0FCA2.1
#=GS D5LF04_HBV/1-352     AC D5LF04.1
#=GS I0C8A2_HBV/1-354     AC I0C8A2.1
#=GS G3E5J9_HBV/1-341     AC G3E5J9.1
#=GS Q98VM6_HBV/1-346     AC Q98VM6.1
#=GS H9XRX7_HBV/1-91      AC H9XRX7.1
#=GS I0C937_HBV/1-354     AC I0C937.1
#=GS Q29VF9_HBV/1-351     AC Q29VF9.1
#=GS D5LEK3_HBV/1-352     AC D5LEK3.1
#=GS H3K3T3_HBV/1-354     AC H3K3T3.1
#=GS F5C1T6_HBV/1-354     AC F5C1T6.1
#=GS C5WJV4_HBV/1-352     AC C5WJV4.1
#=GS D0UDU9_HBV/1-352     AC D0UDU9.1
#=GS Q9QMJ8_HBV/1-352     AC Q9QMJ8.1
#=GS C1K1B9_HBV/1-352     AC C1K1B9.1
#=GS B5B485_HBV/1-352     AC B5B485.1
#=GS H6UMZ3_HBV/1-341     AC H6UMZ3.1
#=GS H6WFF8_HBV/1-112     AC H6WFF8.1
#=GS F5C191_HBV/1-354     AC F5C191.1
#=GS Q7TDS1_HBV/1-352     AC Q7TDS1.1
#=GS C1K1W8_HBV/1-352     AC C1K1W8.1
#=GS Q8B4B4_HBV/1-341     AC Q8B4B4.1
#=GS G3EQX4_HBV/2-41      AC G3EQX4.1
#=GS F5C0Z4_HBV/1-354     AC F5C0Z4.1
#=GS B5B492_HBV/1-242     AC B5B492.1
#=GS Q80H13_HBV/1-352     AC Q80H13.1
#=GS Q9QMI9_HBV/1-352     AC Q9QMI9.1
#=GS A5JIN4_HBV/1-112     AC A5JIN4.1
#=GS G4XHX4_HBV/1-160     AC G4XHX4.1
#=GS F5C117_HBV/280-320   AC F5C117.1
#=GS C7DMZ8_HBV/1-351     AC C7DMZ8.1
#=GS A0MMK6_HBV/1-352     AC A0MMK6.1
#=GS G9G8W3_HBV/1-340     AC G9G8W3.1
#=GS Q99HU3_HBV/1-352     AC Q99HU3.1
#=GS B5TFK9_HBV/1-112     AC B5TFK9.1
#=GS A5JII7_HBV/1-112     AC A5JII7.1
#=GS H6UNC8_HBV/1-340     AC H6UNC8.1
#=GS Q9WP72_HBV/1-324     AC Q9WP72.1
#=GS I0DDC2_HBV/1-328     AC I0DDC2.1
#=GS D5LEH5_HBV/1-352     AC D5LEH5.1
#=GS B5M5T0_HBV/1-352     AC B5M5T0.1
#=GS Q7T668_HBV/1-341     AC Q7T668.1
#=GS F5C7L1_HBV/1-352     AC F5C7L1.1
#=GS D4QGJ6_HBV/1-341     AC D4QGJ6.1
#=GS A5JHV2_HBV/1-112     AC A5JHV2.1
#=GS D2JMP6_HBV/1-346     AC D2JMP6.1
#=GS F5C0U0_HBV/1-351     AC F5C0U0.1
#=GS B5TXP5_HBV/1-352     AC B5TXP5.1
#=GS F5C122_HBV/1-285     AC F5C122.1
#=GS I0DDM0_HBV/1-328     AC I0DDM0.1
#=GS I0C8T4_HBV/1-341     AC I0C8T4.1
#=GS Q81120_HBV/1-352     AC Q81120.1
#=GS B4ZZ11_HBV/1-341     AC B4ZZ11.1
#=GS Q8B4F6_HBV/1-264     AC Q8B4F6.1
#=GS A6MFZ3_HBV/1-352     AC A6MFZ3.1
#=GS D6QVY4_HBV/1-352     AC D6QVY4.1
#=GS H6WF30_HBV/1-112     AC H6WF30.1
#=GS D0EE54_HBV/1-354     AC D0EE54.1
#=GS O91524_HBV/1-352     AC O91524.1
#=GS B2CY02_HBV/1-352     AC B2CY02.1
#=GS A4F530_HBV/30-360    AC A4F530.1
#=GS H9XRY1_HBV/1-91      AC H9XRY1.1
#=GS D0E610_HBV/1-350     AC D0E610.1
#=GS D6QVZ8_HBV/1-352     AC D6QVZ8.1
#=GS H2ER51_HBV/1-352     AC H2ER51.1
#=GS B7TTM6_HBV/1-347     AC B7TTM6.1
#=GS I0C875_HBV/1-354     AC I0C875.1
#=GS H6UND2_HBV/1-333     AC H6UND2.1
#=GS G1C906_HBV/1-341     AC G1C906.1
#=GS I0DGF7_HBV/1-352     AC I0DGF7.1
#=GS C7DNI8_HBV/1-351     AC C7DNI8.1
#=GS I0C8M6_HBV/1-335     AC I0C8M6.1
#=GS Q80GU0_HBV/1-353     AC Q80GU0.1
#=GS B5TFC1_HBV/1-112     AC B5TFC1.1
#=GS G3XGW2_HBV/1-343     AC G3XGW2.1
#=GS B5TF02_HBV/1-112     AC B5TF02.1
#=GS H9XRS5_HBV/1-91      AC H9XRS5.1
#=GS Q19T02_HBV/1-340     AC Q19T02.1
#=GS F5C0X9_HBV/1-354     AC F5C0X9.1
#=GS C7DME5_HBV/1-351     AC C7DME5.1
#=GS E5CZ46_HBV/1-352     AC E5CZ46.1
#=GS D3GE50_HBV/1-352     AC D3GE50.1
#=GS C1K1F8_HBV/1-352     AC C1K1F8.1
#=GS G1C8S9_HBV/1-341     AC G1C8S9.1
#=GS D3GE39_HBV/1-352     AC D3GE39.1
#=GS B8PTH3_HBV/1-341     AC B8PTH3.1
#=GS Q4R1R2_HBV/1-38      AC Q4R1R2.1
#=GS D0E694_HBV/1-352     AC D0E694.1
#=GS D2X4P4_HBV/1-121     AC D2X4P4.1
#=GS I0DCH1_HBV/1-328     AC I0DCH1.1
#=GS F1AER9_HBV/1-354     AC F1AER9.1
#=GS E5CZ02_HBV/1-352     AC E5CZ02.1
#=GS I0C8J5_HBV/1-350     AC I0C8J5.1
#=GS D9U575_HBV/1-346     AC D9U575.1
#=GS Q3ZKP5_HBV/1-351     AC Q3ZKP5.1
#=GS Q6RSF2_9HEPA/1-367   AC Q6RSF2.1
#=GS C7DSI5_HBV/1-341     AC C7DSI5.1
#=GS G3XH22_HBV/1-332     AC G3XH22.1
#=GS H9XQC6_HBV/1-91      AC H9XQC6.1
#=GS G4XI82_HBV/1-160     AC G4XI82.1
#=GS A7L364_HBV/1-30      AC A7L364.1
#=GS O91551_HBV/1-352     AC O91551.1
#=GS B2LRT6_HBV/1-352     AC B2LRT6.1
#=GS D5LBM4_HBV/1-352     AC D5LBM4.1
#=GS D2JMX5_HBV/1-352     AC D2JMX5.1
#=GS C3W4I1_HBV/1-341     AC C3W4I1.1
#=GS I0C8I0_HBV/1-350     AC I0C8I0.1
#=GS H2ER64_HBV/1-352     AC H2ER64.1
#=GS Q2LCF6_HBV/1-341     AC Q2LCF6.1
#=GS H6UGE8_HBV/1-341     AC H6UGE8.1
#=GS D3YGC5_HBV/1-341     AC D3YGC5.1
#=GS B9VKA6_HBV/1-352     AC B9VKA6.1
#=GS B5M5N5_HBV/1-352     AC B5M5N5.1
#=GS G3XGY4_HBV/1-343     AC G3XGY4.1
#=GS B9VKB8_HBV/1-352     AC B9VKB8.1
#=GS D2JMK9_HBV/1-352     AC D2JMK9.1
#=GS A5JIC7_HBV/1-112     AC A5JIC7.1
#=GS F4ZCB8_HBV/1-49      AC F4ZCB8.1
#=GS F1AEN7_HBV/1-354     AC F1AEN7.1
#=GS F5C0J1_HBV/1-341     AC F5C0J1.1
#=GS D3TIR3_HBV/1-352     AC D3TIR3.1
#=GS Q69590_HBV/541-842   AC Q69590.1
#=GS B9VL60_HBV/1-195     AC B9VL60.1
#=GS I0C8K6_HBV/1-335     AC I0C8K6.1
#=GS D0U3X2_HBV/1-354     AC D0U3X2.1
#=GS A9CM41_HBV/1-352     AC A9CM41.1
#=GS B5AST7_HBV/1-352     AC B5AST7.1
#=GS C5WK38_HBV/1-352     AC C5WK38.1
#=GS B5M5X2_HBV/1-352     AC B5M5X2.1
#=GS G4XI37_HBV/1-160     AC G4XI37.1
#=GS Q8B3N7_9HEPA/1-372   AC Q8B3N7.1
#=GS B4YKZ7_HBV/1-341     AC B4YKZ7.1
#=GS G1E7Y1_HBV/1-341     AC G1E7Y1.1
#=GS I0C8T9_HBV/1-354     AC I0C8T9.1
#=GS Q80GX5_HBV/1-203     AC Q80GX5.1
#=GS F1AEQ1_HBV/1-354     AC F1AEQ1.1
#=GS B2LSK9_HBV/1-352     AC B2LSK9.1
#=GS H6UN33_HBV/1-341     AC H6UN33.1
#=GS I0C969_HBV/1-354     AC I0C969.1
#=GS E3Q0P8_HBV/1-352     AC E3Q0P8.1
#=GS H9XR03_HBV/1-91      AC H9XR03.1
#=GS C3W4G8_HBV/1-341     AC C3W4G8.1
#=GS C5WJY6_HBV/1-352     AC C5WJY6.1
#=GS D9U5I2_HBV/1-352     AC D9U5I2.1
#=GS I0DGK3_HBV/1-352     AC I0DGK3.1
#=GS F5C1E4_HBV/1-341     AC F5C1E4.1
#=GS C7DML3_HBV/1-351     AC C7DML3.1
#=GS G3E573_HBV/1-341     AC G3E573.1
#=GS A5JIN0_HBV/1-112     AC A5JIN0.1
#=GS Q69616_HBV/541-843   AC Q69616.1
#=GS F2WS96_HBV/1-352     AC F2WS96.1
#=GS D0EZ10_HBV/1-341     AC D0EZ10.1
#=GS F5C0S9_HBV/1-333     AC F5C0S9.1
#=GS D0E5C9_HBV/1-352     AC D0E5C9.1
#=GS B4YLJ5_HBV/1-341     AC B4YLJ5.1
#=GS B5M656_HBV/1-352     AC B5M656.1
#=GS B5TFE5_HBV/1-112     AC B5TFE5.1
#=GS D3YGG1_HBV/1-341     AC D3YGG1.1
#=GS H2ERG8_HBV/1-334     AC H2ERG8.1
#=GS A6H2L8_HBV/1-341     AC A6H2L8.1
#=GS I0DCL5_HBV/1-328     AC I0DCL5.1
#=GS H6WF50_HBV/1-112     AC H6WF50.1
#=GS D0EEF2_HBV/1-354     AC D0EEF2.1
#=GS G9G8J1_HBV/1-341     AC G9G8J1.1
#=GS I0C870_HBV/1-354     AC I0C870.1
#=GS C1K1X4_HBV/1-352     AC C1K1X4.1
#=GS H3K3T9_HBV/1-352     AC H3K3T9.1
#=GS Q2I363_HBV/1-341     AC Q2I363.1
#=GS B4YTB6_HBV/1-181     AC B4YTB6.1
#=GS F5C180_HBV/1-354     AC F5C180.1
#=GS A7XNR0_HBV/1-354     AC A7XNR0.1
#=GS F5C1B9_HBV/1-354     AC F5C1B9.1
#=GS Q20BQ9_HBV/1-57      AC Q20BQ9.1
#=GS Q20C26_HBV/1-52      AC Q20C26.1
#=GS B0FCF8_HBV/1-352     AC B0FCF8.1
#=GS F1AER5_HBV/1-341     AC F1AER5.1
#=GS Q8JXH7_HBV/1-351     AC Q8JXH7.1
#=GS B5TFB7_HBV/1-112     AC B5TFB7.1
#=GS H3K3U6_HBV/1-354     AC H3K3U6.1
#=GS B2LWC4_HBV/1-337     AC B2LWC4.1
#=GS G1E8T4_HBV/1-341     AC G1E8T4.1
#=GS I0DDS9_HBV/1-317     AC I0DDS9.1
#=GS A5GZH3_HBV/1-352     AC A5GZH3.1
#=GS D2JMH4_HBV/1-330     AC D2JMH4.1
#=GS E5RDA1_HBV/1-341     AC E5RDA1.1
#=GS B7TV53_HBV/1-352     AC B7TV53.1
#=GS B9VKX5_HBV/1-352     AC B9VKX5.1
#=GS Q9IXB4_HBV/1-52      AC Q9IXB4.1
#=GS B5BPL3_HBV/1-352     AC B5BPL3.1
#=GS F5C1A5_HBV/1-354     AC F5C1A5.1
#=GS F5C0S0_HBV/1-351     AC F5C0S0.1
#=GS C1K1R4_HBV/1-352     AC C1K1R4.1
#=GS B5M631_HBV/1-352     AC B5M631.1
#=GS F5C7R0_HBV/1-352     AC F5C7R0.1
#=GS D7NL29_HBV/1-341     AC D7NL29.1
#=GS B4YKZ0_HBV/1-341     AC B4YKZ0.1
#=GS G3E5H8_HBV/1-341     AC G3E5H8.1
#=GS H6V5T0_HBV/1-352     AC H6V5T0.1
#=GS C1K1D2_HBV/1-352     AC C1K1D2.1
#=GS D0E6K4_HBV/1-352     AC D0E6K4.1
#=GS Q9IX96_HBV/1-52      AC Q9IX96.1
#=GS C3W3W0_HBV/1-341     AC C3W3W0.1
#=GS E5RD57_HBV/1-352     AC E5RD57.1
#=GS B4ZYT6_HBV/1-352     AC B4ZYT6.1
#=GS E0ZRZ1_HBV/1-351     AC E0ZRZ1.1
#=GS H6UGM1_HBV/1-341     AC H6UGM1.1
#=GS B0FCM6_HBV/1-352     AC B0FCM6.1
#=GS B9VJX0_HBV/234-291   AC B9VJX0.1
#=GS G4XMM3_HBV/1-352     AC G4XMM3.1
#=GS Q3ZKQ3_HBV/1-354     AC Q3ZKQ3.1
#=GS A6MG74_HBV/1-352     AC A6MG74.1
#=GS I0C8G2_HBV/1-354     AC I0C8G2.1
#=GS B5BUT2_HBV/1-354     AC B5BUT2.1
#=GS D0E5P1_HBV/1-352     AC D0E5P1.1
#=GS G9G984_HBV/239-291   AC G9G984.1
#=GS B5B4F7_HBV/1-352     AC B5B4F7.1
#=GS I0C910_HBV/1-354     AC I0C910.1
#=GS B7TTV6_HBV/1-352     AC B7TTV6.1
#=GS Q80J66_HBV/1-345     AC Q80J66.1
#=GS G9G9P3_HBV/228-308   AC G9G9P3.1
#=GS E5F0W7_HBV/1-49      AC E5F0W7.1
#=GS F4ZCB0_HBV/1-49      AC F4ZCB0.1
#=GS Q9YZS3_HBV/1-334     AC Q9YZS3.1
#=GS B9VKH2_HBV/1-352     AC B9VKH2.1
#=GS E9L2N3_HBV/1-171     AC E9L2N3.1
#=GS Q9ELS4_HBV/1-172     AC Q9ELS4.1
#=GS G4XML9_HBV/1-352     AC G4XML9.1
#=GS G1E7H1_HBV/1-341     AC G1E7H1.1
#=GS D2JMG9_HBV/1-352     AC D2JMG9.1
#=GS C9WDR7_HBV/1-351     AC C9WDR7.1
#=GS B9VKE8_HBV/1-352     AC B9VKE8.1
#=GS H6WFF0_HBV/1-112     AC H6WFF0.1
#=GS Q8BCI7_HBV/1-352     AC Q8BCI7.1
#=GS Q8JN01_HBV/1-348     AC Q8JN01.1
#=GS H9XRB0_HBV/1-91      AC H9XRB0.1
#=GS I0DGB4_HBV/1-352     AC I0DGB4.1
#=GS I0C8I6_HBV/1-350     AC I0C8I6.1
#=GS B7TV21_HBV/1-352     AC B7TV21.1
#=GS B7TUL4_HBV/1-347     AC B7TUL4.1
#=GS I0DCF5_HBV/1-328     AC I0DCF5.1
#=GS I0C9B1_HBV/1-341     AC I0C9B1.1
#=GS C9WDH3_HBV/1-341     AC C9WDH3.1
#=GS D8V9Z2_HBV/48-150    AC D8V9Z2.1
#=GS I0DCV5_HBV/1-328     AC I0DCV5.1
#=GS H2ERB0_HBV/1-352     AC H2ERB0.1
#=GS D0EE22_HBV/1-354     AC D0EE22.1
#=GS O91514_HBV/1-336     AC O91514.1
#=GS G3XGY0_HBV/1-343     AC G3XGY0.1
#=GS I0DD33_HBV/1-328     AC I0DD33.1
#=GS C6F583_HBV/1-354     AC C6F583.1
#=GS B7TUC1_HBV/1-352     AC B7TUC1.1
#=GS Q45V32_HBV/1-341     AC Q45V32.1
#=GS A5JHZ6_HBV/1-112     AC A5JHZ6.1
#=GS D3YG83_HBV/1-341     AC D3YG83.1
#=GS C7DN82_HBV/1-351     AC C7DN82.1
#=GS D3Y1K7_HBV/1-352     AC D3Y1K7.1
#=GS D0UE12_HBV/1-352     AC D0UE12.1
#=GS H9XQB8_HBV/1-91      AC H9XQB8.1
#=GS C9WDF0_HBV/1-325     AC C9WDF0.1
#=GS B0FCZ8_HBV/1-352     AC B0FCZ8.1
#=GS D0E679_HBV/1-352     AC D0E679.1
#=GS B5M618_HBV/1-352     AC B5M618.1
#=GS Q9PWY8_HBV/1-352     AC Q9PWY8.1
#=GS Q8B5Q0_HBV/1-200     AC Q8B5Q0.1
#=GS B5TFB3_HBV/1-112     AC B5TFB3.1
#=GS I0C8D9_HBV/1-354     AC I0C8D9.1
#=GS Q9QMI7_HBV/1-352     AC Q9QMI7.1
#=GS B1ABL8_HBV/1-240     AC B1ABL8.1
#=GS D3TKE3_HBV/1-352     AC D3TKE3.1
#=GS C7DSN2_HBV/1-341     AC C7DSN2.1
#=GS F5C0I6_HBV/1-341     AC F5C0I6.1
#=GS I0C9B0_HBV/1-341     AC I0C9B0.1
#=GS Q20C18_HBV/1-57      AC Q20C18.1
#=GS C7DNE9_HBV/1-351     AC C7DNE9.1
#=GS Q7TDP5_HBV/1-352     AC Q7TDP5.1
#=GS B9VKG8_HBV/1-292     AC B9VKG8.1
#=GS C7AYW5_HBV/1-354     AC C7AYW5.1
#=GS E5RPQ9_HBV/1-325     AC E5RPQ9.1
#=GS Q80J80_HBV/1-352     AC Q80J80.1
#=GS I0DDU9_HBV/1-328     AC I0DDU9.1
#=GS Q99HT1_HBV/1-352     AC Q99HT1.1
#=GS Q91IF8_HBV/26-161    AC Q91IF8.1
#=GS D6QVN4_HBV/1-352     AC D6QVN4.1
#=GS C1K1L9_HBV/1-346     AC C1K1L9.1
#=GS H9XQY4_HBV/1-91      AC H9XQY4.1
#=GS DPOL_WHV5/1-393      AC P17396.1
#=GS A7L369_HBV/1-30      AC A7L369.1
#=GS E5RD37_HBV/1-352     AC E5RD37.1
#=GS B7TV34_HBV/1-352     AC B7TV34.1
#=GS I0DGK5_HBV/1-352     AC I0DGK5.1
#=GS E5F0X7_HBV/1-49      AC E5F0X7.1
#=GS Q67874_HBV/1-341     AC Q67874.1
#=GS G1E8N9_HBV/1-341     AC G1E8N9.1
#=GS E3Q0Q4_HBV/1-352     AC E3Q0Q4.1
#=GS E0ZS08_HBV/1-351     AC E0ZS08.1
#=GS Q80J53_HBV/1-352     AC Q80J53.1
#=GS D0E5X6_HBV/1-352     AC D0E5X6.1
#=GS C1K1Z4_HBV/1-342     AC C1K1Z4.1
#=GS G4XMN9_HBV/1-352     AC G4XMN9.1
#=GS E0ZRS9_HBV/1-351     AC E0ZRS9.1
#=GS F5C1A8_HBV/1-354     AC F5C1A8.1
#=GS I0C8Z8_HBV/1-354     AC I0C8Z8.1
#=GS F5C0Z0_HBV/1-354     AC F5C0Z0.1
#=GS B4YKL6_HBV/1-354     AC B4YKL6.1
#=GS B2CZG3_HBV/1-352     AC B2CZG3.1
#=GS H6WF66_HBV/1-112     AC H6WF66.1
#=GS F5C188_HBV/1-354     AC F5C188.1
#=GS Q6XGH8_HBV/1-341     AC Q6XGH8.1
#=GS A9QPY1_HBV/1-351     AC A9QPY1.1
#=GS D6QVU3_HBV/1-352     AC D6QVU3.1
#=GS Q67932_HBV/1-291     AC Q67932.1
#=GS C7DY99_HBV/1-347     AC C7DY99.1
#=GS E5RPN1_HBV/1-352     AC E5RPN1.1
#=GS B5M5W4_HBV/1-242     AC B5M5W4.1
#=GS C5WJW2_HBV/1-352     AC C5WJW2.1
#=GS Q7THT0_HBV/1-352     AC Q7THT0.1
#=GS F5C0J2_HBV/1-312     AC F5C0J2.1
#=GS D3KZ70_HBV/1-354     AC D3KZ70.1
#=GS G1E7M2_HBV/1-341     AC G1E7M2.1
#=GS I0C8K1_HBV/1-350     AC I0C8K1.1
#=GS E5RD49_HBV/1-352     AC E5RD49.1
#=GS B5M5R4_HBV/1-352     AC B5M5R4.1
#=GS Q67885_HBV/1-334     AC Q67885.1
#=GS I0C8S1_HBV/1-341     AC I0C8S1.1
#=GS D3TIS6_HBV/1-352     AC D3TIS6.1
#=GS F5C0S3_HBV/1-333     AC F5C0S3.1
#=GS E7CT74_HBV/1-352     AC E7CT74.1
#=GS E5RPR9_HBV/1-343     AC E5RPR9.1
#=GS F5C0W1_HBV/1-354     AC F5C0W1.1
#=GS B0FCV6_HBV/1-352     AC B0FCV6.1
#=GS O39644_HBV/1-352     AC O39644.1
#=GS Q4FDL0_HBV/1-352     AC Q4FDL0.1
#=GS O09513_HBV/1-211     AC O09513.1
#=GS E5RPM7_HBV/1-352     AC E5RPM7.1
#=GS B2WSQ9_HBV/1-352     AC B2WSQ9.1
#=GS D9U5A6_HBV/1-352     AC D9U5A6.1
#=GS D0UE39_HBV/1-352     AC D0UE39.1
#=GS F5C182_HBV/1-354     AC F5C182.1
#=GS A4UIM3_HBV/1-61      AC A4UIM3.1
#=GS D5LBB7_HBV/1-352     AC D5LBB7.1
#=GS G1E7D5_HBV/1-301     AC G1E7D5.1
#=GS A5LG26_HBV/1-352     AC A5LG26.1
#=GS A9CM33_HBV/1-352     AC A9CM33.1
#=GS I0DCG3_HBV/1-328     AC I0DCG3.1
#=GS B9VK23_HBV/1-352     AC B9VK23.1
#=GS C6L681_HBV/1-341     AC C6L681.1
#=GS D3YG09_HBV/1-341     AC D3YG09.1
#=GS B4ZYU9_HBV/1-341     AC B4ZYU9.1
#=GS B9VKP6_HBV/1-352     AC B9VKP6.1
#=GS H9XRI9_HBV/1-91      AC H9XRI9.1
#=GS B5ASQ6_HBV/1-352     AC B5ASQ6.1
#=GS A5LG70_HBV/1-352     AC A5LG70.1
#=GS B9VL33_HBV/1-352     AC B9VL33.1
#=GS B5BUU0_HBV/1-354     AC B5BUU0.1
#=GS F5C0W6_HBV/1-354     AC F5C0W6.1
#=GS C6F501_HBV/1-354     AC C6F501.1
#=GS D3YFX8_HBV/1-341     AC D3YFX8.1
#=GS C7DNL5_HBV/1-352     AC C7DNL5.1
#=GS Q8QXQ7_HBV/1-354     AC Q8QXQ7.1
#=GS B9VJX4_HBV/1-352     AC B9VJX4.1
#=GS Q8JXH4_HBV/1-351     AC Q8JXH4.1
#=GS F5C198_HBV/1-354     AC F5C198.1
#=GS I0DDE2_HBV/1-326     AC I0DDE2.1
#=GS Q20BX5_HBV/1-56      AC Q20BX5.1
#=GS F5C0W7_HBV/1-354     AC F5C0W7.1
#=GS D0E5X9_HBV/1-352     AC D0E5X9.1
#=GS G1C8E1_HBV/1-341     AC G1C8E1.1
#=GS B5M669_HBV/1-352     AC B5M669.1
#=GS D3YGD1_HBV/1-341     AC D3YGD1.1
#=GS G4XI97_HBV/27-82     AC G4XI97.1
#=GS A0MML3_HBV/1-352     AC A0MML3.1
#=GS Q20BQ7_HBV/1-56      AC Q20BQ7.1
#=GS H6WFA6_HBV/1-112     AC H6WFA6.1
#=GS A5JHQ5_HBV/1-112     AC A5JHQ5.1
#=GS B5M5L8_HBV/1-352     AC B5M5L8.1
#=GS I0DC51_HBV/1-328     AC I0DC51.1
#=GS I0C9H6_HBV/1-344     AC I0C9H6.1
#=GS Q8B5Q7_HBV/1-190     AC Q8B5Q7.1
#=GS H6V5K0_HBV/1-352     AC H6V5K0.1
#=GS F5C173_HBV/1-354     AC F5C173.1
#=GS I0DGF0_HBV/1-352     AC I0DGF0.1
#=GS D3TIJ9_HBV/1-286     AC D3TIJ9.1
#=GS D2U666_HBV/1-351     AC D2U666.1
#=GS G4XMC3_HBV/1-342     AC G4XMC3.1
#=GS F5C0K6_HBV/1-354     AC F5C0K6.1
#=GS C7DN55_HBV/1-351     AC C7DN55.1
#=GS B9VKQ3_HBV/1-352     AC B9VKQ3.1
#=GS D0E675_HBV/1-352     AC D0E675.1
#=GS G3XGW0_HBV/1-352     AC G3XGW0.1
#=GS H6WF78_HBV/1-112     AC H6WF78.1
#=GS G3E5D6_HBV/1-341     AC G3E5D6.1
#=GS F5C121_HBV/1-285     AC F5C121.1
#=GS F4ZCA7_HBV/1-35      AC F4ZCA7.1
#=GS Q2LCG4_HBV/1-341     AC Q2LCG4.1
#=GS D2JMY5_HBV/1-352     AC D2JMY5.1
#=GS Q9QAW1_HBV/1-341     AC Q9QAW1.1
#=GS B5ASR2_HBV/1-352     AC B5ASR2.1
#=GS D2JMS4_HBV/1-352     AC D2JMS4.1
#=GS A5LG82_HBV/1-337     AC A5LG82.1
#=GS B9VKD3_HBV/285-323   AC B9VKD3.1
#=GS B2CZH0_HBV/1-352     AC B2CZH0.1
#=GS D9U596_HBV/1-352     AC D9U596.1
#=GS H6UG99_HBV/1-341     AC H6UG99.1
#=GS F5C0K7_HBV/1-354     AC F5C0K7.1
#=GS Q4FDK6_HBV/1-352     AC Q4FDK6.1
#=GS A5JI08_HBV/1-112     AC A5JI08.1
#=GS D9U1K1_HBV/1-352     AC D9U1K1.1
#=GS F5C0H2_HBV/1-341     AC F5C0H2.1
#=GS I0C953_HBV/1-354     AC I0C953.1
#=GS G1E8S2_HBV/1-341     AC G1E8S2.1
#=GS E5CZ26_HBV/1-352     AC E5CZ26.1
#=GS C7DMR1_HBV/1-351     AC C7DMR1.1
#=GS Q2MLQ0_HBV/1-341     AC Q2MLQ0.1
#=GS B5TF57_HBV/1-112     AC B5TF57.1
#=GS G9G9B1_HBV/1-341     AC G9G9B1.1
#=GS Q4FDD1_HBV/1-352     AC Q4FDD1.1
#=GS C7DNH0_HBV/1-351     AC C7DNH0.1
#=GS D3YC82_HBV/1-352     AC D3YC82.1
#=GS E5RPY5_HBV/1-326     AC E5RPY5.1
#=GS D2JMU1_HBV/1-352     AC D2JMU1.1
#=GS D5LC97_HBV/1-352     AC D5LC97.1
#=GS D0E644_HBV/1-352     AC D0E644.1
#=GS I0C8M3_HBV/1-335     AC I0C8M3.1
#=GS I0DDB3_HBV/1-328     AC I0DDB3.1
#=GS I0DDD0_HBV/1-328     AC I0DDD0.1
#=GS DPOL_HBVD6/1-341     AC Q67878.1
#=GS F5C146_HBV/1-354     AC F5C146.1
#=GS Q75TM0_HBV/1-354     AC Q75TM0.1
#=GS Q6XGJ9_HBV/1-341     AC Q6XGJ9.1
#=GS B2Y6U1_HBV/1-341     AC B2Y6U1.1
#=GS B5BPY2_HBV/1-334     AC B5BPY2.1
#=GS D5LB68_HBV/1-352     AC D5LB68.1
#=GS B7TUE1_HBV/1-352     AC B7TUE1.1
#=GS F1AEV9_HBV/1-354     AC F1AEV9.1
#=GS B9VKD6_HBV/1-352     AC B9VKD6.1
#=GS E5CZ55_HBV/1-352     AC E5CZ55.1
#=GS B7TUX1_HBV/1-352     AC B7TUX1.1
#=GS G1C8B4_HBV/1-274     AC G1C8B4.1
#=GS DPOL_HBVC9/1-352     AC P0C690.1
#=GS A5JIF1_HBV/1-112     AC A5JIF1.1
#=GS I0DGB1_HBV/1-352     AC I0DGB1.1
#=GS I0C8N3_HBV/1-335     AC I0C8N3.1
#=GS Q461C0_HBV/1-351     AC Q461C0.1
#=GS E0ZRG7_HBV/1-351     AC E0ZRG7.1
#=GS D3GIK1_HBV/1-352     AC D3GIK1.1
#=GS I0DC66_HBV/1-328     AC I0DC66.1
#=GS B3V3Q1_HBV/1-291     AC B3V3Q1.1
#=GS E1U7N1_HBV/1-341     AC E1U7N1.1
#=GS B1ABL8_HBV/233-291   AC B1ABL8.1
#=GS A2T1E4_HBV/1-341     AC A2T1E4.1
#=GS E5RPY1_HBV/1-343     AC E5RPY1.1
#=GS Q20C06_HBV/1-55      AC Q20C06.1
#=GS D3K2F3_HBV/1-341     AC D3K2F3.1
#=GS E5CZ36_HBV/1-352     AC E5CZ36.1
#=GS B5BPQ3_HBV/1-341     AC B5BPQ3.1
#=GS B9VL64_HBV/1-352     AC B9VL64.1
#=GS H1ZN34_HBV/1-341     AC H1ZN34.1
#=GS A5JIJ5_HBV/1-112     AC A5JIJ5.1
#=GS A6MFY1_HBV/1-352     AC A6MFY1.1
#=GS Q06AN4_HBV/1-352     AC Q06AN4.1
#=GS D6QVD4_HBV/1-352     AC D6QVD4.1
#=GS D2U642_HBV/1-351     AC D2U642.1
#=GS I0DD56_HBV/1-328     AC I0DD56.1
#=GS F5C0M1_HBV/1-354     AC F5C0M1.1
#=GS D3Y5Q9_HBV/1-352     AC D3Y5Q9.1
#=GS F5C184_HBV/1-354     AC F5C184.1
#=GS H9XQT7_HBV/1-91      AC H9XQT7.1
#=GS I0C8K9_HBV/1-350     AC I0C8K9.1
#=GS B0YK33_HBV/1-341     AC B0YK33.1
#=GS G9G8K5_HBV/1-341     AC G9G8K5.1
#=GS I0DGI6_HBV/1-352     AC I0DGI6.1
#=GS C6F5B8_HBV/1-354     AC C6F5B8.1
#=GS Q80J74_HBV/1-284     AC Q80J74.1
#=GS B4Y7G4_HBV/1-352     AC B4Y7G4.2
#=GS A5JID5_HBV/1-112     AC A5JID5.1
#=GS I0C8E2_HBV/1-354     AC I0C8E2.1
#=GS E5CYY4_HBV/1-352     AC E5CYY4.1
#=GS Q8B5Q6_HBV/1-190     AC Q8B5Q6.1
#=GS D3XGG6_HBV/1-352     AC D3XGG6.1
#=GS B5M673_HBV/1-341     AC B5M673.1
#=GS D6QVK1_HBV/1-352     AC D6QVK1.1
#=GS A2A1E6_HBV/1-352     AC A2A1E6.1
#=GS B7TTK8_HBV/1-352     AC B7TTK8.1
#=GS B7TTP5_HBV/1-352     AC B7TTP5.1
#=GS DPOL_HBVH2/1-352     AC Q8JN08.1
#=GS B9VK27_HBV/1-352     AC B9VK27.1
#=GS Q4KRE9_HBV/1-354     AC Q4KRE9.1
#=GS D2JMR0_HBV/1-352     AC D2JMR0.1
#=GS B2WSN2_HBV/1-352     AC B2WSN2.1
#=GS B9VL44_HBV/1-352     AC B9VL44.1
#=GS Q8JXA3_HBV/125-153   AC Q8JXA3.1
#=GS G3XGX8_HBV/1-343     AC G3XGX8.1
#=GS I0C9E2_HBV/1-352     AC I0C9E2.1
#=GS G1E7F8_HBV/1-335     AC G1E7F8.1
#=GS C1K1M5_HBV/274-323   AC C1K1M5.1
#=GS G1C8W4_HBV/1-341     AC G1C8W4.1
#=GS B5ASQ0_HBV/1-352     AC B5ASQ0.1
#=GS B5M5E0_HBV/1-352     AC B5M5E0.1
#=GS B4YL17_HBV/1-341     AC B4YL17.1
#=GS I0DCM6_HBV/1-328     AC I0DCM6.1
#=GS F5C7Q3_HBV/1-352     AC F5C7Q3.1
#=GS B9VJY5_HBV/1-352     AC B9VJY5.1
#=GS I0DGJ6_HBV/1-352     AC I0DGJ6.1
#=GS G8CQJ6_HBV/1-49      AC G8CQJ6.1
#=GS Q8QQX2_9HEPA/1-361   AC Q8QQX2.1
#=GS E0ZR86_HBV/1-351     AC E0ZR86.1
#=GS E0D3B3_HBV/1-351     AC E0D3B3.1
#=GS C9WD88_HBV/1-341     AC C9WD88.1
#=GS Q9WRK8_HBV/1-354     AC Q9WRK8.1
#=GS F5C0I0_HBV/1-341     AC F5C0I0.1
#=GS D0E6I0_HBV/1-352     AC D0E6I0.1
#=GS C7DN61_HBV/1-354     AC C7DN61.1
#=GS D0UEC4_HBV/1-352     AC D0UEC4.1
#=GS E0ZRW9_HBV/1-351     AC E0ZRW9.1
#=GS E0ZRV3_HBV/1-351     AC E0ZRV3.1
#=GS F5C0Q9_HBV/1-351     AC F5C0Q9.1
#=GS G1E7E7_HBV/249-297   AC G1E7E7.1
#=GS B4Y4K2_HBV/1-352     AC B4Y4K2.1
#=GS A5JI75_HBV/1-112     AC A5JI75.1
#=GS B5M5Y8_HBV/1-352     AC B5M5Y8.1
#=GS B0I379_HBV/1-352     AC B0I379.1
#=GS Q8UYX9_HHBV/1-354    AC Q8UYX9.1
#=GS G9G9M9_HBV/1-341     AC G9G9M9.1
#=GS B5BPU6_HBV/1-352     AC B5BPU6.1
#=GS G1C939_HBV/1-341     AC G1C939.1
#=GS F4ZCA5_HBV/1-49      AC F4ZCA5.1
#=GS Q77BF9_HBV/1-167     AC Q77BF9.1
#=GS I0CF22_HBV/1-288     AC I0CF22.1
#=GS I0DCY6_HBV/1-328     AC I0DCY6.1
#=GS Q00K76_HBV/1-352     AC Q00K76.1
#=GS Q5Q0Y8_HBV/1-341     AC Q5Q0Y8.1
#=GS I0C8T6_HBV/1-341     AC I0C8T6.1
#=GS C7DMD1_HBV/1-351     AC C7DMD1.1
#=GS H9XR38_HBV/1-91      AC H9XR38.1
#=GS H9XQM5_HBV/1-91      AC H9XQM5.1
#=GS Q6X5F0_HBV/1-24      AC Q6X5F0.1
#=GS B9VKX2_HBV/1-352     AC B9VKX2.1
#=GS H1ACW4_HBV/1-352     AC H1ACW4.1
#=GS H9XQQ6_HBV/1-91      AC H9XQQ6.1
#=GS A5LG86_HBV/1-352     AC A5LG86.1
#=GS Q76B09_HBV/1-352     AC Q76B09.1
#=GS B7TTG8_HBV/1-352     AC B7TTG8.1
#=GS B5TZH6_HBV/1-52      AC B5TZH6.1
#=GS H6UGH9_HBV/1-341     AC H6UGH9.1
#=GS E5RDB7_HBV/1-341     AC E5RDB7.1
#=GS B5M5E8_HBV/1-352     AC B5M5E8.1
#=GS B7TTQ0_HBV/1-352     AC B7TTQ0.1
#=GS E0ZS14_HBV/1-354     AC E0ZS14.1
#=GS A0FDL1_HBV/1-341     AC A0FDL1.1
#=GS Q6IT65_9HEPA/1-388   AC Q6IT65.1
#=GS G3XLD2_HBV/1-352     AC G3XLD2.1
#=GS B5M641_HBV/1-352     AC B5M641.1
#=GS F5C0M2_HBV/1-348     AC F5C0M2.1
#=GS H9XR46_HBV/1-91      AC H9XR46.1
#=GS I0C9E6_HBV/1-352     AC I0C9E6.1
#=GS I0DGA0_HBV/1-352     AC I0DGA0.1
#=GS I0C8Y5_HBV/1-354     AC I0C8Y5.1
#=GS E0D2U9_HBV/1-354     AC E0D2U9.1
#=GS G4XHW9_HBV/1-160     AC G4XHW9.1
#=GS D3YGK4_HBV/1-341     AC D3YGK4.1
#=GS D2U5Z0_HBV/1-351     AC D2U5Z0.1
#=GS D6QVT6_HBV/1-352     AC D6QVT6.1
#=GS F2WS84_HBV/1-352     AC F2WS84.1
#=GS D3YGG7_HBV/1-341     AC D3YGG7.1
#=GS D3K2C5_HBV/1-352     AC D3K2C5.1
#=GS Q9QMN3_HBV/1-332     AC Q9QMN3.1
#=GS D0E5Z8_HBV/1-352     AC D0E5Z8.1
#=GS Q1XHD5_HBV/1-352     AC Q1XHD5.1
#=GS D2JMN2_HBV/1-352     AC D2JMN2.1
#=GS D9U565_HBV/1-352     AC D9U565.1
#=GS G1E7X5_HBV/1-341     AC G1E7X5.1
#=GS D3YGM8_HBV/1-341     AC D3YGM8.1
#=GS D0E6E0_HBV/1-352     AC D0E6E0.1
#=GS F4ZCC0_HBV/1-49      AC F4ZCC0.1
#=GS F5C1B2_HBV/1-354     AC F5C1B2.1
#=GS H9XQK4_HBV/1-91      AC H9XQK4.1
#=GS B0FCD6_HBV/1-352     AC B0FCD6.1
#=GS H6UGF4_HBV/1-341     AC H6UGF4.1
#=GS A7L370_HBV/1-30      AC A7L370.1
#=GS B5ATC8_HBV/272-318   AC B5ATC8.1
#=GS D5LD32_HBV/1-352     AC D5LD32.1
#=GS Q19SV4_HBV/1-341     AC Q19SV4.1
#=GS B4YKV6_HBV/1-341     AC B4YKV6.1
#=GS Q2EIG2_HBV/1-346     AC Q2EIG2.1
#=GS B5M568_HBV/1-352     AC B5M568.1
#=GS C7DNK1_HBV/1-351     AC C7DNK1.1
#=GS B5M505_HBV/1-352     AC B5M505.1
#=GS D5LDE2_HBV/1-352     AC D5LDE2.1
#=GS G3XH34_HBV/1-332     AC G3XH34.1
#=GS B1ABK3_HBV/201-516   AC B1ABK3.1
#=GS C7EA81_HBV/1-352     AC C7EA81.1
#=GS E9L2R1_HBV/1-171     AC E9L2R1.1
#=GS F4ZCA8_HBV/1-49      AC F4ZCA8.1
#=GS I0DGG4_HBV/1-171     AC I0DGG4.1
#=GS I0C992_HBV/1-341     AC I0C992.1
#=GS Q8B4C0_HBV/1-232     AC Q8B4C0.1
#=GS G1E7W3_HBV/1-341     AC G1E7W3.1
#=GS D0E617_HBV/1-352     AC D0E617.1
#=GS B7TU89_HBV/1-352     AC B7TU89.1
#=GS Q4FDB5_HBV/1-352     AC Q4FDB5.1
#=GS B0FCS1_HBV/1-352     AC B0FCS1.1
#=GS I0DCJ5_HBV/1-328     AC I0DCJ5.1
#=GS B0YGJ8_HBV/1-341     AC B0YGJ8.1
#=GS B5M5R8_HBV/1-352     AC B5M5R8.1
#=GS I0DD60_HBV/1-328     AC I0DD60.1
#=GS B5A2H1_HBV/1-352     AC B5A2H1.1
#=GS D7NKR1_HBV/1-341     AC D7NKR1.1
#=GS G9G8N2_HBV/1-341     AC G9G8N2.1
#=GS B5TFE1_HBV/1-112     AC B5TFE1.1
#=GS B2CXZ6_HBV/1-352     AC B2CXZ6.1
#=GS B2CSB3_HBV/1-352     AC B2CSB3.1
#=GS I0DCK0_HBV/1-328     AC I0DCK0.1
#=GS Q5SDK9_HBVC1/1-352   AC Q5SDK9.1
#=GS Q8B3P1_9HEPA/1-374   AC Q8B3P1.1
#=GS I0DGJ5_HBV/291-352   AC I0DGJ5.1
#=GS F5C159_HBV/1-354     AC F5C159.1
#=GS D3YGA1_HBV/1-341     AC D3YGA1.1
#=GS I0C8L3_HBV/1-350     AC I0C8L3.1
#=GS F5C0Z7_HBV/1-354     AC F5C0Z7.1
#=GS I0C9F5_HBV/1-352     AC I0C9F5.1
#=GS F5C0K9_HBV/1-348     AC F5C0K9.1
#=GS E0ZRM6_HBV/1-351     AC E0ZRM6.1
#=GS Q81099_HBV/1-352     AC Q81099.2
#=GS B5TFH3_HBV/1-112     AC B5TFH3.1
#=GS D3YGQ2_HBV/1-341     AC D3YGQ2.1
#=GS H6UGQ0_HBV/1-341     AC H6UGQ0.1
#=GS D3TJ98_HBV/1-349     AC D3TJ98.1
#=GS Q784K8_HBVF5/1-352   AC Q784K8.1
#=GS Q8UYX5_HHBV/1-354    AC Q8UYX5.1
#=GS F5C0T6_HBV/1-351     AC F5C0T6.1
#=GS C3W482_HBV/1-341     AC C3W482.1
#=GS D0UE02_HBV/1-346     AC D0UE02.1
#=GS B2LWA2_HBV/1-198     AC B2LWA2.1
#=GS Q69616_HBV/1-49      AC Q69616.1
#=GS B5M5Q8_HBV/1-352     AC B5M5Q8.1
#=GS H9XRT3_HBV/1-91      AC H9XRT3.1
#=GS F5C160_HBV/1-354     AC F5C160.1
#=GS H6UN45_HBV/1-341     AC H6UN45.1
#=GS Q8B460_HBV/25-108    AC Q8B460.1
#=GS D3TK38_HBV/1-352     AC D3TK38.1
#=GS E5RPV3_HBV/1-343     AC E5RPV3.1
#=GS B5TXS5_HBV/1-334     AC B5TXS5.1
#=GS B7TV59_HBV/1-352     AC B7TV59.1
#=GS B7TTM0_HBV/1-346     AC B7TTM0.1
#=GS D2JMW6_HBV/1-352     AC D2JMW6.1
#=GS F5C0X6_HBV/1-354     AC F5C0X6.1
#=GS D0EEK4_HBV/1-354     AC D0EEK4.1
#=GS I0DE64_HBV/1-312     AC I0DE64.1
#=GS D0EEN8_HBV/1-354     AC D0EEN8.1
#=GS I0CF25_HBV/1-253     AC I0CF25.1
#=GS A6MFY7_HBV/1-352     AC A6MFY7.1
#=GS G4XI88_HBV/1-160     AC G4XI88.1
#=GS B9VJW6_HBV/1-352     AC B9VJW6.1
#=GS B5M5A1_HBV/1-352     AC B5M5A1.1
#=GS D5LBK0_HBV/1-352     AC D5LBK0.1
#=GS Q4FDA7_HBV/1-352     AC Q4FDA7.1
#=GS H9XRY5_HBV/1-91      AC H9XRY5.1
#=GS G1C8S2_HBV/1-341     AC G1C8S2.1
#=GS I0DGC7_HBV/1-352     AC I0DGC7.1
#=GS H2ERJ2_HBV/1-352     AC H2ERJ2.1
#=GS Q3ZKR1_HBV/1-354     AC Q3ZKR1.1
#=GS D3YGE3_HBV/1-341     AC D3YGE3.1
#=GS B5M5Q1_HBV/1-352     AC B5M5Q1.1
#=GS Q9QAF3_HBV/1-341     AC Q9QAF3.1
#=GS B4YKN0_HBV/1-354     AC B4YKN0.1
#=GS I0C893_HBV/1-354     AC I0C893.1
#=GS H9XR10_HBV/1-91      AC H9XR10.1
#=GS A5JIQ0_HBV/1-112     AC A5JIQ0.1
#=GS Q910V6_HBV/1-352     AC Q910V6.1
#=GS D6QVR0_HBV/1-352     AC D6QVR0.1
#=GS I0C8B0_HBV/1-354     AC I0C8B0.1
#=GS D3YFY5_HBV/1-341     AC D3YFY5.1
#=GS Q9QRQ8_HBV/165-207   AC Q9QRQ8.1
#=GS D0E5E7_HBV/1-352     AC D0E5E7.1
#=GS C1K1J1_HBV/1-352     AC C1K1J1.1
#=GS G1E7U5_HBV/1-341     AC G1E7U5.1
#=GS B7TUM3_HBV/1-352     AC B7TUM3.1
#=GS F5C120_HBV/1-285     AC F5C120.1
#=GS D9U5B9_HBV/1-352     AC D9U5B9.1
#=GS H9XRJ6_HBV/1-91      AC H9XRJ6.1
#=GS D2X416_HBV/66-108    AC D2X416.1
#=GS B5B4Q1_HBV/1-352     AC B5B4Q1.1
#=GS Q7TDQ1_HBV/1-352     AC Q7TDQ1.1
#=GS E5F0X0_HBV/1-49      AC E5F0X0.1
#=GS H9XRK0_HBV/1-91      AC H9XRK0.1
#=GS B0YJS3_HBV/1-351     AC B0YJS3.1
#=GS C9WDI5_HBV/1-255     AC C9WDI5.1
#=GS E5RPV7_HBV/1-343     AC E5RPV7.1
#=GS Q461C8_HBV/1-351     AC Q461C8.1
#=GS Q2L4J6_HBV/1-354     AC Q2L4J6.1
#=GS C1K159_HBV/233-291   AC C1K159.1
#=GS Q805G6_HBV/1-352     AC Q805G6.1
#=GS F5C100_HBV/1-354     AC F5C100.1
#=GS G1C8Q8_HBV/1-341     AC G1C8Q8.1
#=GS B5BPI5_HBV/1-352     AC B5BPI5.1
#=GS A5JI48_HBV/1-112     AC A5JI48.1
#=GS I0DCQ0_HBV/1-328     AC I0DCQ0.1
#=GS Q769K5_HBV/1-352     AC Q769K5.1
#=GS B5TFC5_HBV/1-112     AC B5TFC5.1
#=GS D3TJ85_HBV/1-352     AC D3TJ85.1
#=GS G4XI94_HBV/30-85     AC G4XI94.1
#=GS C5WJW6_HBV/1-352     AC C5WJW6.1
#=GS C1K1T9_HBV/1-350     AC C1K1T9.1
#=GS D5LC28_HBV/1-352     AC D5LC28.1
#=GS H9XRM0_HBV/1-91      AC H9XRM0.1
#=GS I0DDT3_HBV/1-328     AC I0DDT3.1
#=GS F5C1A7_HBV/1-354     AC F5C1A7.1
#=GS H6UGR2_HBV/1-337     AC H6UGR2.1
#=GS Q80H07_HBV/1-352     AC Q80H07.1
#=GS Q19SX6_HBV/1-341     AC Q19SX6.1
#=GS I0C8X6_HBV/1-354     AC I0C8X6.1
#=GS H6UGJ1_HBV/1-341     AC H6UGJ1.1
#=GS E5F0Y4_HBV/1-48      AC E5F0Y4.1
#=GS B5M600_HBV/1-352     AC B5M600.1
#=GS B9VKK7_HBV/1-352     AC B9VKK7.1
#=GS F5C102_HBV/1-354     AC F5C102.1
#=GS Q8JXG7_HBV/1-354     AC Q8JXG7.1
#=GS D0UDQ4_HBV/1-352     AC D0UDQ4.1
#=GS Q9YKJ0_HBV/1-352     AC Q9YKJ0.1
#=GS B3VLF7_HBV/1-165     AC B3VLF7.1
#=GS Q5DW09_HBV/1-352     AC Q5DW09.1
#=GS D6R6U9_HBV/1-352     AC D6R6U9.1
#=GS C3W3Z7_HBV/1-341     AC C3W3Z7.1
#=GS Q20C10_HBV/1-55      AC Q20C10.1
#=GS B9VKR9_HBV/1-352     AC B9VKR9.1
#=GS D0UEB5_HBV/1-352     AC D0UEB5.1
#=GS I0DDC6_HBV/1-328     AC I0DDC6.1
#=GS I0DE68_HBV/1-328     AC I0DE68.1
#=GS Q598R1_HBV/1-354     AC Q598R1.1
#=GS Q8JN15_HBV/1-341     AC Q8JN15.1
#=GS Q8B5Q9_HBV/1-190     AC Q8B5Q9.1
#=GS B5M5P2_HBV/1-352     AC B5M5P2.1
#=GS F5C1L4_HBV/1-341     AC F5C1L4.1
#=GS Q17UT1_HBVAW/1-354   AC Q17UT1.1
#=GS Q769H3_HBV/1-352     AC Q769H3.1
#=GS I0DDQ2_HBV/156-198   AC I0DDQ2.1
#=GS F5C0V7_HBV/1-354     AC F5C0V7.1
#=GS D7NL08_HBV/1-341     AC D7NL08.1
#=GS C7AYK5_HBV/1-355     AC C7AYK5.1
#=GS H6V5M4_HBV/1-341     AC H6V5M4.1
#=GS Q4FD57_HBV/1-339     AC Q4FD57.1
#=GS H6V5L2_HBV/1-341     AC H6V5L2.1
#=GS Q81110_HBV/1-49      AC Q81110.1
#=GS E5CZ60_HBV/1-352     AC E5CZ60.1
#=GS Q762E4_HBV/1-352     AC Q762E4.1
#=GS H9XQF4_HBV/1-91      AC H9XQF4.1
#=GS D3YGM2_HBV/1-339     AC D3YGM2.1
#=GS F5C0L9_HBV/1-354     AC F5C0L9.1
#=GS C9WDG1_HBV/1-341     AC C9WDG1.1
#=GS G9G9F3_HBV/226-280   AC G9G9F3.1
#=GS B5TXQ0_HBV/1-350     AC B5TXQ0.1
#=GS B7SXT7_HBV/1-334     AC B7SXT7.1
#=GS G9BNJ4_HBV/1-354     AC G9BNJ4.1
#=GS Q80GY2_HBV/1-352     AC Q80GY2.1
#=GS Q67919_HBV/1-341     AC Q67919.1
#=GS H1ACX2_HBV/1-352     AC H1ACX2.1
#=GS D0EE47_HBV/1-354     AC D0EE47.1
#=GS B5TFG9_HBV/1-112     AC B5TFG9.1
#=GS E0ZRP7_HBV/1-351     AC E0ZRP7.1
#=GS DPOL_HBVB2/1-352     AC P17393.1
#=GS G4XHX7_HBV/1-159     AC G4XHX7.1
#=GS B9VAY5_HBV/262-325   AC B9VAY5.1
#=GS D3YGR4_HBV/1-341     AC D3YGR4.1
#=GS F5C111_HBV/1-352     AC F5C111.1
#=GS B1GS21_HBV/1-354     AC B1GS21.1
#=GS B7TTY8_HBV/1-349     AC B7TTY8.1
#=GS G4XMD9_HBV/1-341     AC G4XMD9.1
#=GS D0E637_HBV/1-352     AC D0E637.1
#=GS B5B496_HBV/234-309   AC B5B496.1
#=GS D3TJZ0_HBV/1-352     AC D3TJZ0.1
#=GS G1C919_HBV/1-341     AC G1C919.1
#=GS Q81169_HBV/1-341     AC Q81169.1
#=GS Q20BY1_HBV/1-57      AC Q20BY1.1
#=GS C1K1M5_HBV/1-278     AC C1K1M5.1
#=GS I0DGE8_HBV/1-352     AC I0DGE8.1
#=GS B2LRW9_HBV/1-352     AC B2LRW9.1
#=GS DPOL_HBVF6/1-352     AC Q69605.1
#=GS A6MGA8_HBV/1-352     AC A6MGA8.1
#=GS DPOL_WHV1/1-388      AC P03160.1
#=GS Q8B4E6_HBV/1-353     AC Q8B4E6.1
#=GS F5C192_HBV/1-354     AC F5C192.1
#=GS F5C0H0_HBV/1-341     AC F5C0H0.1
#=GS I0DGE7_HBV/1-352     AC I0DGE7.1
#=GS B5M5J4_HBV/1-347     AC B5M5J4.1
#=GS B3VLJ3_HBV/1-176     AC B3VLJ3.1
#=GS A5JIE7_HBV/1-102     AC A5JIE7.1
#=GS D5LCE2_HBV/1-352     AC D5LCE2.1
#=GS A7YEU7_HBV/1-352     AC A7YEU7.1
#=GS D3TKD0_HBV/1-352     AC D3TKD0.1
#=GS H9N879_HBV/1-341     AC H9N879.1
#=GS D0E666_HBV/1-352     AC D0E666.1
#=GS E5RD85_HBV/1-352     AC E5RD85.1
#=GS I0C9H4_HBV/1-352     AC I0C9H4.1
#=GS I0C8R8_HBV/1-231     AC I0C8R8.1
#=GS C7DY71_HBV/1-347     AC C7DY71.1
#=GS Q20BP7_HBV/1-57      AC Q20BP7.1
#=GS B0FCS8_HBV/1-352     AC B0FCS8.1
#=GS B5B4F0_HBV/1-352     AC B5B4F0.1
#=GS F5C0V0_HBV/1-354     AC F5C0V0.1
#=GS G4XI21_HBV/1-160     AC G4XI21.1
#=GS B5TXT1_HBV/1-343     AC B5TXT1.1
#=GS G0YVN5_HBV/1-341     AC G0YVN5.1
#=GS D2X599_HBV/3-171     AC D2X599.1
#=GS B5B4H6_HBV/1-242     AC B5B4H6.1
#=GS Q9IXB1_HBV/1-52      AC Q9IXB1.1
#=GS B7TU57_HBV/1-352     AC B7TU57.1
#=GS H6UGS2_HBV/1-306     AC H6UGS2.1
#=GS I0DGE6_HBV/1-352     AC I0DGE6.1
#=GS A8R7F2_HBV/1-352     AC A8R7F2.1
#=GS I0C8I2_HBV/1-335     AC I0C8I2.1
#=GS D8KY05_HBV/1-352     AC D8KY05.1
#=GS Q1PCY4_HBV/1-352     AC Q1PCY4.1
#=GS O91582_HBV/273-320   AC O91582.1
#=GS B9VAZ4_HBV/1-352     AC B9VAZ4.1
#=GS I0C903_HBV/1-354     AC I0C903.1
#=GS I0C9F8_HBV/1-352     AC I0C9F8.1
#=GS E3Q0M1_HBV/1-352     AC E3Q0M1.1
#=GS H6UN72_HBV/1-341     AC H6UN72.1
#=GS I0DCN0_HBV/1-327     AC I0DCN0.1
#=GS B5M546_HBV/1-352     AC B5M546.1
#=GS C9WDA7_HBV/1-341     AC C9WDA7.1
#=GS Q20BP3_HBV/1-57      AC Q20BP3.1
#=GS Q9WP59_HBV/1-276     AC Q9WP59.1
#=GS H1ACW8_HBV/1-352     AC H1ACW8.1
#=GS Q20C14_HBV/1-56      AC Q20C14.1
#=GS Q8B4F8_HBV/261-304   AC Q8B4F8.1
#=GS C7AY29_HBV/1-190     AC C7AY29.1
#=GS D8KY09_HBV/1-352     AC D8KY09.1
#=GS DPOL_HBVE1/1-351     AC Q69602.1
#=GS A5JJ23_HBV/1-180     AC A5JJ23.1
#=GS G9HVZ5_HBV/1-352     AC G9HVZ5.1
#=GS G4XME7_HBV/1-341     AC G4XME7.1
#=GS F5C0M8_HBV/1-348     AC F5C0M8.1
#=GS B4YL77_HBV/1-341     AC B4YL77.1
#=GS Q4R1R6_HBV/1-38      AC Q4R1R6.1
#=GS G1E8K6_HBV/1-341     AC G1E8K6.1
#=GS C5WJX8_HBV/1-352     AC C5WJX8.1
#=GS A5JIP6_HBV/1-112     AC A5JIP6.1
#=GS E5F0W5_HBV/1-49      AC E5F0W5.1
#=GS G3XLB8_HBV/1-352     AC G3XLB8.1
#=GS I0DGK7_HBV/1-174     AC I0DGK7.1
#=GS D5LF71_HBV/1-352     AC D5LF71.1
#=GS G9G8S4_HBV/1-341     AC G9G8S4.1
#=GS Q80J83_HBV/1-352     AC Q80J83.1
#=GS G1E8F9_HBV/1-341     AC G1E8F9.1
#=GS D3YG45_HBV/1-341     AC D3YG45.1
#=GS D0E6I8_HBV/1-352     AC D0E6I8.1
#=GS Q9QAF7_HBV/1-341     AC Q9QAF7.1
#=GS B9VK47_HBV/1-352     AC B9VK47.1
#=GS B7TUT1_HBV/1-352     AC B7TUT1.1
#=GS G9G8T6_HBV/1-341     AC G9G8T6.1
#=GS H6UG47_HBV/1-341     AC H6UG47.1
#=GS DPOL_HBVA5/1-354     AC Q02314.2
#=GS A5JHU4_HBV/1-112     AC A5JHU4.1
#=GS Q20BV9_HBV/1-57      AC Q20BV9.1
#=GS G4XI41_HBV/1-160     AC G4XI41.1
#=GS E5RPK3_HBV/1-352     AC E5RPK3.1
#=GS C7DNJ5_HBV/1-351     AC C7DNJ5.1
#=GS B5AT85_HBV/1-352     AC B5AT85.1
#=GS Q20BQ3_HBV/1-57      AC Q20BQ3.1
#=GS D5LFM1_HBV/1-352     AC D5LFM1.1
#=GS H9XQG6_HBV/1-91      AC H9XQG6.1
#=GS B8PTD8_HBV/1-341     AC B8PTD8.1
#=GS Q2LCC8_HBV/1-333     AC Q2LCC8.1
#=GS H2ER90_HBV/1-352     AC H2ER90.1
#=GS I0C876_HBV/1-354     AC I0C876.1
#=GS G4XI05_HBV/1-160     AC G4XI05.1
#=GS H9XQE2_HBV/1-91      AC H9XQE2.1
#=GS Q8JXI0_HBV/1-351     AC Q8JXI0.1
#=GS A6MG96_HBV/1-352     AC A6MG96.1
#=GS F4ZCA2_HBV/1-49      AC F4ZCA2.1
#=GS Q9DLM4_HBV/1-341     AC Q9DLM4.1
#=GS B3V8V6_HBV/1-341     AC B3V8V6.1
#=GS F5C0N9_HBV/1-354     AC F5C0N9.1
#=GS I0C974_HBV/1-351     AC I0C974.1
#=GS B7TUQ0_HBV/1-352     AC B7TUQ0.1
#=GS G9BNK2_HBV/1-294     AC G9BNK2.1
#=GS I0DGJ2_HBV/1-352     AC I0DGJ2.1
#=GS H9XRC2_HBV/1-91      AC H9XRC2.1
#=GS I0DGD8_HBV/1-352     AC I0DGD8.1
#=GS B5BPS7_HBV/1-352     AC B5BPS7.1
#=GS A5LG78_HBV/1-346     AC A5LG78.1
#=GS Q91EH3_HBV/1-354     AC Q91EH3.1
#=GS I0DCD6_HBV/1-328     AC I0DCD6.1
#=GS B5M5T6_HBV/1-352     AC B5M5T6.1
#=GS A6MG68_HBV/1-352     AC A6MG68.1
#=GS H6WFM5_HBV/1-112     AC H6WFM5.1
#=GS D5LDA7_HBV/1-352     AC D5LDA7.1
#=GS F5C0T2_HBV/1-351     AC F5C0T2.1
#=GS B7TTR2_HBV/1-352     AC B7TTR2.1
#=GS D2JMJ2_HBV/1-336     AC D2JMJ2.1
#=GS Q5U7P8_HBV/1-341     AC Q5U7P8.1
#=GS B3VLG3_HBV/1-176     AC B3VLG3.1
#=GS O91574_HBV/1-339     AC O91574.1
#=GS I0DCH5_HBV/1-328     AC I0DCH5.1
#=GS I0C8U4_HBV/1-354     AC I0C8U4.1
#=GS H6UGJ7_HBV/1-341     AC H6UGJ7.1
#=GS G8CQJ7_HBV/1-49      AC G8CQJ7.1
#=GS H9XR82_HBV/1-91      AC H9XR82.1
#=GS G0YVL9_HBV/1-341     AC G0YVL9.1
#=GS D5LEL0_HBV/1-352     AC D5LEL0.1
#=GS DPOL_HBVGO/1-341     AC Q9YPV8.1
#=GS F5C0R2_HBV/1-351     AC F5C0R2.1
#=GS Q5SDL6_HBV/1-352     AC Q5SDL6.1
#=GS B5TXZ5_HBV/1-352     AC B5TXZ5.1
#=GS D2K7P1_HBV/1-81      AC D2K7P1.1
#=GS D3TJZ7_HBV/237-280   AC D3TJZ7.1
#=GS Q80GV2_HBV/1-352     AC Q80GV2.1
#=GS E5F0Y1_HBV/1-49      AC E5F0Y1.1
#=GS Q5R2L9_HBV/1-352     AC Q5R2L9.1
#=GS G4XMH9_HBV/1-352     AC G4XMH9.1
#=GS Q4KRC1_HBV/1-354     AC Q4KRC1.1
#=GS B0YK46_HBV/1-352     AC B0YK46.1
#=GS D2JMR9_HBV/1-352     AC D2JMR9.1
#=GS B5TF89_HBV/1-112     AC B5TF89.1
#=GS O09509_HBV/1-352     AC O09509.1
#=GS Q80J89_HBV/1-352     AC Q80J89.1
#=GS B4YLG8_HBV/1-341     AC B4YLG8.1
#=GS I0DGC0_HBV/1-352     AC I0DGC0.1
#=GS H9XRX3_HBV/1-91      AC H9XRX3.1
#=GS I0DDB7_HBV/1-328     AC I0DDB7.1
#=GS C7DMY5_HBV/1-351     AC C7DMY5.1
#=GS O91562_HBV/1-352     AC O91562.2
#=GS F5C068_HBV/1-352     AC F5C068.1
#=GS D0E641_HBV/1-352     AC D0E641.1
#=GS B4Y4K7_HBV/1-352     AC B4Y4K7.1
#=GS F5C0Z3_HBV/1-354     AC F5C0Z3.1
#=GS B9VKN6_HBV/1-352     AC B9VKN6.1
#=GS I0C8U3_HBV/1-354     AC I0C8U3.1
#=GS B5TF65_HBV/1-112     AC B5TF65.1
#=GS I0C8N7_HBV/1-341     AC I0C8N7.1
#=GS B9VK43_HBV/1-352     AC B9VK43.1
#=GS D5LEG1_HBV/1-352     AC D5LEG1.1
#=GS C9WDP1_HBV/1-341     AC C9WDP1.1
#=GS G9G8Y4_HBV/1-341     AC G9G8Y4.1
#=GS I0DDW2_HBV/1-328     AC I0DDW2.1
#=GS Q2LCC4_HBV/1-341     AC Q2LCC4.1
#=GS D6QVL5_HBV/1-352     AC D6QVL5.1
#=GS H9XQX2_HBV/1-91      AC H9XQX2.1
#=GS F5C0Z1_HBV/1-354     AC F5C0Z1.1
#=GS H9XRN2_HBV/1-91      AC H9XRN2.1
#=GS B4YKK9_HBV/1-354     AC B4YKK9.1
#=GS C7DSL0_HBV/1-341     AC C7DSL0.1
#=GS F5C0Y1_HBV/1-354     AC F5C0Y1.1
#=GS D2X3T8_HBV/10-171    AC D2X3T8.1
#=GS D5MSI7_HBV/1-343     AC D5MSI7.1
#=GS B5M5F9_HBV/1-352     AC B5M5F9.1
#=GS Q8V1I3_HBV/1-345     AC Q8V1I3.1
#=GS B5M5V8_HBV/1-247     AC B5M5V8.1
#=GS D4QGI7_HBV/1-341     AC D4QGI7.1
#=GS D5MSF5_HBV/1-352     AC D5MSF5.1
#=GS G9G977_HBV/1-341     AC G9G977.1
#=GS B9VAY5_HBV/1-260     AC B9VAY5.1
#=GS F5C185_HBV/1-354     AC F5C185.1
#=GS H9XRW1_HBV/1-91      AC H9XRW1.1
#=GS B9W407_HBV/1-354     AC B9W407.1
#=GS A5JIF5_HBV/1-112     AC A5JIF5.1
#=GS Q80H26_HBV/1-337     AC Q80H26.1
#=GS G3XH18_HBV/1-332     AC G3XH18.1
#=GS Q67835_HBV/1-81      AC Q67835.1
#=GS E5CYW7_HBV/1-352     AC E5CYW7.1
#=GS C7AYM5_HBV/1-354     AC C7AYM5.1
#=GS Q80H48_HBV/1-352     AC Q80H48.1
#=GS B7TU18_HBV/1-352     AC B7TU18.1
#=GS Q9DUH5_HBV/1-341     AC Q9DUH5.1
#=GS Q19SZ8_HBV/1-340     AC Q19SZ8.1
#=GS B5TXL8_HBV/1-352     AC B5TXL8.1
#=GS A5JIF9_HBV/1-112     AC A5JIF9.1
#=GS Q58VZ4_HBV/1-352     AC Q58VZ4.1
#=GS D0EDY1_HBV/1-354     AC D0EDY1.1
#=GS D0EE67_HBV/1-354     AC D0EE67.1
#=GS A5GZM2_HBV/1-352     AC A5GZM2.1
#=GS B2Y6V5_HBV/1-341     AC B2Y6V5.1
#=GS C7DMN2_HBV/1-351     AC C7DMN2.1
#=GS B2LWD0_HBV/284-317   AC B2LWD0.1
#=GS I0DC82_HBV/1-328     AC I0DC82.1
#=GS I0DGA6_HBV/1-352     AC I0DGA6.1
#=GS B8PTD1_HBV/1-341     AC B8PTD1.1
#=GS Q2L4P3_HBV/1-341     AC Q2L4P3.1
#=GS Q9YIV1_HBV/1-167     AC Q9YIV1.1
#=GS I0DGH1_HBV/1-352     AC I0DGH1.1
#=GS C7AYL9_HBV/1-354     AC C7AYL9.1
#=GS A5JHQ8_HBV/1-112     AC A5JHQ8.1
#=GS E0ZRA7_HBV/1-351     AC E0ZRA7.1
#=GS Q9QAD4_HBV/1-352     AC Q9QAD4.1
#=GS Q9IXC6_HBV/1-52      AC Q9IXC6.1
#=GS I0DCV1_HBV/1-328     AC I0DCV1.1
#=GS E0ZRC7_HBV/1-351     AC E0ZRC7.1
#=GS C3W476_HBV/1-341     AC C3W476.1
#=GS H9XRR8_HBV/1-91      AC H9XRR8.1
#=GS D0E5F1_HBV/1-346     AC D0E5F1.1
#=GS D0EEH1_HBV/1-354     AC D0EEH1.1
#=GS B5M663_HBV/1-352     AC B5M663.1
#=GS A7L368_HBV/1-30      AC A7L368.1
#=GS A5LG30_HBV/1-352     AC A5LG30.1
#=GS E5F0X6_HBV/1-49      AC E5F0X6.1
#=GS B5M5K8_HBV/1-352     AC B5M5K8.1
#=GS B9VKM3_HBV/1-352     AC B9VKM3.1
#=GS C9WDR0_HBV/1-352     AC C9WDR0.1
#=GS I0C8R2_HBV/1-231     AC I0C8R2.1
#=GS D0E659_HBV/1-352     AC D0E659.1
#=GS I0DE08_HBV/1-328     AC I0DE08.1
#=GS Q20BS3_HBV/1-57      AC Q20BS3.1
#=GS B8PTF2_HBV/1-341     AC B8PTF2.1
#=GS I0C873_HBV/1-354     AC I0C873.1
#=GS Q5KR19_HBV/1-352     AC Q5KR19.1
#=GS C3W3U8_HBV/1-341     AC C3W3U8.1
#=GS A5JI95_HBV/1-112     AC A5JI95.1
#=GS B4YL96_HBV/1-341     AC B4YL96.1
#=GS F5C0Y4_HBV/1-354     AC F5C0Y4.1
#=GS E5RDA9_HBV/1-341     AC E5RDA9.1
#=GS E5RD65_HBV/1-352     AC E5RD65.1
#=GS I0C9H9_HBV/250-315   AC I0C9H9.1
#=GS G3XGZ2_HBV/1-343     AC G3XGZ2.1
#=GS H9XQL7_HBV/1-91      AC H9XQL7.1
#=GS G4XI47_HBV/1-160     AC G4XI47.1
#=GS I0C8Q0_HBV/226-280   AC I0C8Q0.1
#=GS F5C0W2_HBV/1-354     AC F5C0W2.1
#=GS E0ZRK2_HBV/1-351     AC E0ZRK2.1
#=GS B5M5V8_HBV/243-310   AC B5M5V8.1
#=GS D5LDM2_HBV/1-352     AC D5LDM2.1
#=GS I0DCI3_HBV/1-330     AC I0DCI3.1
#=GS B5M5N9_HBV/1-352     AC B5M5N9.1
#=GS B0FD79_HBV/1-346     AC B0FD79.1
#=GS D6QVQ3_HBV/1-352     AC D6QVQ3.1
#=GS B9VJZ7_HBV/1-352     AC B9VJZ7.1
#=GS I0DGA3_HBV/1-352     AC I0DGA3.1
#=GS D0UE99_HBV/1-352     AC D0UE99.1
#=GS A5GZN4_HBV/1-352     AC A5GZN4.1
#=GS D5LEQ2_HBV/1-352     AC D5LEQ2.1
#=GS F5C0H9_HBV/1-341     AC F5C0H9.1
#=GS B7TTA3_HBV/1-352     AC B7TTA3.1
#=GS G1E7P6_HBV/1-341     AC G1E7P6.1
#=GS H3K3H2_HBV/1-354     AC H3K3H2.1
#=GS F5C0J5_HBV/1-341     AC F5C0J5.1
#=GS F5C153_HBV/1-354     AC F5C153.1
#=GS C7DML9_HBV/1-351     AC C7DML9.1
#=GS G1C8X8_HBV/1-341     AC G1C8X8.1
#=GS Q5DW20_HBV/1-354     AC Q5DW20.1
#=GS D0E5T7_HBV/1-352     AC D0E5T7.1
#=GS G9G8X0_HBV/1-326     AC G9G8X0.1
#=GS B9VK90_HBV/1-352     AC B9VK90.1
#=GS B5ASN8_HBV/1-352     AC B5ASN8.1
#=GS D5MSF9_HBV/1-352     AC D5MSF9.1
#=GS C7DSJ9_HBV/1-341     AC C7DSJ9.1
#=GS G8CQJ5_HBV/1-49      AC G8CQJ5.1
#=GS G3XGX6_HBV/1-343     AC G3XGX6.1
#=GS I0DCR6_HBV/1-317     AC I0DCR6.1
#=GS D7NL48_HBV/1-341     AC D7NL48.1
#=GS G3EQX2_HBV/1-48      AC G3EQX2.1
#=GS E5F0W6_HBV/1-41      AC E5F0W6.1
#=GS D6QVV0_HBV/1-352     AC D6QVV0.1
#=GS I0DGE2_HBV/1-352     AC I0DGE2.1
#=GS H9XRQ6_HBV/1-91      AC H9XRQ6.1
#=GS G1C8N8_HBV/1-341     AC G1C8N8.1
#=GS D0UDZ2_HBV/1-352     AC D0UDZ2.1
#=GS E5F0X4_HBV/1-49      AC E5F0X4.1
#=GS G4XML5_HBV/1-352     AC G4XML5.1
#=GS C1K1I4_HBV/1-352     AC C1K1I4.1
#=GS G3XGT2_HBV/1-342     AC G3XGT2.1
#=GS D5LCR8_HBV/1-352     AC D5LCR8.1
#=GS F5C0V1_HBV/1-354     AC F5C0V1.1
#=GS H6V5S2_HBV/1-352     AC H6V5S2.1
#=GS O91578_HBV/1-352     AC O91578.1
#=GS D5LDG3_HBV/1-352     AC D5LDG3.1
#=GS D5LD79_HBV/1-352     AC D5LD79.1
#=GS H9XRU9_HBV/1-91      AC H9XRU9.1
#=GS F5C1T5_HBV/1-347     AC F5C1T5.1
#=GS I0C8K0_HBV/1-350     AC I0C8K0.1
#=GS C1K1E6_HBV/1-351     AC C1K1E6.1
#=GS D5LBB0_HBV/1-352     AC D5LBB0.1
#=GS Q9QMJ3_HBV/1-352     AC Q9QMJ3.1
#=GS D3YG77_HBV/1-341     AC D3YG77.1
#=GS D0E652_HBV/1-352     AC D0E652.1
#=GS F5C1F9_HBV/1-341     AC F5C1F9.1
#=GS B9VKS3_HBV/1-352     AC B9VKS3.1
#=GS E5F0W9_HBV/1-26      AC E5F0W9.1
#=GS D3YGP6_HBV/1-341     AC D3YGP6.1
#=GS G1C8P4_HBV/1-324     AC G1C8P4.1
#=GS B2Y6W7_HBV/1-341     AC B2Y6W7.1
#=GS F5C133_HBV/1-354     AC F5C133.1
#=GS DPOL_HBVD7/1-341     AC O56655.1
#=GS O72031_HBV/1-171     AC O72031.1
#=GS A6MG80_HBV/1-352     AC A6MG80.1
#=GS Q2L4M8_HBV/1-341     AC Q2L4M8.1
#=GS G1E8D3_HBV/1-341     AC G1E8D3.1
#=GS B7TU14_HBV/1-352     AC B7TU14.1
#=GS B9VKA2_HBV/1-352     AC B9VKA2.1
#=GS Q9QBF6_HBV/1-352     AC Q9QBF6.1
#=GS E5CYZ3_HBV/1-352     AC E5CYZ3.1
#=GS B0YK52_HBV/1-352     AC B0YK52.1
#=GS Q91IN8_HBV/1-208     AC Q91IN8.1
#=GS C3W3P5_HBV/1-341     AC C3W3P5.1
#=GS D0E5Z1_HBV/1-352     AC D0E5Z1.1
#=GS E5F0X9_HBV/1-49      AC E5F0X9.1
#=GS C7AY96_HBV/1-354     AC C7AY96.1
#=GS B1ABQ3_HBV/1-352     AC B1ABQ3.1
#=GS C9WDN4_HBV/1-341     AC C9WDN4.1
#=GS D3GIL7_HBV/1-336     AC D3GIL7.1
#=GS H9XQW0_HBV/1-91      AC H9XQW0.1
#=GS Q00K72_HBV/1-352     AC Q00K72.1
#=GS A8D6R3_HBV/1-352     AC A8D6R3.1
#=GS Q20BV3_HBV/1-57      AC Q20BV3.1
#=GS B0FC38_HBV/1-352     AC B0FC38.1
#=GS D9U5P0_HBV/283-316   AC D9U5P0.1
#=GS D2JMJ6_HBV/1-352     AC D2JMJ6.1
#=GS B3VLL7_HBV/1-176     AC B3VLL7.1
#=GS B5M5V2_HBV/1-281     AC B5M5V2.1
#=GS Q20BR5_HBV/1-56      AC Q20BR5.1
#=GS B0FCH9_HBV/1-352     AC B0FCH9.1
#=GS F5C0L6_HBV/1-354     AC F5C0L6.1
#=GS Q4W6E8_HBV/1-351     AC Q4W6E8.1
#=GS B9VK08_HBV/1-352     AC B9VK08.1
#=GS H9XRR4_HBV/1-91      AC H9XRR4.1
#=GS Q1T7D1_HBV/1-341     AC Q1T7D1.1
#=GS D9U5P0_HBV/1-285     AC D9U5P0.1
#=GS F1CFC3_HBV/1-341     AC F1CFC3.1
#=GS DPOL_HBVE3/1-351     AC Q9QAW8.1
#=GS D3TKA3_HBV/1-352     AC D3TKA3.1
#=GS Q2EIF9_HBV/1-346     AC Q2EIF9.1
#=GS B5M5D0_HBV/1-352     AC B5M5D0.1
#=GS Q8B459_HBV/25-108    AC Q8B459.1
#=GS B0FD90_HBV/1-352     AC B0FD90.1
#=GS B9VL25_HBV/1-352     AC B9VL25.1
#=GS A0FDL8_HBV/1-333     AC A0FDL8.1
#=GS A4F517_HBV/234-311   AC A4F517.1
#=GS F5C0S6_HBV/1-333     AC F5C0S6.1
#=GS G4XIB5_HBV/1-130     AC G4XIB5.1
#=GS B5BPV8_HBV/1-352     AC B5BPV8.1
#=GS A5JIE3_HBV/1-112     AC A5JIE3.1
#=GS F5C0T9_HBV/1-351     AC F5C0T9.1
#=GS I0C8V8_HBV/1-354     AC I0C8V8.1
#=GS B7TUF5_HBV/1-340     AC B7TUF5.1
#=GS G4XI77_HBV/1-160     AC G4XI77.1
#=GS I0DGG6_HBV/1-160     AC I0DGG6.1
#=GS B5ATB9_HBV/1-276     AC B5ATB9.1
#=GS H9BDZ7_HBV/1-351     AC H9BDZ7.1
#=GS F5C062_HBV/1-352     AC F5C062.1
#=GS B5M522_HBV/1-352     AC B5M522.1
#=GS Q8JLX3_HBV/1-354     AC Q8JLX3.1
#=GS I0DCW7_HBV/1-328     AC I0DCW7.1
#=GS D6QVS9_HBV/1-352     AC D6QVS9.1
#=GS F5C0W0_HBV/1-354     AC F5C0W0.1
#=GS E0ZRU7_HBV/1-351     AC E0ZRU7.1
#=GS Q1XHE6_HBV/1-341     AC Q1XHE6.1
#=GS I0C918_HBV/1-354     AC I0C918.1
#=GS G9G905_HBV/1-341     AC G9G905.1
#=GS Q80MQ8_HBV/1-352     AC Q80MQ8.1
#=GS D2U630_HBV/1-351     AC D2U630.1
#=GS D0E6J6_HBV/1-352     AC D0E6J6.1
#=GS F5C1A9_HBV/1-354     AC F5C1A9.1
#=GS F5C1B0_HBV/1-354     AC F5C1B0.1
#=GS Q9IXA2_HBV/1-52      AC Q9IXA2.1
#=GS I0DE96_HBV/1-328     AC I0DE96.1
#=GS B5TF06_HBV/1-112     AC B5TF06.1
#=GS D0E5V6_HBV/1-352     AC D0E5V6.1
#=GS I0C8H5_HBV/1-354     AC I0C8H5.1
#=GS D0ESR5_HBV/1-352     AC D0ESR5.1
#=GS G9G8R7_HBV/1-341     AC G9G8R7.1
#=GS D5LCS2_HBV/1-352     AC D5LCS2.1
#=GS D5MSH7_HBV/1-343     AC D5MSH7.1
#=GS Q76B05_HBV/1-352     AC Q76B05.1
#=GS E5CYZ7_HBV/1-352     AC E5CYZ7.1
#=GS G1C973_HBV/1-341     AC G1C973.1
#=GS B4YT95_HBV/1-352     AC B4YT95.1
#=GS I0C924_HBV/1-354     AC I0C924.1
#=GS Q1RN63_HBV/1-352     AC Q1RN63.1
#=GS F5C156_HBV/1-354     AC F5C156.1
#=GS D2U626_HBV/1-351     AC D2U626.1
#=GS B5M534_HBV/1-352     AC B5M534.1
#=GS H9XRG2_HBV/1-91      AC H9XRG2.1
#=GS B5M4Y1_HBV/1-334     AC B5M4Y1.1
#=GS B5TF69_HBV/1-112     AC B5TF69.1
#=GS C1K227_HBV/1-289     AC C1K227.1
#=GS D3GE28_HBV/1-352     AC D3GE28.1
#=GS I0DDR1_HBV/1-251     AC I0DDR1.1
#=GS E9L2K4_HBV/1-171     AC E9L2K4.1
#=GS G4XHY4_HBV/1-160     AC G4XHY4.1
#=GS B2WSP5_HBV/1-352     AC B2WSP5.1
#=GS B7TV47_HBV/1-352     AC B7TV47.1
#=GS B5BPN3_HBV/1-341     AC B5BPN3.1
#=GS A6YK00_HBV/136-218   AC A6YK00.1
#=GS O91565_HBV/1-352     AC O91565.1
#=GS I0C8X3_HBV/1-354     AC I0C8X3.1
#=GS E0ZRL3_HBV/1-351     AC E0ZRL3.1
#=GS F5C143_HBV/1-354     AC F5C143.1
#=GS D6QW18_HBV/1-352     AC D6QW18.1
#=GS E3Q0E8_HBV/1-352     AC E3Q0E8.1
#=GS E0ZRP0_HBV/1-351     AC E0ZRP0.1
#=GS I0DGB8_HBV/1-352     AC I0DGB8.1
#=GS D0E6F6_HBV/1-352     AC D0E6F6.1
#=GS B0FD67_HBV/1-346     AC B0FD67.1
#=GS D3GIK5_HBV/1-352     AC D3GIK5.1
#=GS E5RD45_HBV/1-352     AC E5RD45.1
#=GS I0DGE9_HBV/1-342     AC I0DGE9.1
#=GS DPOL_HBVC8/1-347     AC Q81165.1
#=GS G4XIB2_HBV/1-130     AC G4XIB2.1
#=GS D5LBM0_HBV/1-352     AC D5LBM0.1
#=GS D9U1R4_HBV/1-352     AC D9U1R4.1
#=GS B2WSS3_HBV/1-352     AC B2WSS3.1
#=GS E5RPR1_HBV/1-332     AC E5RPR1.1
#=GS D0E5U1_HBV/1-352     AC D0E5U1.1
#=GS B7TTH5_HBV/1-352     AC B7TTH5.1
#=GS D0E633_HBV/1-352     AC D0E633.1
#=GS D3YGQ8_HBV/1-341     AC D3YGQ8.1
#=GS D0E6D6_HBV/1-352     AC D0E6D6.1
#=GS D7NKV9_HBV/1-341     AC D7NKV9.1
#=GS H6UN76_HBV/1-341     AC H6UN76.1
#=GS G1E7V7_HBV/1-266     AC G1E7V7.1
#=GS D2U646_HBV/1-351     AC D2U646.1
#=GS Q5U7R5_HBV/1-341     AC Q5U7R5.1
#=GS D5LE55_HBV/1-352     AC D5LE55.1
#=GS G4XHX1_HBV/1-160     AC G4XHX1.1
#=GS Q2V2L2_HBV/1-352     AC Q2V2L2.1
#=GS B2CY09_HBV/1-352     AC B2CY09.1
#=GS I0C885_HBV/1-354     AC I0C885.1
#=GS Q8AYU1_HBV/1-341     AC Q8AYU1.1
#=GS D0E5K3_HBV/1-352     AC D0E5K3.1
#=GS H2ERJ8_HBV/1-352     AC H2ERJ8.1
#=GS A5JID9_HBV/1-106     AC A5JID9.1
#=GS DPOL_HPBDW/1-367     AC P17193.1
#=GS I0C9D3_HBV/1-334     AC I0C9D3.1
#=GS B5B4G4_HBV/1-352     AC B5B4G4.1
#=GS B2WSQ2_HBV/1-352     AC B2WSQ2.1
#=GS Q9YQ43_HBV/1-167     AC Q9YQ43.1
#=GS Q9YKI7_HBV/1-352     AC Q9YKI7.1
#=GS H6W4F2_HBV/2-148     AC H6W4F2.1
#=GS B7TTE7_HBV/1-352     AC B7TTE7.1
#=GS I0C8N9_HBV/1-341     AC I0C8N9.1
#=GS B7TTR9_HBV/1-352     AC B7TTR9.1
#=GS A4F242_HBV/1-352     AC A4F242.1
#=GS I0DGJ8_HBV/1-352     AC I0DGJ8.1
#=GS B5M591_HBV/1-346     AC B5M591.1
#=GS D2U654_HBV/1-351     AC D2U654.1
#=GS I0C968_HBV/1-351     AC I0C968.1
#=GS Q4FDM6_HBV/1-352     AC Q4FDM6.1
#=GS E3Q0K1_HBV/1-352     AC E3Q0K1.1
#=GS Q70B61_HBV/1-109     AC Q70B61.1
#=GS I0DDI1_HBV/1-317     AC I0DDI1.1
#=GS B5M5H4_HBV/1-352     AC B5M5H4.1
#=GS G9G931_HBV/1-341     AC G9G931.1
#=GS G0YVN9_HBV/1-341     AC G0YVN9.1
#=GS DPOL_HBVA7/1-354     AC O91533.1
#=GS F5C0J7_HBV/1-354     AC F5C0J7.1
#=GS F5C113_HBV/1-285     AC F5C113.1
#=GS Q2L4N8_HBV/1-341     AC Q2L4N8.1
#=GS C1K1D1_HBV/1-179     AC C1K1D1.1
#=GS A8J4E6_HBV/1-352     AC A8J4E6.1
#=GS A7L374_HBV/1-30      AC A7L374.1
#=GS A8IEU6_HBV/1-52      AC A8IEU6.1
#=GS H6UNE0_HBV/1-338     AC H6UNE0.1
#=GS Q8B4C2_HBV/228-322   AC Q8B4C2.1
#=GS F5C108_HBV/1-354     AC F5C108.1
#=GS Q20BY9_HBV/1-57      AC Q20BY9.1
#=GS Q004A1_HBV/1-352     AC Q004A1.1
#=GS D3TJD5_HBV/1-218     AC D3TJD5.1
#=GS H9XR66_HBV/1-91      AC H9XR66.1
#=GS H2ERC4_HBV/1-352     AC H2ERC4.1
#=GS Q9YPV5_HBV/1-341     AC Q9YPV5.1
#=GS Q67882_HBV/1-341     AC Q67882.1
#=GS A9CM82_HBV/1-352     AC A9CM82.1
#=GS I0C9H3_HBV/1-352     AC I0C9H3.1
#=GS D0UE44_HBV/1-352     AC D0UE44.1
#=GS F5C0W9_HBV/1-354     AC F5C0W9.1
#=GS C6F4G2_HBV/1-354     AC C6F4G2.1
#=GS E5RPL1_HBV/1-352     AC E5RPL1.1
#=GS Q8V1H9_HBV/1-350     AC Q8V1H9.1
#=GS D0UEA7_HBV/1-347     AC D0UEA7.1
#=GS D0E5J7_HBV/1-352     AC D0E5J7.1
#=GS G1E877_HBV/1-341     AC G1E877.1
#=GS B1ABM6_HBV/1-352     AC B1ABM6.1
#=GS G1E7R5_HBV/1-341     AC G1E7R5.1
#=GS I0C9F6_HBV/1-338     AC I0C9F6.1
#=GS Q20C12_HBV/1-56      AC Q20C12.1
#=GS G9G9E6_HBV/1-341     AC G9G9E6.1
#=GS B5M5S6_HBV/1-352     AC B5M5S6.1
#=GS B5TF45_HBV/1-112     AC B5TF45.1
#=GS I0C8D6_HBV/1-354     AC I0C8D6.1
#=GS I0DDA5_HBV/1-328     AC I0DDA5.1
#=GS B3VLM8_HBV/1-176     AC B3VLM8.1
#=GS C7DQS2_HBV/1-352     AC C7DQS2.1
#=GS G4XI67_HBV/1-160     AC G4XI67.1
#=GS Q99HS9_HBV/1-352     AC Q99HS9.1
#=GS I0C8J3_HBV/1-350     AC I0C8J3.1
#=GS B7TUA9_HBV/1-352     AC B7TUA9.1
#=GS I0C8A8_HBV/1-354     AC I0C8A8.1
#=GS Q0PVA6_HBV/1-352     AC Q0PVA6.1
#=GS G3XLE4_HBV/1-352     AC G3XLE4.1
#=GS F5C158_HBV/1-354     AC F5C158.1
#=GS B9W3Y5_HBV/1-354     AC B9W3Y5.1
#=GS F5C0W5_HBV/1-354     AC F5C0W5.1
#=GS B4YLB7_HBV/1-341     AC B4YLB7.1
#=GS B7TUI9_HBV/1-352     AC B7TUI9.1
#=GS E5RPL9_HBV/1-352     AC E5RPL9.1
#=GS C6F528_HBV/1-354     AC C6F528.1
#=GS H6UGG1_HBV/1-341     AC H6UGG1.1
#=GS G1E7I5_HBV/269-317   AC G1E7I5.1
#=GS I0DCC9_HBV/1-317     AC I0DCC9.1
#=GS I0C900_HBV/1-354     AC I0C900.1
#=GS I0DCJ1_HBV/1-328     AC I0DCJ1.1
#=GS Q89248_9HEPA/1-294   AC Q89248.1
#=GS F5C103_HBV/1-354     AC F5C103.1
#=GS G1E889_HBV/1-341     AC G1E889.1
#=GS D5LF78_HBV/1-352     AC D5LF78.1
#=GS D3TIH5_HBV/1-342     AC D3TIH5.1
#=GS I0DD64_HBV/1-328     AC I0DD64.1
#=GS D5LD53_HBV/1-352     AC D5LD53.1
#=GS G9G9I0_HBV/1-341     AC G9G9I0.1
#=GS I0C871_HBV/1-354     AC I0C871.1
#=GS H6V5P4_HBV/1-341     AC H6V5P4.1
#=GS I0C863_HBV/1-354     AC I0C863.1
#=GS H9XRM4_HBV/1-91      AC H9XRM4.1
#=GS E0ZRD4_HBV/1-351     AC E0ZRD4.1
#=GS I0DGC8_HBV/1-352     AC I0DGC8.1
#=GS D0E5I0_HBV/1-352     AC D0E5I0.1
#=GS D3TKB6_HBV/1-352     AC D3TKB6.1
#=GS H9XR07_HBV/1-91      AC H9XR07.1
#=GS D0E6H6_HBV/1-352     AC D0E6H6.1
#=GS I0DGD6_HBV/1-352     AC I0DGD6.1
#=GS D0UE07_HBV/1-352     AC D0UE07.1
#=GS G1E8J2_HBV/1-233     AC G1E8J2.1
#=GS B9VKD3_HBV/1-291     AC B9VKD3.1
#=GS C7AY66_HBV/1-354     AC C7AY66.1
#=GS B0FD60_HBV/1-352     AC B0FD60.1
#=GS I0DCE0_HBV/240-285   AC I0DCE0.1
#=GS H9XRB8_HBV/1-91      AC H9XRB8.1
#=GS F5C0L1_HBV/1-354     AC F5C0L1.1
#=GS Q68RR7_HBV/1-352     AC Q68RR7.1
#=GS Q2EIE7_HBV/1-346     AC Q2EIE7.1
#=GS E5F0W1_HBV/1-49      AC E5F0W1.1
#=GS D5LEE7_HBV/1-352     AC D5LEE7.1
#=GS C7DMA6_HBV/1-351     AC C7DMA6.1
#=GS Q6XGR9_HBV/1-354     AC Q6XGR9.1
#=GS G4XIA8_HBV/1-130     AC G4XIA8.1
#=GS D0U3X8_HBV/1-354     AC D0U3X8.1
#=GS D2JMA1_HBV/1-352     AC D2JMA1.1
#=GS A9QQ05_HBV/1-351     AC A9QQ05.1
#=GS D5LCU3_HBV/1-352     AC D5LCU3.1
#=GS Q5EDR9_HBV/1-341     AC Q5EDR9.1
#=GS A4F517_HBV/1-240     AC A4F517.1
#=GS A5JI59_HBV/1-112     AC A5JI59.1
#=GS C9WDK8_HBV/1-341     AC C9WDK8.1
#=GS B9VKW8_HBV/1-352     AC B9VKW8.1
#=GS I0C997_HBV/1-341     AC I0C997.1
#=GS G1E7T9_HBV/1-341     AC G1E7T9.1
#=GS B9VKM8_HBV/1-352     AC B9VKM8.1
#=GS Q77BF5_HBV/1-167     AC Q77BF5.1
#=GS B0FCE6_HBV/1-352     AC B0FCE6.1
#=GS O91561_HBV/1-352     AC O91561.1
#=GS Q91C43_HBV/1-330     AC Q91C43.1
#=GS I0C892_HBV/1-354     AC I0C892.1
#=GS I0DGB5_HBV/1-352     AC I0DGB5.1
#=GS F5C0S1_HBV/1-333     AC F5C0S1.1
#=GS I0DG99_HBV/1-352     AC I0DG99.1
#=GS B0FCH3_HBV/1-352     AC B0FCH3.1
#=GS I0DCK7_HBV/1-328     AC I0DCK7.1
#=GS H9XQE6_HBV/1-91      AC H9XQE6.1
#=GS A0FDK9_HBV/1-100     AC A0FDK9.1
#=GS Q80SD0_HBV/1-341     AC Q80SD0.1
#=GS D3YFZ7_HBV/1-341     AC D3YFZ7.1
#=GS H9XQH0_HBV/1-91      AC H9XQH0.1
#=GS B5TFG1_HBV/1-112     AC B5TFG1.1
#=GS B5M5U8_HBV/1-352     AC B5M5U8.1
#=GS F5C132_HBV/1-354     AC F5C132.1
#=GS G1C952_HBV/1-341     AC G1C952.1
#=GS A6MG91_HBV/1-352     AC A6MG91.1
#=GS D9U5J3_HBV/1-183     AC D9U5J3.1
#=GS B5TFL3_HBV/1-112     AC B5TFL3.1
#=GS B5BPW2_HBV/1-334     AC B5BPW2.1
#=GS A5LG54_HBV/1-352     AC A5LG54.1
#=GS DPOL_HBVH3/1-352     AC Q8JMZ7.1
#=GS Q9E9A5_HBV/1-352     AC Q9E9A5.1
#=GS H2ER83_HBV/1-352     AC H2ER83.1
#=GS H6V5K4_HBV/1-352     AC H6V5K4.1
#=GS Q9WFB5_9HEPA/1-365   AC Q9WFB5.1
#=GS D5LCG6_HBV/1-352     AC D5LCG6.1
#=GS I0C8D0_HBV/1-354     AC I0C8D0.1
#=GS D0UDR9_HBV/1-352     AC D0UDR9.1
#=GS Q6XGM7_HBV/1-354     AC Q6XGM7.1
#=GS B9VKR5_HBV/1-352     AC B9VKR5.1
#=GS Q2ABY6_HBV/1-352     AC Q2ABY6.1
#=GS Q00K92_HBV/1-352     AC Q00K92.1
#=GS B4YLD1_HBV/1-341     AC B4YLD1.1
#=GS B4ZYX9_HBV/1-341     AC B4ZYX9.1
#=GS Q9IXC9_HBV/1-52      AC Q9IXC9.1
#=GS H6UN56_HBV/1-341     AC H6UN56.1
#=GS B7TV93_HBV/1-352     AC B7TV93.1
#=GS H6V5T8_HBV/1-352     AC H6V5T8.1
#=GS B9VKI0_HBV/1-352     AC B9VKI0.1
#=GS Q5R2M3_HBV/1-352     AC Q5R2M3.1
#=GS D6QW32_HBV/244-308   AC D6QW32.1
#=GS A7YEU1_HBV/1-352     AC A7YEU1.1
#=GS C8CK47_HBV/1-354     AC C8CK47.1
#=GS F5C129_HBV/1-354     AC F5C129.1
#=GS G9BMP5_HBV/1-338     AC G9BMP5.1
#=GS C6F534_HBV/1-354     AC C6F534.1
#=GS B7TUZ6_HBV/1-352     AC B7TUZ6.1
#=GS O91522_HBV/1-186     AC O91522.1
#=GS I0DDK5_HBV/1-328     AC I0DDK5.1
#=GS Q80MR1_HBV/1-352     AC Q80MR1.1
#=GS D3TK31_HBV/1-352     AC D3TK31.1
#=GS Q404F0_HBV/1-341     AC Q404F0.1
#=GS DPOL_HBVB1/1-352     AC P17394.1
#=GS D0EEB9_HBV/1-354     AC D0EEB9.1
#=GS B7TUY4_HBV/1-352     AC B7TUY4.1
#=GS D2U618_HBV/1-351     AC D2U618.1
#=GS A5LGB8_HBV/1-352     AC A5LGB8.1
#=GS G1C8A7_HBV/1-341     AC G1C8A7.1
#=GS H6V5K8_HBV/1-352     AC H6V5K8.1
#=GS G3XH12_HBV/1-332     AC G3XH12.1
#=GS I0DE04_HBV/1-328     AC I0DE04.1
#=GS I0C923_HBV/1-354     AC I0C923.1
#=GS D2U670_HBV/1-351     AC D2U670.1
#=GS D3YN74_HBV/1-352     AC D3YN74.1
#=GS C1K1L5_HBV/1-278     AC C1K1L5.1
#=GS C1K1G3_HBV/1-352     AC C1K1G3.1
#=GS D0E5K9_HBV/1-352     AC D0E5K9.1
#=GS I0DDX0_HBV/1-328     AC I0DDX0.1
#=GS G9G8P6_HBV/1-341     AC G9G8P6.1
#=GS G1C8A0_HBV/1-341     AC G1C8A0.1
#=GS F2WS76_HBV/1-352     AC F2WS76.1
#=GS A1BLQ9_HBV/1-52      AC A1BLQ9.1
#=GS E5F0X2_HBV/1-48      AC E5F0X2.1
#=GS G4XI55_HBV/1-119     AC G4XI55.1
#=GS A9CM62_HBV/1-352     AC A9CM62.1
#=GS B1B609_HBV/1-352     AC B1B609.1
#=GS F5C0Z5_HBV/1-354     AC F5C0Z5.1
#=GS Q19SV8_HBV/1-339     AC Q19SV8.1
#=GS I0DGC5_HBV/1-352     AC I0DGC5.1
#=GS G3XH08_HBV/1-343     AC G3XH08.1
#=GS D0E686_HBV/1-352     AC D0E686.1
#=GS H6UGG7_HBV/1-341     AC H6UGG7.1
#=GS Q4FDB9_HBV/1-352     AC Q4FDB9.1
#=GS I0DE88_HBV/1-317     AC I0DE88.1
#=GS B6CIY6_HBV/1-341     AC B6CIY6.1
#=GS B5M5I1_HBV/1-215     AC B5M5I1.1
#=GS Q7T7Y5_HBV/1-341     AC Q7T7Y5.1
#=GS G1C913_HBV/1-336     AC G1C913.1
#=GS I0C897_HBV/1-354     AC I0C897.1
#=GS I0DDA1_HBV/1-328     AC I0DDA1.1
#=GS Q5U7S7_HBV/1-341     AC Q5U7S7.1
#=GS H6UND6_HBV/1-343     AC H6UND6.1
#=GS Q8B6N0_HBV/1-352     AC Q8B6N0.1
#=GS C7DSQ3_HBV/1-341     AC C7DSQ3.1
#=GS Q8B4G2_HBV/272-307   AC Q8B4G2.1
#=GS B0YGH4_HBV/1-341     AC B0YGH4.1
#=GS A5JJ30_HBV/1-51      AC A5JJ30.1
#=GS Q81127_HBV/1-352     AC Q81127.1
#=GS B1ABL4_HBV/234-291   AC B1ABL4.1
#=GS Q5KR23_HBV/1-352     AC Q5KR23.1
#=GS D0E5J4_HBV/1-352     AC D0E5J4.1
#=GS H9XQK8_HBV/1-91      AC H9XQK8.1
#=GS I0DCK4_HBV/1-322     AC I0DCK4.1
#=GS E7CT95_HBV/1-352     AC E7CT95.1
#=GS Q20BS7_HBV/3-63      AC Q20BS7.1
#=GS B5ASX2_HBV/1-352     AC B5ASX2.1
#=GS H2ER44_HBV/1-352     AC H2ER44.1
#=GS I0C8W1_HBV/1-354     AC I0C8W1.1
#=GS C7DMG4_HBV/1-351     AC C7DMG4.1
#=GS Q20BN7_HBV/1-57      AC Q20BN7.1
#=GS A6MGA2_HBV/1-352     AC A6MGA2.1
#=GS G4XI90_HBV/1-54      AC G4XI90.1
#=GS Q81116_HBV/1-352     AC Q81116.1
#=GS B5AT80_HBV/1-352     AC B5AT80.1
#=GS I0DGC4_HBV/1-352     AC I0DGC4.1
#=GS B5B474_HBV/1-352     AC B5B474.1
#=GS Q8JXB1_HBV/1-352     AC Q8JXB1.1
#=GS I0C962_HBV/1-354     AC I0C962.1
#=GS C7DM85_HBV/1-351     AC C7DM85.1
#=GS C7DY88_HBV/1-347     AC C7DY88.1
#=GS C7DM24_HBV/1-351     AC C7DM24.1
#=GS H6UN68_HBV/1-341     AC H6UN68.1
#=GS B7TUZ0_HBV/1-352     AC B7TUZ0.1
#=GS B0FCG8_HBV/1-352     AC B0FCG8.1
#=GS C5WJV8_HBV/1-352     AC C5WJV8.1
#=GS Q404G2_HBV/1-341     AC Q404G2.1
#=GS Q4FDC3_HBV/1-352     AC Q4FDC3.1
#=GS C3W4H5_HBV/1-341     AC C3W4H5.1
#=GS B5AT13_HBV/1-352     AC B5AT13.1
#=GS G4XI51_HBV/1-160     AC G4XI51.1
#=GS Q5DW02_HBV/1-352     AC Q5DW02.1
#=GS Q0PML2_HBV/1-352     AC Q0PML2.1
#=GS I0C8Y4_HBV/1-354     AC I0C8Y4.1
#=GS F5C0M9_HBV/1-354     AC F5C0M9.1
#=GS Q2AC04_HBV/1-352     AC Q2AC04.1
#=GS D5LEA0_HBV/1-352     AC D5LEA0.1
#=GS Q4W6F2_HBV/1-351     AC Q4W6F2.1
#=GS E7D6T6_9HEPA/1-364   AC E7D6T6.1
#=GS I0DGG8_HBV/3-157     AC I0DGG8.1
#=GS I0C972_HBV/1-354     AC I0C972.1
#=GS I0C9F9_HBV/1-338     AC I0C9F9.1
#=GS E0ZRB3_HBV/1-351     AC E0ZRB3.1
#=GS G1C8Y5_HBV/1-341     AC G1C8Y5.1
#=GS A5JIL9_HBV/1-112     AC A5JIL9.1
#=GS D3TK44_HBV/1-352     AC D3TK44.1
#=GS H9XQP8_HBV/1-91      AC H9XQP8.1
#=GS Q764Q1_HBV/1-341     AC Q764Q1.1
#=GS Q2L4L9_HBV/1-341     AC Q2L4L9.1
#=GS D5LC14_HBV/1-352     AC D5LC14.1
#=GS Q4KR93_HBV/1-354     AC Q4KR93.1
#=GS I0C9A1_HBV/1-341     AC I0C9A1.1
#=GS Q20BW1_HBV/1-56      AC Q20BW1.1
#=GS O91563_HBV/1-352     AC O91563.1
#=GS D0E6F2_HBV/1-352     AC D0E6F2.1
#=GS E5RD33_HBV/1-352     AC E5RD33.1
#=GS I0DDZ4_HBV/230-281   AC I0DDZ4.1
#=GS H9XQW8_HBV/1-91      AC H9XQW8.1
#=GS Q91ID1_HBV/1-52      AC Q91ID1.1
#=GS I0DG88_HBV/1-352     AC I0DG88.1
#=GS C3W3X2_HBV/1-341     AC C3W3X2.1
#=GS E5CYX2_HBV/1-352     AC E5CYX2.1
#=GS B5TXN1_HBV/1-352     AC B5TXN1.1
#=GS H6UGT4_HBV/1-341     AC H6UGT4.1
#=GS Q58W09_HBV/1-352     AC Q58W09.1
#=GS A5JI40_HBV/1-112     AC A5JI40.1
#=GS I0C9G4_HBV/1-338     AC I0C9G4.1
#=GS D5LFJ0_HBV/1-352     AC D5LFJ0.1
#=GS Q6BCP3_HBV/17-132    AC Q6BCP3.1
#=GS B9VL56_HBV/1-352     AC B9VL56.1
#=GS Q6QJC7_9HEPA/1-368   AC Q6QJC7.1
#=GS H9XQR7_HBV/1-91      AC H9XQR7.1
#=GS Q8B4F8_HBV/1-270     AC Q8B4F8.1
#=GS D2U660_HBV/1-351     AC D2U660.1
#=GS Q5Q0T5_HBV/1-352     AC Q5Q0T5.1
#=GS I0DDJ7_HBV/1-317     AC I0DDJ7.1
#=GS DPOL_WHV2/1-392      AC P06275.1
#=GS I0C963_HBV/1-354     AC I0C963.1
#=GS B1A0B8_HBV/1-352     AC B1A0B8.1
#=GS I0C8R2_HBV/226-280   AC I0C8R2.1
#=GS G3GDQ8_HBV/1-352     AC G3GDQ8.1
#=GS D0E5Z4_HBV/1-352     AC D0E5Z4.1
#=GS C6F4Q3_HBV/1-354     AC C6F4Q3.1
#=GS I0C911_HBV/1-354     AC I0C911.1
#=GS G9G9S5_HBV/1-341     AC G9G9S5.1
#=GS Q77BG2_HBV/1-167     AC Q77BG2.1
#=GS H9XRT7_HBV/1-91      AC H9XRT7.1
#=GS D7NKX1_HBV/1-341     AC D7NKX1.1
#=GS I0C9E0_HBV/1-334     AC I0C9E0.1
#=GS Q2L4L0_HBV/1-341     AC Q2L4L0.1
#=GS Q2MLR6_HBV/1-341     AC Q2MLR6.1
#=GS B5TFE9_HBV/1-112     AC B5TFE9.1
#=GS O09511_HBV/1-212     AC O09511.1
#=GS H9XRW9_HBV/1-91      AC H9XRW9.1
#=GS B1A0A5_HBV/1-352     AC B1A0A5.1
#=GS F1AEZ3_HBV/1-354     AC F1AEZ3.1
#=GS Q2ABE2_HBV/1-352     AC Q2ABE2.1
#=GS E0ZRL9_HBV/1-351     AC E0ZRL9.1
#=GS I0DDR3_HBV/1-328     AC I0DDR3.1
#=GS D4P3S8_HBV/1-351     AC D4P3S8.1
#=GS D0EE29_HBV/1-354     AC D0EE29.1
#=GS F5C1C0_HBV/1-354     AC F5C1C0.1
#=GS E5RD89_HBV/1-352     AC E5RD89.1
#=GS I0C917_HBV/1-354     AC I0C917.1
#=GS B9VL29_HBV/1-352     AC B9VL29.1
#=GS H9XRP4_HBV/1-91      AC H9XRP4.1
#=GS B2LW98_HBV/1-200     AC B2LW98.1
#=GS D0EE15_HBV/1-354     AC D0EE15.1
#=GS D3TK24_HBV/1-352     AC D3TK24.1
#=GS A5JJ30_HBV/42-101    AC A5JJ30.1
#=GS G9G9N6_HBV/1-341     AC G9G9N6.1
#=GS D5LCV7_HBV/1-352     AC D5LCV7.1
#=GS C1K198_HBV/1-352     AC C1K198.1
#=GS Q918N9_9HEPA/1-393   AC Q918N9.1
#=GS F5C0H5_HBV/1-341     AC F5C0H5.1
#=GS I0DGC6_HBV/1-352     AC I0DGC6.1
#=GS G0VSF6_HBV/1-354     AC G0VSF6.1
#=GS A5GZG8_HBV/1-352     AC A5GZG8.1
#=GS D0EEE6_HBV/1-354     AC D0EEE6.1
#=GS C6F4B3_HBV/1-354     AC C6F4B3.1
#=GS Q9YKJ3_HBV/1-352     AC Q9YKJ3.1
#=GS C9WDU4_HBV/1-352     AC C9WDU4.1
#=GS I0C864_HBV/1-354     AC I0C864.1
#=GS E9L5I4_HBV/1-352     AC E9L5I4.1
#=GS B0YGJ0_HBV/1-341     AC B0YGJ0.1
#=GS B0FCL2_HBV/1-352     AC B0FCL2.1
#=GS A8J4G9_HBV/1-344     AC A8J4G9.1
#=GS Q2L4K5_HBV/1-352     AC Q2L4K5.1
#=GS Q5U7R0_HBV/1-341     AC Q5U7R0.1
#=GS Q4KRD5_HBV/1-354     AC Q4KRD5.1
#=GS D0EEP5_HBV/1-354     AC D0EEP5.1
#=GS D0EE08_HBV/1-354     AC D0EE08.1
#=GS A0FDM5_HBV/1-341     AC A0FDM5.1
#=GS D3YGD7_HBV/1-336     AC D3YGD7.1
#=GS B5TFH7_HBV/1-112     AC B5TFH7.1
#=GS D5LCK7_HBV/1-352     AC D5LCK7.1
#=GS B5U729_HBV/1-341     AC B5U729.1
#=GS B4YLD8_HBV/1-341     AC B4YLD8.1
#=GS D2JMG0_HBV/1-352     AC D2JMG0.1
#=GS Q5SDK5_HBV/1-352     AC Q5SDK5.1
#=GS C7AY90_HBV/1-354     AC C7AY90.1
#=GS B5TF18_HBV/1-112     AC B5TF18.1
#=GS F5C179_HBV/1-354     AC F5C179.1
#=GS Q2PWX3_HBV/1-354     AC Q2PWX3.1
#=GS B5LXY6_HBV/1-341     AC B5LXY6.1
#=GS I0C866_HBV/1-354     AC I0C866.1
#=GS A9CM25_HBV/1-352     AC A9CM25.1
#=GS A5JIR6_HBV/1-112     AC A5JIR6.1
#=GS C7AYY1_HBV/1-354     AC C7AYY1.1
#=GS Q8B5Q1_HBV/1-200     AC Q8B5Q1.1
#=GS D5LB89_HBV/1-352     AC D5LB89.1
#=GS G3XH24_HBV/1-332     AC G3XH24.1
#=GS H9XRE2_HBV/1-91      AC H9XRE2.1
#=GS O91559_HBV/1-352     AC O91559.1
#=GS D0E5P9_HBV/1-352     AC D0E5P9.1
#=GS A5JIB5_HBV/1-112     AC A5JIB5.1
#=GS D0E672_HBV/1-352     AC D0E672.1
#=GS G3E538_HBV/1-342     AC G3E538.1
#=GS B3VLL4_HBV/1-176     AC B3VLL4.1
#=GS D6QVV6_HBV/1-352     AC D6QVV6.1
#=GS I0C8P7_HBV/1-341     AC I0C8P7.1
#=GS H2ERE5_HBV/1-352     AC H2ERE5.1
#=GS D3YG51_HBV/1-341     AC D3YG51.1
#=GS I0DG98_HBV/1-352     AC I0DG98.1
#=GS Q9E934_HBV/1-352     AC Q9E934.1
#=GS Q80JT8_9HEPA/1-363   AC Q80JT8.1
#=GS F5C0R0_HBV/1-351     AC F5C0R0.1
#=GS G3E566_HBV/1-341     AC G3E566.1
#=GS I0DGD9_HBV/1-352     AC I0DGD9.1
#=GS H9XQP4_HBV/1-91      AC H9XQP4.1
#=GS D5L234_9HEPA/1-388   AC D5L234.1
#=GS Q0KG44_HBV/1-354     AC Q0KG44.1
#=GS C7DM72_HBV/1-351     AC C7DM72.1
#=GS H9XR54_HBV/1-91      AC H9XR54.1
#=GS Q6RSE2_9HEPA/1-363   AC Q6RSE2.1
#=GS Q6XGV4_HBV/1-354     AC Q6XGV4.1
#=GS D0E6H2_HBV/1-352     AC D0E6H2.1
#=GS E9L2J8_HBV/1-171     AC E9L2J8.1
#=GS D3XGH2_HBV/1-352     AC D3XGH2.1
#=GS I0C9H5_HBV/1-352     AC I0C9H5.1
#=GS C9WDB4_HBV/1-329     AC C9WDB4.1
#=GS F5C0Q1_HBV/1-354     AC F5C0Q1.1
#=GS B5ASR8_HBV/1-352     AC B5ASR8.1
#=GS O91556_HBV/1-352     AC O91556.1
#=GS D6QVF5_HBV/1-352     AC D6QVF5.1
#=GS I0C9C5_HBV/1-334     AC I0C9C5.1
#=GS A5JIP2_HBV/1-112     AC A5JIP2.1
#=GS C1K1U3_HBV/1-350     AC C1K1U3.1
#=GS F5C1S8_HBV/1-348     AC F5C1S8.1
#=GS I0C8F1_HBV/1-354     AC I0C8F1.1
#=GS H2ERI7_HBV/1-273     AC H2ERI7.1
#=GS G9G8V6_HBV/1-341     AC G9G8V6.1
#=GS Q58W05_HBV/1-352     AC Q58W05.1
#=GS H6WFB8_HBV/1-112     AC H6WFB8.1
#=GS Q5R2M7_HBV/1-340     AC Q5R2M7.1
#=GS G4XMN1_HBV/1-352     AC G4XMN1.1
#=GS H9XR70_HBV/1-91      AC H9XR70.1
#=GS Q9QN49_HBV/1-352     AC Q9QN49.1
#=GS A5JI25_HBV/1-112     AC A5JI25.1
#=GS B7TTC4_HBV/1-352     AC B7TTC4.1
#=GS D0EDZ4_HBV/1-354     AC D0EDZ4.1
#=GS C3W4A0_HBV/1-336     AC C3W4A0.1
#=GS Q1PD00_HBV/1-352     AC Q1PD00.1
#=GS H6UGL5_HBV/1-341     AC H6UGL5.1
#=GS B7TTZ9_HBV/1-352     AC B7TTZ9.1
#=GS Q8B4D5_HBV/1-341     AC Q8B4D5.1
#=GS B5M4Z5_HBV/1-352     AC B5M4Z5.1
#=GS Q81141_HBV/1-352     AC Q81141.1
#=GS I0DGA9_HBV/1-352     AC I0DGA9.1
#=GS C9WDL5_HBV/1-341     AC C9WDL5.1
#=GS B9VL21_HBV/1-341     AC B9VL21.1
#=GS Q50JU2_HBV/1-346     AC Q50JU2.1
#=GS H6WF94_HBV/1-112     AC H6WF94.1
#=GS B9VK35_HBV/1-352     AC B9VK35.1
#=GS E5CZ41_HBV/1-352     AC E5CZ41.1
#=GS Q9E6T9_HBV/1-352     AC Q9E6T9.1
#=GS D3YGB9_HBV/1-341     AC D3YGB9.1
#=GS D0E5S1_HBV/1-352     AC D0E5S1.1
#=GS I0C883_HBV/1-354     AC I0C883.1
#=GS B5M5D3_HBV/1-352     AC B5M5D3.1
#=GS B0FC52_HBV/1-352     AC B0FC52.1
#=GS C1K1U7_HBV/1-352     AC C1K1U7.1
#=GS Q9WDD4_HBV/47-103    AC Q9WDD4.1
#=GS B9VKI8_HBV/1-352     AC B9VKI8.1
#=GS I0C890_HBV/1-354     AC I0C890.1
#=GS H9XQC2_HBV/1-91      AC H9XQC2.1
#=GS I0DDC1_HBV/1-328     AC I0DDC1.1
#=GS Q2EIF1_HBV/1-346     AC Q2EIF1.1
#=GS D0E5R4_HBV/1-352     AC D0E5R4.1
#=GS C5WJX4_HBV/1-352     AC C5WJX4.1
#=GS A6MG45_HBV/1-352     AC A6MG45.1
#=GS B5TFM1_HBV/1-112     AC B5TFM1.1
#=GS A9PLJ1_HBV/2-43      AC A9PLJ1.1
#=GS E5RPV9_HBV/1-343     AC E5RPV9.1
#=GS C3W403_HBV/1-341     AC C3W403.1
#=GS Q9QMP1_HBV/1-352     AC Q9QMP1.1
#=GS D6QW05_HBV/1-352     AC D6QW05.1
#=GS D3YG21_HBV/1-341     AC D3YG21.1
#=GS A4UBL7_HBV/1-341     AC A4UBL7.2
#=GS B1NYB6_HBV/1-341     AC B1NYB6.1
#=GS Q68RQ6_HBV/1-352     AC Q68RQ6.1
#=GS Q3ZKN7_HBV/1-351     AC Q3ZKN7.1
#=GS H6UN96_HBV/1-341     AC H6UN96.1
#=GS Q9DTC9_HBV/1-352     AC Q9DTC9.1
#=GS E0ZRA0_HBV/1-351     AC E0ZRA0.1
#=GS Q5UFT9_HBV/1-341     AC Q5UFT9.1
#=GS Q80J78_HBV/1-352     AC Q80J78.1
#=GS C0IR93_HBV/1-352     AC C0IR93.1
#=GS I0C9G0_HBV/1-338     AC I0C9G0.1
#=GS I0C8Q6_HBV/1-231     AC I0C8Q6.1
#=GS D0UDY2_HBV/1-336     AC D0UDY2.1
#=GS A5JHS8_HBV/1-112     AC A5JHS8.1
#=GS Q20BV5_HBV/1-57      AC Q20BV5.1
#=GS H1ACY4_HBV/1-352     AC H1ACY4.1
#=GS Q67937_HBV/1-352     AC Q67937.1
#=GS F5C0X5_HBV/1-354     AC F5C0X5.1
#=GS E0ZRU1_HBV/1-351     AC E0ZRU1.1
#=GS D5LD72_HBV/1-352     AC D5LD72.1
#=GS B7TUC4_HBV/1-352     AC B7TUC4.1
#=GS Q20BT1_HBV/1-57      AC Q20BT1.1
#=GS F1KLU1_HBV/1-352     AC F1KLU1.1
#=GS Q9E9A0_HBV/1-352     AC Q9E9A0.1
#=GS B5BPR5_HBV/1-352     AC B5BPR5.1
#=GS Q70B80_HBV/1-103     AC Q70B80.1
#=GS D0E6A2_HBV/1-352     AC D0E6A2.1
#=GS A5GZK2_HBV/1-352     AC A5GZK2.1
#=GS B0YGL6_HBV/1-341     AC B0YGL6.1
#=GS C1K1Q1_HBV/1-352     AC C1K1Q1.1
#=GS Q769J1_HBV/1-349     AC Q769J1.1
#=GS G4XMD5_HBV/1-341     AC G4XMD5.1
#=GS Q6XGR2_HBV/1-354     AC Q6XGR2.1
#=GS I0C8Q9_HBV/225-280   AC I0C8Q9.1
#=GS B0FCC4_HBV/1-352     AC B0FCC4.1
#=GS B9VAY1_HBV/213-283   AC B9VAY1.1
#=GS C1K1D9_HBV/1-352     AC C1K1D9.1
#=GS G3XH04_HBV/1-343     AC G3XH04.1
#=GS Q1HH99_HBV/1-341     AC Q1HH99.1
#=GS F5C0Q6_HBV/1-351     AC F5C0Q6.1
#=GS C7AYX6_HBV/1-354     AC C7AYX6.1
#=GS Q9E8L0_HBV/1-352     AC Q9E8L0.1
#=GS A5LG18_HBV/1-352     AC A5LG18.1
#=GS H9XQV6_HBV/1-91      AC H9XQV6.1
#=GS F5C0U7_HBV/1-354     AC F5C0U7.1
#=GS I0C8J2_HBV/1-350     AC I0C8J2.1
#=GS F5C0I7_HBV/1-341     AC F5C0I7.1
#=GS A5JIA7_HBV/1-112     AC A5JIA7.1
#=GS Q67832_HBV/1-83      AC Q67832.1
#=GS D5LF39_HBV/1-352     AC D5LF39.1
#=GS Q20BT3_HBV/1-52      AC Q20BT3.1
#=GS Q8B5Q4_HBV/1-190     AC Q8B5Q4.1
#=GS I0C888_HBV/1-354     AC I0C888.1
#=GS G3E5A8_HBV/1-341     AC G3E5A8.1
#=GS I0C8A4_HBV/1-354     AC I0C8A4.1
#=GS G4XI59_HBV/1-160     AC G4XI59.1
#=GS B5M644_HBV/1-352     AC B5M644.1
#=GS I0DE84_HBV/1-317     AC I0DE84.1
#=GS D5LC55_HBV/1-352     AC D5LC55.1
#=GS B2Y6Y8_HBV/1-341     AC B2Y6Y8.1
#=GS G1E7C3_HBV/1-341     AC G1E7C3.1
#=GS C9WDB9_HBV/1-341     AC C9WDB9.1
#=GS G4XMN5_HBV/1-352     AC G4XMN5.1
#=GS C7AYE9_HBV/1-354     AC C7AYE9.1
#=GS A5GZL4_HBV/1-352     AC A5GZL4.1
#=GS E5RPS1_HBV/1-332     AC E5RPS1.1
#=GS Q8V1I6_HBV/1-352     AC Q8V1I6.1
#=GS C3W470_HBV/1-341     AC C3W470.1
#=GS B4YLI1_HBV/1-341     AC B4YLI1.1
#=GS F4ZCA1_HBV/1-49      AC F4ZCA1.1
#=GS F5C0Z6_HBV/1-354     AC F5C0Z6.1
#=GS Q05HA7_HBV/1-340     AC Q05HA7.1
#=GS D5LE61_HBV/1-352     AC D5LE61.1
#=GS B4YL73_HBV/1-341     AC B4YL73.1
#=GS F5C0U8_HBV/1-354     AC F5C0U8.1
#=GS C5WJV0_HBV/1-352     AC C5WJV0.1
#=GS I0C896_HBV/1-354     AC I0C896.1
#=GS F1AEX3_HBV/1-351     AC F1AEX3.1
#=GS I0DGD7_HBV/1-352     AC I0DGD7.1
#=GS B5TF53_HBV/1-112     AC B5TF53.1
#=GS E5F0V8_HBV/1-34      AC E5F0V8.1
#=GS H9XR34_HBV/1-91      AC H9XR34.1
#=GS Q76B13_HBV/1-352     AC Q76B13.1
#=GS D3TKC3_HBV/1-352     AC D3TKC3.1
#=GS C6F5E6_HBV/1-354     AC C6F5E6.1
#=GS F5C172_HBV/1-176     AC F5C172.1
#=GS Q8QMM2_HBV/1-341     AC Q8QMM2.1
#=GS D0E5M4_HBV/1-352     AC D0E5M4.1
#=GS I0DGB9_HBV/1-352     AC I0DGB9.1
#=GS H6WFE6_HBV/1-112     AC H6WFE6.1
#=GS B7TUB3_HBV/1-352     AC B7TUB3.1
#=GS E0ZR74_HBV/1-351     AC E0ZR74.1
#=GS E3Q0G2_HBV/1-352     AC E3Q0G2.1
#=GS O91545_HBV/1-337     AC O91545.1
#=GS B5M650_HBV/1-352     AC B5M650.1
#=GS B4ZYZ3_HBV/1-341     AC B4ZYZ3.1
#=GS Q9QMJ7_HBV/1-352     AC Q9QMJ7.1
#=GS I0C994_HBV/1-341     AC I0C994.1
#=GS Q5SDL2_HBV/1-352     AC Q5SDL2.1
#=GS B5TF30_HBV/1-112     AC B5TF30.1
#=GS C6F4C7_HBV/1-354     AC C6F4C7.1
#=GS Q5Q0Y1_HBV/1-341     AC Q5Q0Y1.1
#=GS B9VK01_HBV/1-352     AC B9VK01.1
#=GS I0DCL9_HBV/1-328     AC I0DCL9.1
#=GS B3VLL1_HBV/1-175     AC B3VLL1.1
#=GS I0DCS8_HBV/1-328     AC I0DCS8.1
#=GS E5RPY9_HBV/1-325     AC E5RPY9.1
#=GS I0DEA9_HBV/1-328     AC I0DEA9.1
#=GS B4YKM3_HBV/1-354     AC B4YKM3.1
#=GS Q20BW5_HBV/1-56      AC Q20BW5.1
#=GS D0EEQ2_HBV/1-354     AC D0EEQ2.1
#=GS Q2PWW9_HBV/1-354     AC Q2PWW9.1
#=GS Q8AZ40_HBV/1-352     AC Q8AZ40.1
#=GS F1AET2_HBV/1-354     AC F1AET2.1
#=GS Q9WP64_HBV/1-264     AC Q9WP64.1
#=GS I0C914_HBV/1-354     AC I0C914.1
#=GS G1E7L6_HBV/1-341     AC G1E7L6.1
#=GS I0C8A1_HBV/1-354     AC I0C8A1.1
#=GS Q68RQ2_HBV/1-352     AC Q68RQ2.1
#=GS DPOL_HBVG2/1-351     AC Q8QZQ2.1
#=GS F5C183_HBV/1-354     AC F5C183.1
#=GS Q8QTL9_HBV/1-351     AC Q8QTL9.1
#=GS Q1XHG5_HBV/1-354     AC Q1XHG5.1
#=GS F5C119_HBV/1-285     AC F5C119.1
#=GS E5RPS9_HBV/1-343     AC E5RPS9.1
#=GS B4YL37_HBV/1-341     AC B4YL37.1
#=GS Q99HV0_HBV/1-352     AC Q99HV0.1
#=GS I0DDP8_HBV/1-317     AC I0DDP8.1
#=GS C6F4V2_HBV/1-354     AC C6F4V2.1
#=GS B2CZV6_HBV/1-352     AC B2CZV6.1
#=GS G3XGZ0_HBV/1-327     AC G3XGZ0.1
#=GS E5F0V3_HBV/1-49      AC E5F0V3.1
#=GS E3Q0P1_HBV/1-352     AC E3Q0P1.1
#=GS B5M513_HBV/1-352     AC B5M513.1
#=GS I0DD13_HBV/1-328     AC I0DD13.1
#=GS A9CM86_HBV/1-352     AC A9CM86.1
#=GS B5TFF7_HBV/1-112     AC B5TFF7.1
#=GS D0EYY4_HBV/1-341     AC D0EYY4.1
#=GS A8J4B7_HBV/1-354     AC A8J4B7.1
#=GS E5RPT7_HBV/1-343     AC E5RPT7.1
#=GS C1K217_HBV/1-335     AC C1K217.1
#=GS B5TXQ6_HBV/1-352     AC B5TXQ6.1
#=GS Q8JXH1_HBV/1-351     AC Q8JXH1.1
#=GS Q9QAE0_HBV/1-352     AC Q9QAE0.1
#=GS Q8JNW7_HBV/1-354     AC Q8JNW7.1
#=GS C9WD82_HBV/1-341     AC C9WD82.1
#=GS G9HVE0_HBV/1-352     AC G9HVE0.1
#=GS B0FC66_HBV/1-352     AC B0FC66.1
#=GS Q5UFT5_HBV/1-341     AC Q5UFT5.1
#=GS B5ATD7_HBV/1-276     AC B5ATD7.1
#=GS B7TTF4_HBV/1-352     AC B7TTF4.1
#=GS I0C8Z7_HBV/1-354     AC I0C8Z7.1
#=GS B5A2H8_HBV/1-352     AC B5A2H8.1
#=GS G4XI45_HBV/1-160     AC G4XI45.1
#=GS A6MG51_HBV/1-352     AC A6MG51.1
#=GS E0ZRR7_HBV/1-351     AC E0ZRR7.1
#=GS DPOL_WHV6/1-65       AC P11292.1
#=GS G4XI19_HBV/1-160     AC G4XI19.1
#=GS B2NI16_HBV/1-352     AC B2NI16.1
#=GS O09511_HBV/206-310   AC O09511.1
#=GS I0DCY2_HBV/1-319     AC I0DCY2.1
#=GS Q6X802_9HEPA/1-363   AC Q6X802.1
#=GS Q8B5Q8_HBV/1-190     AC Q8B5Q8.1
#=GS Q8B4I2_HBV/1-354     AC Q8B4I2.1
#=GS F5C0J9_HBV/1-354     AC F5C0J9.1
#=GS B1ABN0_HBV/1-352     AC B1ABN0.1
#=GS B7TUV5_HBV/1-347     AC B7TUV5.1
#=GS D5MSG7_HBV/1-343     AC D5MSG7.1
#=GS C1K1V3_HBV/1-352     AC C1K1V3.1
#=GS Q2L4P8_HBV/1-341     AC Q2L4P8.1
#=GS D0UE91_HBV/1-352     AC D0UE91.1
#=GS C7AY78_HBV/1-354     AC C7AY78.1
#=GS Q9QBE7_HBV/1-352     AC Q9QBE7.1
#=GS A9CM45_HBV/1-352     AC A9CM45.1
#=GS B5M5Y1_HBV/1-352     AC B5M5Y1.1
#=GS H9XR30_HBV/1-91      AC H9XR30.1
#=GS H9XRY9_HBV/1-91      AC H9XRY9.1
#=GS Q1HHB5_HBV/1-341     AC Q1HHB5.1
#=GS H6UGM6_HBV/1-341     AC H6UGM6.1
#=GS I0C980_HBV/1-354     AC I0C980.1
#=GS I0DD90_HBV/1-328     AC I0DD90.1
#=GS H2ER57_HBV/1-352     AC H2ER57.1
#=GS B4YL84_HBV/1-341     AC B4YL84.1
#=GS B5M5G2_HBV/1-352     AC B5M5G2.1
#=GS B5M5Q5_HBV/1-352     AC B5M5Q5.1
#=GS I0DDW1_HBV/185-226   AC I0DDW1.1
#=GS B9VKC2_HBV/1-352     AC B9VKC2.1
#=GS D3TJY3_HBV/1-352     AC D3TJY3.1
#=GS D5LB61_HBV/1-352     AC D5LB61.1
#=GS B9VKC6_HBV/1-352     AC B9VKC6.1
#=GS Q9IX75_HBV/1-52      AC Q9IX75.1
#=GS B7TUR8_HBV/1-352     AC B7TUR8.1
#=GS B9VKW1_HBV/1-352     AC B9VKW1.1
#=GS D3YG57_HBV/1-341     AC D3YG57.1
#=GS E5RD73_HBV/1-352     AC E5RD73.1
#=GS A5JI33_HBV/1-111     AC A5JI33.1
#=GS F5C1G6_HBV/1-341     AC F5C1G6.1
#=GS C0IRW3_HBV/1-352     AC C0IRW3.1
#=GS I0DE00_HBV/1-328     AC I0DE00.1
#=GS Q6UBJ8_HBV/1-323     AC Q6UBJ8.1
#=GS A5LG58_HBV/1-352     AC A5LG58.1
#=GS G9G997_HBV/1-341     AC G9G997.1
#=GS D5LE34_HBV/1-352     AC D5LE34.1
#=GS F5C120_HBV/280-320   AC F5C120.1
#=GS Q1PCZ6_HBV/1-352     AC Q1PCZ6.1
#=GS H9XRA6_HBV/1-91      AC H9XRA6.1
#=GS B5A2G4_HBV/1-352     AC B5A2G4.1
#=GS Q67952_HBV/1-352     AC Q67952.1
#=GS I0DGC3_HBV/1-352     AC I0DGC3.1
#=GS A7YEW2_HBV/1-352     AC A7YEW2.1
#=GS F5C142_HBV/1-354     AC F5C142.1
#=GS B8PTF9_HBV/1-341     AC B8PTF9.1
#=GS D2U5Z4_HBV/1-351     AC D2U5Z4.1
#=GS I0DGC9_HBV/1-352     AC I0DGC9.1
#=GS B7TTE0_HBV/1-352     AC B7TTE0.1
#=GS H6UGC4_HBV/1-341     AC H6UGC4.1
#=GS C6F590_HBV/1-354     AC C6F590.1
#=GS E5RPP9_HBV/1-343     AC E5RPP9.1
#=GS F5C0Z9_HBV/1-354     AC F5C0Z9.1
#=GS C7DN75_HBV/1-351     AC C7DN75.1
#=GS B5BPK1_HBV/1-352     AC B5BPK1.1
#=GS F5C0X4_HBV/1-354     AC F5C0X4.1
#=GS O09505_HBV/206-310   AC O09505.1
#=GS B1PI53_9HEPA/51-416  AC B1PI53.1
#=GS Q6QZR0_9HEPA/1-367   AC Q6QZR0.1
#=GS B5B4A7_HBV/233-291   AC B5B4A7.1
#=GS D0E6E4_HBV/1-341     AC D0E6E4.1
#=GS G4XI86_HBV/1-54      AC G4XI86.1
#=GS D5LEJ6_HBV/1-352     AC D5LEJ6.1
#=GS B5M5S4_HBV/281-325   AC B5M5S4.1
#=GS Q2L4K0_HBV/1-351     AC Q2L4K0.1
#=GS E5CZ07_HBV/1-352     AC E5CZ07.1
#=GS G1C8L0_HBV/1-341     AC G1C8L0.1
#=GS F5C1B8_HBV/1-354     AC F5C1B8.1
#=GS DPOL_HBVA8/1-354     AC Q4R1S7.1
#=GS C7DSN9_HBV/1-341     AC C7DSN9.1
#=GS D0E629_HBV/1-352     AC D0E629.1
#=GS G9HNR0_HBV/2-159     AC G9HNR0.1
#=GS Q91GX2_HBV/1-352     AC Q91GX2.1
#=GS B5M4Y7_HBV/1-352     AC B5M4Y7.1
#=GS C7AYE3_HBV/1-354     AC C7AYE3.1
#=GS A4GUD9_HBV/85-121    AC A4GUD9.1
#=GS B0FCP4_HBV/1-352     AC B0FCP4.1
#=GS I0DD29_HBV/1-328     AC I0DD29.1
#=GS C5WK14_HBV/1-352     AC C5WK14.1
#=GS I0DC59_HBV/1-328     AC I0DC59.1
#=GS D0E5U5_HBV/1-352     AC D0E5U5.1
#=GS D5LE41_HBV/1-352     AC D5LE41.1
#=GS D5LFJ6_HBV/1-352     AC D5LFJ6.1
#=GS I0DGH8_HBV/1-352     AC I0DGH8.1
#=GS H6V5N2_HBV/1-341     AC H6V5N2.1
#=GS Q81107_HBV/1-352     AC Q81107.1
#=GS D0UDS4_HBV/1-352     AC D0UDS4.1
#=GS E9L2H7_HBV/1-171     AC E9L2H7.1
#=GS P88802_HBV/1-347     AC P88802.1
#=GS B5M5D6_HBV/1-352     AC B5M5D6.1
#=GS D3YG39_HBV/1-341     AC D3YG39.1
#=GS D5LF18_HBV/1-352     AC D5LF18.1
#=GS A5GZI4_HBV/1-352     AC A5GZI4.1
#=GS I0C942_HBV/1-354     AC I0C942.1
#=GS Q918N3_9HEPA/1-393   AC Q918N3.1
#=GS D3TII8_HBV/1-345     AC D3TII8.1
#=GS F5C0V2_HBV/1-354     AC F5C0V2.1
#=GS H9N883_HBV/1-341     AC H9N883.1
#=GS Q5KR39_HBV/1-352     AC Q5KR39.1
#=GS G3XGW6_HBV/1-343     AC G3XGW6.1
#=GS B5M543_HBV/1-342     AC B5M543.1
#=GS DPOL_HPBDB/1-367     AC P17192.1
#=GS B0FD97_HBV/1-346     AC B0FD97.1
#=GS D0EDT5_HBV/1-341     AC D0EDT5.1
#=GS B1ABK6_HBV/1-47      AC B1ABK6.1
#=GS O91580_HBV/1-352     AC O91580.1
#=GS F5C0V4_HBV/1-354     AC F5C0V4.1
#=GS Q1XHF8_HBV/1-341     AC Q1XHF8.1
#=GS G4XI09_HBV/1-160     AC G4XI09.1
#=GS D0EEL1_HBV/1-354     AC D0EEL1.1
#=GS I0DE36_HBV/1-328     AC I0DE36.1
#=GS B0FCI6_HBV/1-352     AC B0FCI6.1
#=GS B5L575_HBV/1-354     AC B5L575.1
#=GS B9VJY9_HBV/1-352     AC B9VJY9.1
#=GS H9XRH3_HBV/1-91      AC H9XRH3.1
#=GS D5LE87_HBV/1-352     AC D5LE87.1
#=GS B7TTB7_HBV/1-352     AC B7TTB7.1
#=GS I0C8L0_HBV/1-350     AC I0C8L0.1
#=GS D2JMH8_HBV/1-352     AC D2JMH8.1
#=GS Q7THS2_HBV/1-352     AC Q7THS2.1
#=GS F2WS72_HBV/1-352     AC F2WS72.1
#=GS C5WJZ8_HBV/1-352     AC C5WJZ8.1
#=GS F5C0H6_HBV/1-341     AC F5C0H6.1
#=GS H6V5Q6_HBV/1-350     AC H6V5Q6.1
#=GS C7DN29_HBV/1-351     AC C7DN29.1
#=GS O56654_HBV/1-337     AC O56654.1
#=GS D0EDR5_HBV/1-341     AC D0EDR5.1
#=GS E8Z617_HBV/1-352     AC E8Z617.1
#=GS DPOL_HBVB4/1-352     AC P17395.1
#=GS A5JI04_HBV/1-112     AC A5JI04.1
#=GS Q1JUR0_HBV/1-352     AC Q1JUR0.1
#=GS D5MSI9_HBV/1-343     AC D5MSI9.1
#=GS B2LWB8_HBV/1-337     AC B2LWB8.1
#=GS D3TIP9_HBV/1-352     AC D3TIP9.1
#=GS I0C8J8_HBV/1-350     AC I0C8J8.1
#=GS D5LBV0_HBV/1-352     AC D5LBV0.1
#=GS D5LCK1_HBV/1-352     AC D5LCK1.1
#=GS F5C0R8_HBV/1-351     AC F5C0R8.1
#=GS E5RPW9_HBV/1-343     AC E5RPW9.1
#=GS A0FDV5_HBV/1-342     AC A0FDV5.1
#=GS B7SXU7_HBV/1-352     AC B7SXU7.1
#=GS Q4KRB4_HBV/1-354     AC Q4KRB4.1
#=GS F5C137_HBV/1-354     AC F5C137.1
#=GS H6UNA8_HBV/1-341     AC H6UNA8.1
#=GS Q00K56_HBV/1-352     AC Q00K56.1
#=GS D0E5G5_HBV/1-352     AC D0E5G5.1
#=GS E5RPW1_HBV/1-343     AC E5RPW1.1
#=GS G4XMH5_HBV/1-352     AC G4XMH5.1
#=GS A6MGB4_HBV/1-352     AC A6MGB4.1
#=GS C6F5F3_HBV/1-354     AC C6F5F3.1
#=GS Q598S1_HBV/1-352     AC Q598S1.1
#=GS A5JJ36_HBV/1-73      AC A5JJ36.1
#=GS I0C8N2_HBV/1-335     AC I0C8N2.1
#=GS H6WFH0_HBV/1-112     AC H6WFH0.1
#=GS B3VLG9_HBV/1-175     AC B3VLG9.1
#=GS Q4AC34_HBV/1-352     AC Q4AC34.1
#=GS B5BPM9_HBV/1-352     AC B5BPM9.1
#=GS D0EEJ7_HBV/1-354     AC D0EEJ7.1
#=GS A5JIS4_HBV/1-112     AC A5JIS4.1
#=GS B0YGI6_HBV/1-354     AC B0YGI6.1
#=GS B5B4I9_HBV/1-347     AC B5B4I9.1
#=GS B9VKU7_HBV/1-352     AC B9VKU7.1
#=GS I0C979_HBV/1-351     AC I0C979.1
#=GS D3TJC3_HBV/205-305   AC D3TJC3.1
#=GS E5RPL5_HBV/1-352     AC E5RPL5.1
#=GS D0E5D3_HBV/1-352     AC D0E5D3.1
#=GS D7NKS9_HBV/1-341     AC D7NKS9.1
#=GS B5BPK9_HBV/1-352     AC B5BPK9.1
#=GS D0E5E0_HBV/1-352     AC D0E5E0.1
#=GS I0C925_HBV/1-354     AC I0C925.1
#=GS Q5DWM7_HBV/1-352     AC Q5DWM7.1
#=GS B8PTE5_HBV/1-341     AC B8PTE5.1
#=GS I0DGJ1_HBV/1-352     AC I0DGJ1.1
#=GS Q4FDC7_HBV/1-352     AC Q4FDC7.1
#=GS G3XLD8_HBV/1-352     AC G3XLD8.1
#=GS Q8B5R3_HBV/1-203     AC Q8B5R3.1
#=GS B5TXY1_HBV/1-352     AC B5TXY1.1
#=GS B5TF37_HBV/1-112     AC B5TF37.1
#=GS B3VLK5_HBV/1-176     AC B3VLK5.1
#=GS E5RD81_HBV/1-352     AC E5RD81.1
#=GS H6UG76_HBV/1-341     AC H6UG76.1
#=GS I0C8N4_HBV/1-341     AC I0C8N4.1
#=GS I0DGB2_HBV/1-352     AC I0DGB2.1
#=GS I0C9E8_HBV/1-352     AC I0C9E8.1
#=GS D9U548_HBV/1-352     AC D9U548.1
#=GS Q4FD95_HBV/1-352     AC Q4FD95.1
#=GS C9WDQ4_HBV/1-341     AC C9WDQ4.1
#=GS H9XRN6_HBV/1-91      AC H9XRN6.1
#=GS Q9YPV1_HBV/1-341     AC Q9YPV1.1
#=GS B9VKV5_HBV/1-352     AC B9VKV5.1
#=GS B1ABJ9_HBV/1-346     AC B1ABJ9.1
#=GS C1K180_HBV/1-352     AC C1K180.1
#=GS G3XH20_HBV/1-332     AC G3XH20.1
#=GS Q1XHG2_HBV/1-354     AC Q1XHG2.1
#=GS B4YLA0_HBV/1-341     AC B4YLA0.1
#=GS H1ZN37_HBV/1-341     AC H1ZN37.1
#=GS I0C862_HBV/1-354     AC I0C862.1
#=GS H2ERB7_HBV/1-352     AC H2ERB7.1
#=GS B5AT06_HBV/1-352     AC B5AT06.1
#=GS G4XMF9_HBV/1-352     AC G4XMF9.1
#=GS H9XRG5_HBV/1-91      AC H9XRG5.1
#=GS A5JHR2_HBV/1-112     AC A5JHR2.1
#=GS C7DM51_HBV/1-351     AC C7DM51.1
#=GS G4XI78_HBV/1-54      AC G4XI78.1
#=GS G9G8T0_HBV/1-335     AC G9G8T0.1
#=GS C1K1F3_HBV/1-352     AC C1K1F3.1
#=GS C7DMH1_HBV/1-351     AC C7DMH1.1
#=GS B7TUI3_HBV/1-343     AC B7TUI3.1
#=GS H9XRS9_HBV/1-91      AC H9XRS9.1
#=GS H6UG70_HBV/1-341     AC H6UG70.1
#=GS Q9IGW1_HBV/1-341     AC Q9IGW1.1
#=GS E9L2R5_HBV/1-171     AC E9L2R5.1
#=GS E5RPV5_HBV/1-343     AC E5RPV5.1
#=GS B3VLI4_HBV/1-175     AC B3VLI4.1
#=GS C9WDD8_HBV/1-341     AC C9WDD8.1
#=GS H2ERG2_HBV/268-313   AC H2ERG2.1
#=GS B5M5F6_HBV/1-352     AC B5M5F6.1
#=GS H6WFK6_HBV/1-112     AC H6WFK6.1
#=GS H9XQR3_HBV/1-91      AC H9XQR3.1
#=GS B1ABR0_HBV/231-290   AC B1ABR0.1
#=GS Q9YQ44_HBV/1-167     AC Q9YQ44.1
#=GS I0DCD2_HBV/1-328     AC I0DCD2.1
#=GS I0DGH2_HBV/1-352     AC I0DGH2.1
#=GS A8J4A7_HBV/1-352     AC A8J4A7.1
#=GS I0C9B5_HBV/1-334     AC I0C9B5.1
#=GS I0C955_HBV/1-354     AC I0C955.1
#=GS D9U5B2_HBV/1-352     AC D9U5B2.1
#=GS Q7T4U8_HBV/1-341     AC Q7T4U8.1
#=GS B2LSK4_HBV/1-352     AC B2LSK4.1
#=GS I0DGK0_HBV/1-352     AC I0DGK0.1
#=GS G4XI85_HBV/1-160     AC G4XI85.1
#=GS Q8B4C0_HBV/228-322   AC Q8B4C0.1
#=GS A5LGB0_HBV/1-352     AC A5LGB0.1
#=GS I0DCL1_HBV/1-317     AC I0DCL1.1
#=GS Q003Z7_HBV/1-352     AC Q003Z7.1
#=GS B2Y6U8_HBV/1-341     AC B2Y6U8.1
#=GS E5RPX1_HBV/1-343     AC E5RPX1.1
#=GS D0EE93_HBV/1-354     AC D0EE93.1
#=GS Q9QMH7_HBV/1-341     AC Q9QMH7.1
#=GS I0DGI4_HBV/2-172     AC I0DGI4.1
#=GS B5U731_HBV/1-341     AC B5U731.1
#=GS G1E7I5_HBV/1-272     AC G1E7I5.1
#=GS A5JI99_HBV/1-112     AC A5JI99.1
#=GS I0C9A7_HBV/1-341     AC I0C9A7.1
#=GS B1ABP5_HBV/1-352     AC B1ABP5.1
#=GS Q1XHD8_HBV/1-352     AC Q1XHD8.1
#=GS F5C1H3_HBV/1-341     AC F5C1H3.1
#=GS O91522_HBV/180-315   AC O91522.1
#=GS C3W3H8_HBV/1-124     AC C3W3H8.1
#=GS D3XGD6_HBV/1-352     AC D3XGD6.1
#=GS G9G9K8_HBV/1-341     AC G9G9K8.1
#=GS B3VLN1_HBV/1-175     AC B3VLN1.1
#=GS F5C175_HBV/1-354     AC F5C175.1
#=GS C5WJZ0_HBV/1-352     AC C5WJZ0.1
#=GS G3XGV6_HBV/1-352     AC G3XGV6.1
#=GS A5JHY4_HBV/1-112     AC A5JHY4.1
#=GS A5LG42_HBV/1-352     AC A5LG42.1
#=GS H6UGR6_HBV/1-341     AC H6UGR6.1
#=GS Q80GX5_HBV/243-278   AC Q80GX5.1
#=GS E5RPR5_HBV/1-343     AC E5RPR5.1
#=GS D6QW12_HBV/1-352     AC D6QW12.1
#=GS B5ATE6_HBV/268-305   AC B5ATE6.1
#=GS Q4W6E4_HBV/1-351     AC Q4W6E4.1
#=GS B6CEV9_HBV/1-352     AC B6CEV9.1
#=GS B1PI65_9HEPA/51-416  AC B1PI65.1
#=GS B7TTX5_HBV/1-352     AC B7TTX5.1
#=GS E1U7N5_HBV/1-341     AC E1U7N5.1
#=GS I0C8J7_HBV/1-350     AC I0C8J7.1
#=GS C7DMW0_HBV/1-351     AC C7DMW0.1
#=GS Q8B466_HBV/4-119     AC Q8B466.1
#=GS B5TXR1_HBV/1-352     AC B5TXR1.1
#=GS F5C171_HBV/1-354     AC F5C171.1
#=GS D5MSG5_HBV/1-343     AC D5MSG5.1
#=GS E5RPQ7_HBV/1-343     AC E5RPQ7.1
#=GS I0C8P1_HBV/1-341     AC I0C8P1.1
#=GS H6WFP0_HBV/1-112     AC H6WFP0.1
#=GS I0DDH4_HBV/1-328     AC I0DDH4.1
#=GS DPOL_HBVOR/1-341     AC Q9J5S2.1
#=GS E3Q0M8_HBV/1-352     AC E3Q0M8.1
#=GS D2JN10_HBV/160-220   AC D2JN10.1
#=GS C1K1A5_HBV/1-352     AC C1K1A5.1
#=GS G1E814_HBV/1-341     AC G1E814.1
#=GS D0EE79_HBV/1-354     AC D0EE79.1
#=GS H6WF74_HBV/1-112     AC H6WF74.1
#=GS E3Q0G9_HBV/1-352     AC E3Q0G9.1
#=GS C7AYA2_HBV/1-354     AC C7AYA2.1
#=GS O91549_HBV/1-352     AC O91549.1
#=GS H6WFC6_HBV/1-112     AC H6WFC6.1
#=GS G1C8Z2_HBV/1-336     AC G1C8Z2.1
#=GS I0DCC5_HBV/1-328     AC I0DCC5.1
#=GS Q9IX72_HBV/1-52      AC Q9IX72.1
#=GS Q6QZQ7_9HEPA/1-367   AC Q6QZQ7.1
#=GS I0DDX4_HBV/1-328     AC I0DDX4.1
#=GS Q4FDF1_HBV/1-352     AC Q4FDF1.1
#=GS B9VKY2_HBV/1-352     AC B9VKY2.1
#=GS Q91S89_HBV/1-341     AC Q91S89.1
#=GS H6WFI2_HBV/1-112     AC H6WFI2.1
#=GS D5LDL5_HBV/1-352     AC D5LDL5.1
#=GS H6WF90_HBV/1-112     AC H6WF90.1
#=GS D0E5B3_HBV/1-352     AC D0E5B3.1
#=GS D5LDH3_HBV/1-352     AC D5LDH3.1
#=GS C9WDP7_HBV/1-341     AC C9WDP7.1
#=GS D5LDI0_HBV/1-352     AC D5LDI0.1
#=GS Q2HXJ0_HBV/1-352     AC Q2HXJ0.1
#=GS D0E5M0_HBV/1-352     AC D0E5M0.1
#=GS C1K1Q7_HBV/1-352     AC C1K1Q7.1
#=GS B9VK31_HBV/1-352     AC B9VK31.1
#=GS Q402B4_HBV/1-352     AC Q402B4.1
#=GS F5C0K8_HBV/1-354     AC F5C0K8.1
#=GS C4RU84_HBV/1-341     AC C4RU84.1
#=GS B5B4H1_HBV/1-240     AC B5B4H1.1
#=GS G9G9P3_HBV/1-233     AC G9G9P3.1
#=GS Q6RSF7_9HEPA/1-367   AC Q6RSF7.1
#=GS G0YVP3_HBV/1-341     AC G0YVP3.1
#=GS Q2LCB6_HBV/1-341     AC Q2LCB6.1
#=GS D5LDA0_HBV/1-352     AC D5LDA0.1
#=GS H6WF54_HBV/1-112     AC H6WF54.1
#=GS G1C8C7_HBV/1-341     AC G1C8C7.1
#=GS A5GZL0_HBV/1-352     AC A5GZL0.1
#=GS D0E5Y7_HBV/1-352     AC D0E5Y7.1
#=GS G3XGV2_HBV/1-335     AC G3XGV2.1
#=GS B0FD24_HBV/1-346     AC B0FD24.1
#=GS Q80GX0_HBV/1-345     AC Q80GX0.1
#=GS C5WJX0_HBV/1-352     AC C5WJX0.1
#=GS I0DCQ8_HBV/1-328     AC I0DCQ8.1
#=GS G1E8E7_HBV/1-341     AC G1E8E7.1
#=GS G1E8Q9_HBV/1-341     AC G1E8Q9.1
#=GS D5LEW9_HBV/1-352     AC D5LEW9.1
#=GS D0VXK1_HBV/1-341     AC D0VXK1.1
#=GS B0FCT5_HBV/1-352     AC B0FCT5.1
#=GS B5BPX0_HBV/1-348     AC B5BPX0.1
#=GS H9XQZ5_HBV/1-91      AC H9XQZ5.1
#=GS I0DGK6_HBV/1-299     AC I0DGK6.1
#=GS A5JII3_HBV/1-112     AC A5JII3.1
#=GS B9VK15_HBV/1-352     AC B9VK15.1
#=GS I0DEA5_HBV/1-317     AC I0DEA5.1
#=GS D7NKN1_HBV/1-341     AC D7NKN1.1
#=GS C7DNM2_HBV/1-352     AC C7DNM2.1
#=GS I0DDR7_HBV/1-328     AC I0DDR7.1
#=GS Q9WP51_HBV/207-289   AC Q9WP51.1
#=GS D2JN03_HBV/1-352     AC D2JN03.1
#=GS D0E5W4_HBV/1-352     AC D0E5W4.1
#=GS I0CF24_HBV/1-280     AC I0CF24.1
#=GS B5M5C4_HBV/1-352     AC B5M5C4.1
#=GS D0EE01_HBV/1-354     AC D0EE01.1
#=GS D3YG89_HBV/1-341     AC D3YG89.1
#=GS D3TJE1_HBV/1-209     AC D3TJE1.1
#=GS G9G9G0_HBV/1-340     AC G9G9G0.1
#=GS I0C8W9_HBV/1-354     AC I0C8W9.1
#=GS Q4FD91_HBV/1-352     AC Q4FD91.1
#=GS A5HKQ7_HBV/1-352     AC A5HKQ7.1
#=GS Q6JWV7_HBV/1-352     AC Q6JWV7.1
#=GS G1E7F2_HBV/1-341     AC G1E7F2.1
#=GS Q9IX90_HBV/1-52      AC Q9IX90.1
#=GS E9L2P9_HBV/1-171     AC E9L2P9.1
#=GS Q2LCE0_HBV/1-333     AC Q2LCE0.1
#=GS I0C8H9_HBV/1-335     AC I0C8H9.1
#=GS B5AT57_HBV/1-352     AC B5AT57.1
#=GS C7DND6_HBV/1-350     AC C7DND6.1
#=GS I0DDU1_HBV/1-317     AC I0DDU1.1
#=GS G4XMJ5_HBV/1-352     AC G4XMJ5.1
#=GS I0DGD3_HBV/1-352     AC I0DGD3.1
#=GS Q68RP8_HBV/1-352     AC Q68RP8.1
#=GS B3VLF4_HBV/1-176     AC B3VLF4.1
#=GS H9XQH8_HBV/1-91      AC H9XQH8.1
#=GS B4YKW9_HBV/1-341     AC B4YKW9.1
#=GS B5M5C7_HBV/1-352     AC B5M5C7.1
#=GS F5C0S7_HBV/1-333     AC F5C0S7.1
#=GS E9L5F6_HBV/1-352     AC E9L5F6.1
#=GS G4XMC7_HBV/1-341     AC G4XMC7.1
#=GS D5LEZ7_HBV/1-352     AC D5LEZ7.1
#=GS Q00K52_HBV/1-352     AC Q00K52.1
#=GS H6V5M8_HBV/1-341     AC H6V5M8.1
#=GS E9L2L0_HBV/1-171     AC E9L2L0.1
#=GS Q992I7_HBV/1-352     AC Q992I7.1
#=GS I0DCE7_HBV/1-328     AC I0DCE7.1
#=GS C6F597_HBV/1-354     AC C6F597.1
#=GS Q2EIF5_HBV/1-346     AC Q2EIF5.1
#=GS I0C857_HBV/1-354     AC I0C857.1
#=GS D3TIF6_HBV/1-285     AC D3TIF6.1
#=GS D5LFD3_HBV/1-352     AC D5LFD3.1
#=GS D0E5J0_HBV/1-352     AC D0E5J0.1
#=GS G3E5H1_HBV/1-341     AC G3E5H1.1
#=GS D0E578_HBV/1-352     AC D0E578.1
#=GS D0UEB0_HBV/1-352     AC D0UEB0.1
#=GS B5BPG9_HBV/1-352     AC B5BPG9.1
#=GS B5ASW6_HBV/1-352     AC B5ASW6.1
#=GS F5C181_HBV/1-354     AC F5C181.1
#=GS Q89244_9HEPA/1-94    AC Q89244.1
#=GS D0E5L3_HBV/1-352     AC D0E5L3.1
#=GS H9XRQ2_HBV/1-91      AC H9XRQ2.1
#=GS Q9QAE8_HBV/1-352     AC Q9QAE8.1
#=GS F5C0U5_HBV/1-351     AC F5C0U5.1
#=GS G1C8V0_HBV/1-341     AC G1C8V0.1
#=GS D5LBG5_HBV/1-352     AC D5LBG5.1
#=GS E0ZS03_HBV/1-351     AC E0ZS03.1
#=GS B2CFG3_HBV/272-304   AC B2CFG3.1
#=GS E5F0Y2_HBV/1-49      AC E5F0Y2.1
#=GS F5C127_HBV/1-354     AC F5C127.1
#=GS A5JI36_HBV/1-101     AC A5JI36.1
#=GS Q7THQ4_HBV/1-346     AC Q7THQ4.1
#=GS G1C8Z9_HBV/1-341     AC G1C8Z9.1
#=GS D9U5P6_HBV/1-71      AC D9U5P6.1
#=GS D6QVM1_HBV/1-352     AC D6QVM1.1
#=GS B5TXV4_HBV/1-352     AC B5TXV4.1
#=GS A5JI91_HBV/1-112     AC A5JI91.1
#=GS I0C8L7_HBV/1-335     AC I0C8L7.1
#=GS Q8JMZ0_HBV/1-352     AC Q8JMZ0.1
#=GS G3XLF1_HBV/1-352     AC G3XLF1.1
#=GS C7DY82_HBV/1-347     AC C7DY82.1
#=GS E7CU09_HBV/1-352     AC E7CU09.1
#=GS D7NL68_HBV/1-341     AC D7NL68.1
#=GS O91584_HBV/1-352     AC O91584.1
#=GS B9VK74_HBV/1-352     AC B9VK74.1
#=GS D0E5Y3_HBV/1-352     AC D0E5Y3.1
#=GS I0C8Q5_HBV/1-341     AC I0C8Q5.1
#=GS F5C0H3_HBV/1-341     AC F5C0H3.1
#=GS H1ACW0_HBV/1-352     AC H1ACW0.1
#=GS B1ABM2_HBV/233-291   AC B1ABM2.1
#=GS G9G917_HBV/1-341     AC G9G917.1
#=GS H2ER77_HBV/1-352     AC H2ER77.1
#=GS F1AEX9_HBV/1-341     AC F1AEX9.1
#=GS B3VLH2_HBV/1-176     AC B3VLH2.1
#=GS H9XRA2_HBV/1-91      AC H9XRA2.1
#=GS B1A0C5_HBV/1-354     AC B1A0C5.1
#=GS B7TUP3_HBV/1-352     AC B7TUP3.1
#=GS Q81137_HBV/1-352     AC Q81137.1
#=GS Q00K84_HBV/1-352     AC Q00K84.1
#=GS E9L2M7_HBV/1-171     AC E9L2M7.1
#=GS H9XQU1_HBV/1-91      AC H9XQU1.1
#=GS D7NKK7_HBV/1-341     AC D7NKK7.1
#=GS F5C112_HBV/1-352     AC F5C112.1
#=GS F5C0L3_HBV/1-354     AC F5C0L3.1
#=GS B5BPX8_HBV/1-352     AC B5BPX8.1
#=GS I0DD72_HBV/1-328     AC I0DD72.1
#=GS E9L2E5_HBV/1-171     AC E9L2E5.1
#=GS D5LBW4_HBV/1-352     AC D5LBW4.1
#=GS I0DGD1_HBV/1-352     AC I0DGD1.1
#=GS Q9WP68_HBV/301-333   AC Q9WP68.1
#=GS F5C170_HBV/1-354     AC F5C170.1
#=GS B9VK11_HBV/1-352     AC B9VK11.1
#=GS H3K3D0_HBV/1-354     AC H3K3D0.1
#=GS I0C8M0_HBV/1-335     AC I0C8M0.1
#=GS B0YGL1_HBV/1-341     AC B0YGL1.1
#=GS D3TIG8_HBV/1-352     AC D3TIG8.1
#=GS D2U610_HBV/1-351     AC D2U610.1
#=GS G4XML1_HBV/1-352     AC G4XML1.1
#=GS Q20BU1_HBV/1-42      AC Q20BU1.1
#=GS I0C9H9_HBV/1-255     AC I0C9H9.1
#=GS D5LCF2_HBV/1-352     AC D5LCF2.1
#=GS Q7TDR5_HBV/1-352     AC Q7TDR5.1
#=GS D0UE35_HBV/1-352     AC D0UE35.1
#=GS E3Q0F5_HBV/1-352     AC E3Q0F5.1
#=GS I0DGF2_HBV/1-352     AC I0DGF2.1
#=GS Q2EX70_HBV/1-342     AC Q2EX70.1
#=GS A4F509_HBV/1-354     AC A4F509.1
#=GS B0YGI2_HBV/1-341     AC B0YGI2.1
#=GS A5JIH5_HBV/1-112     AC A5JIH5.1
#=GS A4F535_HBV/30-360    AC A4F535.1
#=GS F5C1B7_HBV/1-354     AC F5C1B7.1
#=GS Q9YV47_HBV/1-352     AC Q9YV47.1
#=GS G3E594_HBV/1-341     AC G3E594.1
#=GS E0ZRV8_HBV/1-351     AC E0ZRV8.1
#=GS H1ZN31_HBV/1-341     AC H1ZN31.1
#=GS I0DCU4_HBV/1-328     AC I0DCU4.1
#=GS Q2F4X8_HBV/1-353     AC Q2F4X8.1
#=GS D5MSI5_HBV/1-343     AC D5MSI5.1
#=GS I0C886_HBV/1-354     AC I0C886.1
#=GS H6UN25_HBV/1-341     AC H6UN25.1
#=GS H6UNB2_HBV/1-341     AC H6UNB2.1
#=GS B4ZZ04_HBV/1-341     AC B4ZZ04.1
#=GS DPOL_DHBVQ/1-367     AC Q66403.1
#=GS H2ERI0_HBV/1-352     AC H2ERI0.1
#=GS C7DNB5_HBV/1-351     AC C7DNB5.1
#=GS I0DD80_HBV/1-328     AC I0DD80.1
#=GS A5LG98_HBV/1-352     AC A5LG98.1
#=GS Q913B1_HBV/1-352     AC Q913B1.1
#=GS Q5EDT1_HBV/1-341     AC Q5EDT1.1
#=GS Q8B4E2_HBV/1-354     AC Q8B4E2.1
#=GS D3YGN4_HBV/1-341     AC D3YGN4.1
#=GS G3E5F7_HBV/1-341     AC G3E5F7.1
#=GS H6WF42_HBV/1-112     AC H6WF42.1
#=GS Q6XGU0_HBV/1-354     AC Q6XGU0.1
#=GS Q91HD7_HBV/1-354     AC Q91HD7.1
#=GS I0DGH6_HBV/1-352     AC I0DGH6.1
#=GS I0C8C6_HBV/1-354     AC I0C8C6.1
#=GS B5M637_HBV/1-352     AC B5M637.1
#=GS Q6X5G7_HBV/28-84     AC Q6X5G7.1
#=GS H2ERD8_HBV/1-352     AC H2ERD8.1
#=GS Q19SY5_HBV/1-341     AC Q19SY5.1
#=GS I0DCR2_HBV/1-317     AC I0DCR2.1
#=GS A8J490_HBV/1-352     AC A8J490.1
#=GS B3VLI7_HBV/1-176     AC B3VLI7.1
#=GS H9XRC6_HBV/1-91      AC H9XRC6.1
#=GS B4ZYV6_HBV/1-341     AC B4ZYV6.1
#=GS H6UNB6_HBV/1-341     AC H6UNB6.1
#=GS E5CZ70_HBV/1-352     AC E5CZ70.1
#=GS G9G963_HBV/1-341     AC G9G963.1
#=GS Q80J72_HBV/1-352     AC Q80J72.1
#=GS Q2VAD3_9HEPA/1-368   AC Q2VAD3.1
#=GS C7AYU7_HBV/1-354     AC C7AYU7.1
#=GS I0DGG0_HBV/1-352     AC I0DGG0.1
#=GS H3K3N4_HBV/1-352     AC H3K3N4.1
#=GS B0FCC9_HBV/1-352     AC B0FCC9.1
#=GS B5TY02_HBV/1-352     AC B5TY02.1
#=GS F5C0I1_HBV/1-341     AC F5C0I1.1
#=GS A5JHW4_HBV/1-112     AC A5JHW4.1
#=GS B5BPR9_HBV/1-352     AC B5BPR9.1
#=GS A5JIB9_HBV/1-112     AC A5JIB9.1
#=GS I0DGF9_HBV/1-352     AC I0DGF9.1
#=GS I0C881_HBV/1-354     AC I0C881.1
#=GS G1E7J1_HBV/1-341     AC G1E7J1.1
#=GS D2X3V8_HBV/96-130    AC D2X3V8.1
#=GS I0C8F9_HBV/1-354     AC I0C8F9.1
#=GS I0DG92_HBV/1-352     AC I0DG92.1
#=GS G3E587_HBV/1-341     AC G3E587.1
#=GS D0E625_HBV/1-352     AC D0E625.1
#=GS B9VK39_HBV/1-352     AC B9VK39.1
#=GS D0E6B8_HBV/1-352     AC D0E6B8.1
#=GS Q80GW5_HBV/281-365   AC Q80GW5.1
#=GS Q7T4V7_HBV/1-341     AC Q7T4V7.1
#=GS D7NL15_HBV/1-341     AC D7NL15.1
#=GS D2JMT7_HBV/1-352     AC D2JMT7.1
#=GS D3YGA7_HBV/1-341     AC D3YGA7.1
#=GS Q80H00_HBV/1-352     AC Q80H00.1
#=GS G4XI07_HBV/1-160     AC G4XI07.1
#=GS B5B4I2_HBV/1-240     AC B5B4I2.1
#=GS G4XMI3_HBV/1-352     AC G4XMI3.1
#=GS B7TVA0_HBV/1-352     AC B7TVA0.1
#=GS B5M5W4_HBV/234-291   AC B5M5W4.1
#=GS B5ATA9_HBV/1-346     AC B5ATA9.1
#=GS C3W439_HBV/1-341     AC C3W439.1
#=GS A4F2U8_HBV/1-352     AC A4F2U8.1
#=GS I0C8H3_HBV/1-354     AC I0C8H3.1
#=GS Q9YL91_HBV/1-352     AC Q9YL91.1
#=GS F5C166_HBV/1-354     AC F5C166.1
#=GS F5C0I5_HBV/1-341     AC F5C0I5.1
#=GS B3VLG0_HBV/1-176     AC B3VLG0.1
#=GS B5U710_HBV/1-341     AC B5U710.1
#=GS B5TF73_HBV/1-112     AC B5TF73.1
#=GS B5B4B4_HBV/1-240     AC B5B4B4.1
#=GS C3W4G2_HBV/1-341     AC C3W4G2.1
#=GS D5LDP8_HBV/1-352     AC D5LDP8.1
#=GS E5RPX7_HBV/1-343     AC E5RPX7.1
#=GS A5LGC2_HBV/1-352     AC A5LGC2.1
#=GS C1K163_HBV/1-352     AC C1K163.1
#=GS Q4FDJ8_HBV/1-352     AC Q4FDJ8.1
#=GS C3W4B2_HBV/1-341     AC C3W4B2.1
#=GS D3TKB0_HBV/1-352     AC D3TKB0.1
#=GS Q81112_HBV/1-49      AC Q81112.1
#=GS D5MSI3_HBV/1-343     AC D5MSI3.1
#=GS B9VK98_HBV/1-352     AC B9VK98.1
#=GS I0DD09_HBV/1-317     AC I0DD09.1
#=GS E9L2T0_HBV/1-171     AC E9L2T0.1
#=GS Q80BT5_HBV/1-303     AC Q80BT5.1
#=GS D5LEY3_HBV/1-352     AC D5LEY3.1
#=GS B7TTV0_HBV/1-352     AC B7TTV0.1
#=GS G1E7Q2_HBV/1-341     AC G1E7Q2.1
#=GS D3TIP3_HBV/1-349     AC D3TIP3.1
#=GS Q9E6U2_HBV/1-352     AC Q9E6U2.1
#=GS Q58VZ7_HBV/1-352     AC Q58VZ7.1
#=GS C7DMK6_HBV/1-351     AC C7DMK6.1
#=GS F5C151_HBV/1-53      AC F5C151.1
#=GS O91516_HBV/1-352     AC O91516.1
#=GS D3YGL6_HBV/1-341     AC D3YGL6.1
#=GS Q4FDG3_HBV/1-352     AC Q4FDG3.1
#=GS A8R7F6_HBV/1-352     AC A8R7F6.1
#=GS H3K3I6_HBV/1-354     AC H3K3I6.1
#=GS C6F4E1_HBV/1-354     AC C6F4E1.1
#=GS C7DMQ1_HBV/1-303     AC C7DMQ1.1
#=GS G9G943_HBV/253-304   AC G9G943.1
#=GS B5B4N7_HBV/1-352     AC B5B4N7.1
#=GS C1K1H0_HBV/1-352     AC C1K1H0.1
#=GS C7DN36_HBV/1-351     AC C7DN36.1
#=GS Q20BS9_HBV/1-52      AC Q20BS9.1
#=GS F1CFB6_HBV/1-341     AC F1CFB6.1
#=GS B5M5S4_HBV/1-288     AC B5M5S4.1
#=GS C1K1L5_HBV/274-323   AC C1K1L5.1
#=GS D2X580_HBV/5-172     AC D2X580.1
#=GS H9XRF0_HBV/1-91      AC H9XRF0.1
#=GS A5JIA3_HBV/1-112     AC A5JIA3.1
#=GS I0C8C7_HBV/1-354     AC I0C8C7.1
#=GS B5M5W8_HBV/1-352     AC B5M5W8.1
#=GS Q2LCD2_HBV/1-333     AC Q2LCD2.1
#=GS I0DC55_HBV/1-317     AC I0DC55.1
#=GS I0C8T1_HBV/1-341     AC I0C8T1.1
#=GS H9XQQ2_HBV/1-91      AC H9XQQ2.1
#=GS B7TTJ4_HBV/1-352     AC B7TTJ4.1
#=GS H9XR94_HBV/1-91      AC H9XR94.1
#=GS C1K1L0_HBV/1-239     AC C1K1L0.1
#=GS B9VK63_HBV/1-352     AC B9VK63.1
#=GS D0EE40_HBV/1-354     AC D0EE40.1
#=GS D2JMK1_HBV/1-352     AC D2JMK1.1
#=GS D3TK17_HBV/1-352     AC D3TK17.1
#=GS D0UE63_HBV/1-341     AC D0UE63.1
#=GS C3W4F0_HBV/1-341     AC C3W4F0.1
#=GS A8J498_HBV/1-352     AC A8J498.1
#=GS I0C951_HBV/1-354     AC I0C951.1
#=GS Q918J2_HBV/1-343     AC Q918J2.1
#=GS D0UE31_HBV/1-352     AC D0UE31.1
#=GS A5GZK7_HBV/1-352     AC A5GZK7.1
#=GS Q2LCC0_HBV/1-341     AC Q2LCC0.1
#=GS B7TU63_HBV/1-352     AC B7TU63.1
#=GS D6QVR7_HBV/1-352     AC D6QVR7.1
#=GS Q2EX74_HBV/1-345     AC Q2EX74.1
#=GS I0C988_HBV/1-351     AC I0C988.1
#=GS C3W4J4_HBV/1-341     AC C3W4J4.1
#=GS H6UGQ6_HBV/1-341     AC H6UGQ6.1
#=GS B4Y4H7_HBV/1-352     AC B4Y4H7.1
#=GS D9U5L4_HBV/1-352     AC D9U5L4.1
#=GS C7DMT2_HBV/1-351     AC C7DMT2.1
#=GS E9L2Q5_HBV/1-171     AC E9L2Q5.1
#=GS E5F0V6_HBV/1-49      AC E5F0V6.1
#=GS D0E6C5_HBV/1-352     AC D0E6C5.1
#=GS B0YGK6_HBV/1-341     AC B0YGK6.1
#=GS Q80J92_HBV/1-352     AC Q80J92.1
#=GS Q9WFA8_9HEPA/1-365   AC Q9WFA8.1
#=GS D5LFI5_HBV/1-352     AC D5LFI5.1
#=GS G3XGZ8_HBV/1-343     AC G3XGZ8.1
#=GS G9G8J8_HBV/1-341     AC G9G8J8.1
#=GS I0C8E9_HBV/1-354     AC I0C8E9.1
#=GS B5BPP9_HBV/1-352     AC B5BPP9.1
#=GS Q5KR27_HBV/1-352     AC Q5KR27.1
#=GS I0DD83_HBV/1-328     AC I0DD83.1
#=GS I0C922_HBV/1-354     AC I0C922.1
#=GS F5C1E1_HBV/1-341     AC F5C1E1.1
#=GS Q9IXD2_HBV/1-52      AC Q9IXD2.1
#=GS B7TU76_HBV/1-352     AC B7TU76.1
#=GS B0FD46_HBV/1-352     AC B0FD46.1
#=GS D2U622_HBV/1-346     AC D2U622.1
#=GS C7DNC4_HBV/1-348     AC C7DNC4.1
#=GS B7TUG9_HBV/1-334     AC B7TUG9.1
#=GS H6UGP4_HBV/1-341     AC H6UGP4.1
#=GS H6UN52_HBV/1-341     AC H6UN52.1
#=GS F5C0R3_HBV/1-351     AC F5C0R3.1
#=GS A1YTM2_HBV/1-352     AC A1YTM2.1
#=GS I0DDW1_HBV/1-193     AC I0DDW1.1
#=GS Q68RR3_HBV/1-352     AC Q68RR3.1
#=GS F5C7K4_HBV/1-352     AC F5C7K4.1
#=GS A3F6H7_HBV/1-354     AC A3F6H7.1
#=GS B9VL68_HBV/1-341     AC B9VL68.1
#=GS D0E5B7_HBV/1-352     AC D0E5B7.1
#=GS B9W411_HBV/1-354     AC B9W411.1
#=GS G4XI53_HBV/1-160     AC G4XI53.1
#=GS B0FCW3_HBV/1-352     AC B0FCW3.1
#=GS I0C9E1_HBV/1-334     AC I0C9E1.1
#=GS B5BPT5_HBV/1-352     AC B5BPT5.1
#=GS B5AST1_HBV/1-352     AC B5AST1.1
#=GS A5JHT2_HBV/1-112     AC A5JHT2.1
#=GS G9HNR2_HBV/2-159     AC G9HNR2.1
#=GS E9L5B4_HBV/1-352     AC E9L5B4.1
#=GS B9VL41_HBV/1-243     AC B9VL41.1
#=GS G4XHZ2_HBV/1-160     AC G4XHZ2.1
#=GS Q45V29_HBV/1-341     AC Q45V29.1
#=GS B5TY08_HBV/1-352     AC B5TY08.1
#=GS C7DN04_HBV/1-351     AC C7DN04.1
#=GS I0C8P2_HBV/1-231     AC I0C8P2.1
#=GS F5C1P9_HBV/1-341     AC F5C1P9.1
#=GS F5C167_HBV/1-354     AC F5C167.1
#=GS F5C0H7_HBV/1-341     AC F5C0H7.1
#=GS B6VA73_HBV/1-352     AC B6VA73.1
#=GS C7AY84_HBV/1-354     AC C7AY84.1
#=GS I0C946_HBV/1-354     AC I0C946.1
#=GS D0E6I4_HBV/1-352     AC D0E6I4.1
#=GS Q77BH2_HBV/1-167     AC Q77BH2.1
#=GS I0C9H0_HBV/1-352     AC I0C9H0.1
#=GS G8DC36_HBV/1-352     AC G8DC36.1
#=GS F5C163_HBV/1-75      AC F5C163.1
#=GS D2U662_HBV/1-351     AC D2U662.1
#=GS G1C8G9_HBV/1-341     AC G1C8G9.1
#=GS F5C0S2_HBV/1-333     AC F5C0S2.1
#=GS Q4FDD5_HBV/1-352     AC Q4FDD5.1
#=GS E7FK73_HBV/1-352     AC E7FK73.1
#=GS D3K2D2_HBV/1-352     AC D3K2D2.1
#=GS H9XRM8_HBV/1-91      AC H9XRM8.1
#=GS Q4FDK2_HBV/1-352     AC Q4FDK2.1
#=GS B5M528_HBV/1-343     AC B5M528.1
#=GS D3TIF6_HBV/280-319   AC D3TIF6.1
#=GS Q7T7W6_HBV/1-343     AC Q7T7W6.1
#=GS D3TII1_HBV/1-352     AC D3TII1.1
#=GS Q8V0M9_HBV/1-352     AC Q8V0M9.1
#=GS B5TFK1_HBV/1-112     AC B5TFK1.1
#=GS I0DE48_HBV/1-328     AC I0DE48.1
#=GS B0FCE0_HBV/1-352     AC B0FCE0.1
#=GS I0C882_HBV/1-354     AC I0C882.1
#=GS Q00K48_HBV/1-352     AC Q00K48.1
#=GS Q7TDR3_HBV/1-352     AC Q7TDR3.1
#=GS D0E621_HBV/1-352     AC D0E621.1
#=GS O09517_HBV/1-212     AC O09517.1
#=GS D0E5G9_HBV/1-352     AC D0E5G9.1
#=GS H9XQS1_HBV/1-91      AC H9XQS1.1
#=GS A5JIH9_HBV/1-112     AC A5JIH9.1
#=GS I0DD76_HBV/1-328     AC I0DD76.1
#=GS I0CF26_HBV/2-268     AC I0CF26.1
#=GS I0C943_HBV/1-354     AC I0C943.1
#=GS I0DDW6_HBV/1-328     AC I0DDW6.1
#=GS I0DGG1_HBV/1-352     AC I0DGG1.1
#=GS I0DGF3_HBV/1-352     AC I0DGF3.1
#=GS I0C8U0_HBV/1-354     AC I0C8U0.1
#=GS H9XRS2_HBV/1-91      AC H9XRS2.1
#=GS A5JI21_HBV/1-112     AC A5JI21.1
#=GS Q8JXA7_HBV/1-352     AC Q8JXA7.1
#=GS I0DD86_HBV/1-328     AC I0DD86.1
#=GS B4YL04_HBV/1-341     AC B4YL04.1
#=GS Q5KR11_HBV/1-352     AC Q5KR11.1
#=GS O91547_HBV/1-352     AC O91547.1
#=GS B5BPW7_HBV/1-339     AC B5BPW7.1
#=GS D0UDW4_HBV/1-352     AC D0UDW4.1
#=GS Q2LCE4_HBV/1-333     AC Q2LCE4.1
#=GS Q97975_HBV/1-49      AC Q97975.1
#=GS C5WJU2_HBV/1-352     AC C5WJU2.1
#=GS D0E5M8_HBV/1-352     AC D0E5M8.1
#=GS D0UE87_HBV/1-352     AC D0UE87.1
#=GS F5C195_HBV/1-354     AC F5C195.1
#=GS E5RPU3_HBV/1-343     AC E5RPU3.1
#=GS C7DSJ2_HBV/1-341     AC C7DSJ2.1
#=GS I0DCT2_HBV/1-327     AC I0DCT2.1
#=GS Q50JU5_HBV/1-352     AC Q50JU5.1
#=GS G4XI03_HBV/1-160     AC G4XI03.1
#=GS Q461B6_HBV/1-351     AC Q461B6.1
#=GS I0C8D5_HBV/1-354     AC I0C8D5.1
#=GS B5M634_HBV/1-352     AC B5M634.1
#=GS G4XI69_HBV/1-160     AC G4XI69.1
#=GS F5C157_HBV/1-354     AC F5C157.1
#=GS B2LRV6_HBV/1-352     AC B2LRV6.1
#=GS A5LG46_HBV/1-352     AC A5LG46.1
#=GS B5AT25_HBV/1-352     AC B5AT25.1
#=GS D9U553_HBV/1-352     AC D9U553.1
#=GS G0YVM3_HBV/234-287   AC G0YVM3.1
#=GS Q8V1H4_HBV/1-275     AC Q8V1H4.1
#=GS F5C0J4_HBV/1-341     AC F5C0J4.1
#=GS Q20BT7_HBV/1-57      AC Q20BT7.1
#=GS C6F507_HBV/1-354     AC C6F507.1
#=GS G9G9B8_HBV/1-341     AC G9G9B8.1
#=GS B7TUS4_HBV/1-352     AC B7TUS4.1
#=GS F5C0I4_HBV/1-341     AC F5C0I4.1
#=GS A7J8K4_HBV/1-336     AC A7J8K4.1
#=GS G1C8J7_HBV/1-341     AC G1C8J7.1
#=GS F5C176_HBV/1-354     AC F5C176.1
#=GS H3K3M1_HBV/1-352     AC H3K3M1.1
#=GS D4QGJ3_HBV/1-355     AC D4QGJ3.1
#=GS Q2LCD6_HBV/1-333     AC Q2LCD6.1
#=GS Q5R2R9_HBV/1-341     AC Q5R2R9.1
#=GS B0FCY4_HBV/1-352     AC B0FCY4.1
#=GS D0EEA0_HBV/1-354     AC D0EEA0.1
#=GS D5LED3_HBV/1-352     AC D5LED3.1
#=GS I0DC62_HBV/1-328     AC I0DC62.1
#=GS B5TFA1_HBV/1-112     AC B5TFA1.1
#=GS B5M5I3_HBV/1-352     AC B5M5I3.1
#=GS B3VLH8_HBV/1-176     AC B3VLH8.1
#=GS D2N0Z2_HBV/1-354     AC D2N0Z2.1
#=GS D5LEV5_HBV/1-352     AC D5LEV5.1
#=GS Q91EI6_HBV/1-354     AC Q91EI6.1
#=GS A5GZJ4_HBV/1-352     AC A5GZJ4.1
#=GS Q9YL94_HBV/1-352     AC Q9YL94.1
#=GS Q6W5D0_HBV/1-352     AC Q6W5D0.1
#=GS B5MEW1_HBV/1-337     AC B5MEW1.1
#=GS B5M5C1_HBV/1-352     AC B5M5C1.1
#=GS H6WFJ7_HBV/1-112     AC H6WFJ7.1
#=GS C9WDG7_HBV/1-341     AC C9WDG7.1
#=GS B5BUS5_HBV/1-354     AC B5BUS5.1
#=GS Q8QZP4_HBV/1-268     AC Q8QZP4.1
#=GS Q20BZ4_HBV/1-55      AC Q20BZ4.1
#=GS Q4KRC8_HBV/1-354     AC Q4KRC8.1
#=GS I0DCS4_HBV/9-329     AC I0DCS4.1
#=GS B0YGH8_HBV/1-341     AC B0YGH8.1
#=GS D7NL02_HBV/1-341     AC D7NL02.1
#=GS B9VL13_HBV/1-352     AC B9VL13.1
#=GS B5U703_HBV/1-341     AC B5U703.1
#=GS B9VJZ3_HBV/1-352     AC B9VJZ3.1
#=GS F5C0M0_HBV/1-354     AC F5C0M0.1
#=GS E5RPN5_HBV/1-341     AC E5RPN5.1
#=GS I0C8D8_HBV/1-354     AC I0C8D8.1
#=GS Q9QN54_HBV/1-352     AC Q9QN54.1
#=GS Q20BZ0_HBV/1-47      AC Q20BZ0.1
#=GS E5CZ21_HBV/1-352     AC E5CZ21.1
#=GS B9VKF2_HBV/1-352     AC B9VKF2.1
#=GS B9W403_HBV/1-354     AC B9W403.1
#=GS Q8V1F0_HBV/1-354     AC Q8V1F0.1
#=GS Q5EDN8_HBV/1-341     AC Q5EDN8.1
#=GS B5ASN2_HBV/1-352     AC B5ASN2.1
#=GS I0C8R4_HBV/1-231     AC I0C8R4.1
#=GS A7M684_HBV/1-352     AC A7M684.1
#=GS H6WFJ8_HBV/1-112     AC H6WFJ8.1
#=GS D5LE20_HBV/1-352     AC D5LE20.1
#=GS Q7T7X9_HBV/1-341     AC Q7T7X9.1
#=GS B9VKL1_HBV/1-352     AC B9VKL1.1
#=GS Q6XGI5_HBV/1-341     AC Q6XGI5.1
#=GS I0DGE4_HBV/1-352     AC I0DGE4.1
#=GS B7TTU3_HBV/1-352     AC B7TTU3.1
#=GS B5M4Z0_HBV/1-352     AC B5M4Z0.1
#=GS H2ERA3_HBV/1-342     AC H2ERA3.1
#=GS I0DGF8_HBV/1-352     AC I0DGF8.1
#=GS F5C117_HBV/1-285     AC F5C117.1
#=GS B3V8U9_HBV/1-346     AC B3V8U9.1
#=GS D0EEF8_HBV/1-354     AC D0EEF8.1
#=GS E3Q0K7_HBV/1-352     AC E3Q0K7.1
#=GS H3K3R9_HBV/1-354     AC H3K3R9.1
#=GS G3E5C2_HBV/1-341     AC G3E5C2.1
#=GS A6MFX3_HBV/1-352     AC A6MFX3.1
#=GS H6V5R8_HBV/1-352     AC H6V5R8.1
#=GS D3YG95_HBV/1-341     AC D3YG95.1
#=GS E1U7N9_HBV/1-341     AC E1U7N9.1
#=GS G4XMQ1_HBV/1-352     AC G4XMQ1.1
#=GS DPOL_HBVC1/1-352     AC P0C688.1
#=GS B5B4H1_HBV/234-291   AC B5B4H1.1
#=GS G9G9L5_HBV/1-341     AC G9G9L5.1
#=GS A5JHV6_HBV/1-112     AC A5JHV6.1
#=GS D9U5J4_HBV/1-352     AC D9U5J4.1
#=GS D7NL22_HBV/1-341     AC D7NL22.1
#=GS Q68RS2_HBV/1-352     AC Q68RS2.1
#=GS B9VL48_HBV/1-352     AC B9VL48.1
#=GS D3YG33_HBV/1-341     AC D3YG33.1
#=GS B5TXW0_HBV/1-352     AC B5TXW0.1
#=GS D7NKZ5_HBV/1-341     AC D7NKZ5.1
#=GS E5F0Y5_HBV/1-49      AC E5F0Y5.1
#=GS F5C123_HBV/1-354     AC F5C123.1
#=GS Q4FDH1_HBV/1-352     AC Q4FDH1.1
#=GS B5TZH4_HBV/1-57      AC B5TZH4.1
#=GS H6WF82_HBV/1-112     AC H6WF82.1
#=GS A5JIQ4_HBV/1-112     AC A5JIQ4.1
#=GS G1E807_HBV/1-341     AC G1E807.1
#=GS I0C8K4_HBV/1-350     AC I0C8K4.1
#=GS B0FCA2_HBV/1-286     AC B0FCA2.1
#=GS Q4FD87_HBV/1-352     AC Q4FD87.1
#=GS DPOL_HBVD1/1-341     AC P03155.1
#=GS B3V8V4_HBV/1-341     AC B3V8V4.1
#=GS D6QVE8_HBV/1-351     AC D6QVE8.1
#=GS I0DCG7_HBV/1-328     AC I0DCG7.1
#=GS B5M587_HBV/1-352     AC B5M587.1
#=GS B9VAY1_HBV/1-219     AC B9VAY1.1
#=GS F5C0Y2_HBV/1-354     AC F5C0Y2.1
#=GS B4YTA2_HBV/1-352     AC B4YTA2.1
#=GS B3V3R5_HBV/1-352     AC B3V3R5.1
#=GS A5JIB1_HBV/1-101     AC A5JIB1.1
#=GS B5M606_HBV/1-352     AC B5M606.1
#=GS B5TFF3_HBV/1-112     AC B5TFF3.1
#=GS D0E5N1_HBV/1-352     AC D0E5N1.1
#=GS C3W4E4_HBV/1-341     AC C3W4E4.1
#=GS H9XQN3_HBV/1-91      AC H9XQN3.1
#=GS I0C8E4_HBV/1-354     AC I0C8E4.1
#=GS Q9YKJ8_HBV/1-352     AC Q9YKJ8.1
#=GS E5F0V1_HBV/1-49      AC E5F0V1.1
#=GS I0DCI7_HBV/1-328     AC I0DCI7.1
#=GS D3GIJ3_HBV/1-352     AC D3GIJ3.1
#=GS Q9QMN7_HBV/1-352     AC Q9QMN7.2
#=GS Q9IX69_HBV/1-52      AC Q9IX69.1
#=GS E0ZRK7_HBV/1-351     AC E0ZRK7.1
#=GS B0FCX7_HBV/1-352     AC B0FCX7.1
#=GS D3YGL0_HBV/1-341     AC D3YGL0.1
#=GS G3XH14_HBV/1-332     AC G3XH14.1
#=GS Q9E9B4_HBV/1-352     AC Q9E9B4.1
#=GS I0C8N1_HBV/1-335     AC I0C8N1.1
#=GS I0C8F6_HBV/1-354     AC I0C8F6.1
#=GS D6R3W5_HBV/1-352     AC D6R3W5.1
#=GS D5LDX9_HBV/1-352     AC D5LDX9.1
#=GS Q0PMM8_HBV/1-354     AC Q0PMM8.1
#=GS B4YKX6_HBV/1-341     AC B4YKX6.1
#=GS B7TU82_HBV/1-344     AC B7TU82.1
#=GS E5RD61_HBV/1-352     AC E5RD61.1
#=GS D5MSH5_HBV/1-343     AC D5MSH5.1
#=GS Q4JQH4_HBV/1-354     AC Q4JQH4.1
#=GS D5LFA5_HBV/1-352     AC D5LFA5.1
#=GS B9VK55_HBV/1-352     AC B9VK55.1
#=GS H9XQV2_HBV/1-91      AC H9XQV2.1
#=GS Q6RSE7_9HEPA/1-367   AC Q6RSE7.1
#=GS A6MG32_HBV/1-352     AC A6MG32.1
#=GS B5M671_HBV/1-341     AC B5M671.1
#=GS Q9QMM9_HBV/1-352     AC Q9QMM9.1
#=GS D9U590_HBV/1-176     AC D9U590.1
#=GS I0C8D1_HBV/1-354     AC I0C8D1.1
#=GS I0C8Y9_HBV/1-354     AC I0C8Y9.1
#=GS A8J4C6_HBV/1-354     AC A8J4C6.1
#=GS Q4KR79_HBV/1-354     AC Q4KR79.1
#=GS D3TIK4_HBV/1-352     AC D3TIK4.1
#=GS Q3HM64_HBV/1-350     AC Q3HM64.1
#=GS C6F5A4_HBV/1-354     AC C6F5A4.1
#=GS B9VKY5_HBV/1-352     AC B9VKY5.1
#=GS B5TF77_HBV/1-112     AC B5TF77.1
#=GS B0FD74_HBV/1-346     AC B0FD74.1
#=GS H9XRV3_HBV/1-91      AC H9XRV3.1
#=GS B9VKV9_HBV/1-341     AC B9VKV9.1
#=GS G1E8C6_HBV/1-341     AC G1E8C6.1
#=GS G9HNQ8_HBV/2-159     AC G9HNQ8.1
#=GS D5LBR8_HBV/1-352     AC D5LBR8.1
#=GS B2LXP0_HBV/1-352     AC B2LXP0.1
#=GS Q2PWW5_HBV/1-354     AC Q2PWW5.1
#=GS D0E6B0_HBV/1-352     AC D0E6B0.1
#=GS H6UN01_HBV/1-341     AC H6UN01.1
#=GS I0DEA0_HBV/204-281   AC I0DEA0.1
#=GS C3W3Q1_HBV/1-341     AC C3W3Q1.1
#=GS Q67913_HBV/1-341     AC Q67913.1
#=GS F5C0U2_HBV/1-351     AC F5C0U2.1
#=GS I0C8A5_HBV/1-354     AC I0C8A5.1
#=GS B0FD17_HBV/1-346     AC B0FD17.1
#=GS I0DGA2_HBV/1-352     AC I0DGA2.1
#=GS D3XGC6_HBV/1-352     AC D3XGC6.1
#=GS I0DDP0_HBV/1-328     AC I0DDP0.1
#=GS Q20BZ2_HBV/1-57      AC Q20BZ2.1
#=GS B5BPR1_HBV/1-352     AC B5BPR1.1
#=GS Q9QAW4_HBV/1-341     AC Q9QAW4.1
#=GS D2U606_HBV/1-346     AC D2U606.1
#=GS B5M571_HBV/1-352     AC B5M571.1
#=GS I0C8K5_HBV/1-350     AC I0C8K5.1
#=GS B7TV14_HBV/1-352     AC B7TV14.1
#=GS I0C861_HBV/1-354     AC I0C861.1
#=GS D0EDQ8_HBV/1-341     AC D0EDQ8.1
#=GS F5C122_HBV/280-320   AC F5C122.1
#=GS B9VK51_HBV/1-352     AC B9VK51.1
#=GS D3TK62_HBV/1-352     AC D3TK62.1
#=GS F5C0I3_HBV/1-341     AC F5C0I3.1
#=GS H9XQF0_HBV/1-91      AC H9XQF0.1
#=GS C7DMS5_HBV/1-351     AC C7DMS5.1
#=GS I0DDN2_HBV/1-317     AC I0DDN2.1
#=GS I0DCN4_HBV/1-328     AC I0DCN4.1
#=GS D9U1M9_HBV/1-352     AC D9U1M9.1
#=GS I0DGH0_HBV/1-352     AC I0DGH0.1
#=GS Q69590_HBV/1-49      AC Q69590.1
#=GS A9PLI9_HBV/2-43      AC A9PLI9.1
#=GS B7TTK1_HBV/1-341     AC B7TTK1.1
#=GS C7AY51_HBV/1-354     AC C7AY51.1
#=GS B4YL24_HBV/1-341     AC B4YL24.1
#=GS E5F0X1_HBV/1-49      AC E5F0X1.1
#=GS Q9QAC4_HBV/1-352     AC Q9QAC4.1
#=GS B5M4Y5_HBV/1-352     AC B5M4Y5.1
#=GS Q9IXB7_HBV/1-52      AC Q9IXB7.1
#=GS Q9YZT9_HBV/1-346     AC Q9YZT9.1
#=GS I0C902_HBV/1-354     AC I0C902.1
#=GS Q4R1S3_HBV/1-354     AC Q4R1S3.1
#=GS F5C0S5_HBV/1-333     AC F5C0S5.1
#=GS I0C8Z0_HBV/1-354     AC I0C8Z0.1
#=GS DPOL_HBVE2/1-351     AC Q80IU7.1
#=GS B5A2F7_HBV/1-352     AC B5A2F7.1
#=GS H3K3G5_HBV/1-354     AC H3K3G5.1
#=GS I0DGF5_HBV/1-352     AC I0DGF5.1
#=GS B5TY11_HBV/1-352     AC B5TY11.1
#=GS Q4FD99_HBV/1-352     AC Q4FD99.1
#=GS F5C0Q7_HBV/1-351     AC F5C0Q7.1
#=GS D3YG27_HBV/230-303   AC D3YG27.1
#=GS B5M603_HBV/1-352     AC B5M603.1
#=GS C9WDA1_HBV/1-341     AC C9WDA1.1
#=GS E9L2I5_HBV/1-171     AC E9L2I5.1
#=GS I0DGH4_HBV/1-352     AC I0DGH4.1
#=GS D0EEJ0_HBV/1-354     AC D0EEJ0.1
#=GS E0D3A9_HBV/1-352     AC E0D3A9.1
#=GS B5A2J0_HBV/1-352     AC B5A2J0.1
#=GS B5AT90_HBV/1-352     AC B5AT90.1
#=GS Q68RQ9_HBV/1-352     AC Q68RQ9.1
#=GS H6V5P8_HBV/1-341     AC H6V5P8.1
#=GS G1C8V7_HBV/1-341     AC G1C8V7.1
#=GS F5C1I0_HBV/1-341     AC F5C1I0.1
#=GS F5C139_HBV/1-354     AC F5C139.1
#=GS Q5SDK1_HBV/1-346     AC Q5SDK1.1
#=GS B7TV70_HBV/1-352     AC B7TV70.1
#=GS B5B4E3_HBV/1-352     AC B5B4E3.1
#=GS B7TTW8_HBV/1-352     AC B7TTW8.1
#=GS Q20BR1_HBV/1-57      AC Q20BR1.1
#=GS Q80GW5_HBV/1-287     AC Q80GW5.1
#=GS B7TTS5_HBV/1-352     AC B7TTS5.1
#=GS Q404F4_HBV/1-341     AC Q404F4.1
#=GS D2X530_HBV/3-171     AC D2X530.1
#=GS I0DDP4_HBV/1-328     AC I0DDP4.1
#=GS B9W3Z9_HBV/1-354     AC B9W3Z9.1
#=GS B3VLK2_HBV/1-165     AC B3VLK2.1
#=GS D3YG15_HBV/1-239     AC D3YG15.1
#=GS I0C8J1_HBV/1-350     AC I0C8J1.1
#=GS B5M5U1_HBV/1-352     AC B5M5U1.1
#=GS Q4AC37_HBV/1-352     AC Q4AC37.1
#=GS E5F0W8_HBV/1-49      AC E5F0W8.1
#=GS D0VXH3_HBV/1-352     AC D0VXH3.1
#=GS H6V5H6_HBV/1-352     AC H6V5H6.1
#=GS G4XMD1_HBV/1-341     AC G4XMD1.1
#=GS Q404E6_HBV/1-341     AC Q404E6.1
#=GS B7TTY2_HBV/1-352     AC B7TTY2.1
#=GS D5LFE0_HBV/1-352     AC D5LFE0.1
#=GS A5JHX2_HBV/1-112     AC A5JHX2.1
#=GS B9VKX9_HBV/1-352     AC B9VKX9.1
#=GS E5RD77_HBV/1-352     AC E5RD77.1
#=GS I0C8Y3_HBV/1-354     AC I0C8Y3.1
#=GS A7YET2_HBV/1-352     AC A7YET2.1
#=GS C7DMT9_HBV/1-351     AC C7DMT9.1
#=GS B5BUR7_HBV/1-354     AC B5BUR7.1
#=GS G9M9Q9_HBV/1-352     AC G9M9Q9.1
#=GS I0C8P5_HBV/1-341     AC I0C8P5.1
#=GS D3XGE1_HBV/1-352     AC D3XGE1.1
#=GS I0DGB0_HBV/1-352     AC I0DGB0.1
#=GS I0DD68_HBV/1-328     AC I0DD68.1
#=GS B6CIZ5_HBV/1-354     AC B6CIZ5.1
#=GS D5LEG8_HBV/1-352     AC D5LEG8.1
#=GS Q9WFA5_9HEPA/1-365   AC Q9WFA5.1
#=GS E0ZRF4_HBV/1-351     AC E0ZRF4.1
#=GS C6F5D2_HBV/1-354     AC C6F5D2.1
#=GS C1K1T4_HBV/1-352     AC C1K1T4.1
#=GS C7DNH5_HBV/1-347     AC C7DNH5.1
#=GS E5RPM3_HBV/1-352     AC E5RPM3.1
#=GS B5M5M1_HBV/1-352     AC B5M5M1.1
#=GS B5BUT6_HBV/1-354     AC B5BUT6.1
#=GS G3E5C9_HBV/1-341     AC G3E5C9.1
#=GS G4XI17_HBV/1-160     AC G4XI17.1
#=GS G4XI73_HBV/1-160     AC G4XI73.1
#=GS D0UDM9_HBV/1-352     AC D0UDM9.1
#=GS B5M5S1_HBV/1-352     AC B5M5S1.1
#=GS H9XSZ1_HBV/1-89      AC H9XSZ1.1
#=GS C3W3U2_HBV/1-341     AC C3W3U2.1
#=GS D5LCF9_HBV/1-352     AC D5LCF9.1
#=GS E9L2H3_HBV/1-171     AC E9L2H3.1
#=GS E0ZRG0_HBV/1-351     AC E0ZRG0.1
#=GS I0DGB3_HBV/1-352     AC I0DGB3.1
#=GS E0ZRR1_HBV/1-351     AC E0ZRR1.1
#=GS F5C075_HBV/1-352     AC F5C075.1
#=GS F5C0N6_HBV/1-354     AC F5C0N6.1
#=GS G1E7J7_HBV/1-341     AC G1E7J7.1
#=GS D0UE82_HBV/1-346     AC D0UE82.1
#=GS E5F0X5_HBV/1-49      AC E5F0X5.1
#=GS B5ATD7_HBV/272-318   AC B5ATD7.1
#=GS E5KUG3_9HEPA/1-363   AC E5KUG3.1
#=GS G9HNR4_HBV/2-159     AC G9HNR4.1
#=GS G3XH06_HBV/1-343     AC G3XH06.1
#=GS B2Y6Z5_HBV/1-341     AC B2Y6Z5.1
#=GS Q918N5_9HEPA/1-393   AC Q918N5.1
#=GS H1ZN40_HBV/1-341     AC H1ZN40.1
#=GS C5WK10_HBV/1-352     AC C5WK10.1
#=GS C1K1H7_HBV/1-352     AC C1K1H7.1
#=GS H9XRR0_HBV/1-91      AC H9XRR0.1
#=GS F5C0Q3_HBV/1-347     AC F5C0Q3.1
#=GS D2U5Z8_HBV/1-351     AC D2U5Z8.1
#=GS G1E828_HBV/1-341     AC G1E828.1
#=GS C9WDC5_HBV/1-341     AC C9WDC5.1
#=GS D0EE35_HBV/1-354     AC D0EE35.1
#=GS O39666_HBV/1-352     AC O39666.1
#=GS C1K174_HBV/1-352     AC C1K174.1
#=GS B5BUU4_HBV/1-354     AC B5BUU4.1
#=GS I0C8Z5_HBV/1-354     AC I0C8Z5.1
#=GS I0DG90_HBV/1-352     AC I0DG90.1
#=GS H9XR58_HBV/1-91      AC H9XR58.1
#=GS Q8BCB4_HBV/1-354     AC Q8BCB4.1
#=GS B9VKF6_HBV/1-352     AC B9VKF6.1
#=GS D0E5S9_HBV/1-352     AC D0E5S9.1
#=GS B2CFG3_HBV/1-274     AC B2CFG3.1
#=GS Q5DVZ0_HBV/1-341     AC Q5DVZ0.1
#=GS I0C8Q4_HBV/1-341     AC I0C8Q4.1
#=GS Q97976_HBV/1-49      AC Q97976.1
#=GS Q2EIE3_HBV/1-352     AC Q2EIE3.1
#=GS D2JMF6_HBV/1-352     AC D2JMF6.1
#=GS Q3ZKQ7_HBV/1-354     AC Q3ZKQ7.1
#=GS D0E606_HBV/1-352     AC D0E606.1
#=GS Q4FDJ0_HBV/1-352     AC Q4FDJ0.1
#=GS C6F521_HBV/1-354     AC C6F521.1
#=GS DPOL_HBVB6/1-352     AC Q67925.1
#=GS B4YKR4_HBV/1-354     AC B4YKR4.1
#=GS F5C147_HBV/1-354     AC F5C147.1
#=GS G9G9G6_HBV/1-341     AC G9G9G6.1
#=GS D0EEG5_HBV/1-354     AC D0EEG5.1
#=GS F5C165_HBV/1-354     AC F5C165.1
#=GS I0C8X0_HBV/1-354     AC I0C8X0.1
#=GS G3GDN7_HBV/1-352     AC G3GDN7.1
#=GS D9U5H6_HBV/1-352     AC D9U5H6.1
#=GS B9VK59_HBV/1-352     AC B9VK59.1
#=GS Q6RSG2_9HEPA/1-366   AC Q6RSG2.1
#=GS D6R6U2_HBV/1-352     AC D6R6U2.1
#=GS I0C884_HBV/1-354     AC I0C884.1
#=GS DPOL_HBVC4/1-352     AC P31870.1
#=GS Q91C50_HBV/1-347     AC Q91C50.1
#=GS B2CS99_HBV/1-341     AC B2CS99.1
#=GS B3IWV5_HBV/1-352     AC B3IWV5.1
#=GS E5RD69_HBV/1-352     AC E5RD69.1
#=GS B0FCZ1_HBV/1-352     AC B0FCZ1.1
#=GS B5BPP1_HBV/1-352     AC B5BPP1.1
#=GS Q2LCA8_HBV/1-341     AC Q2LCA8.1
#=GS Q09GP2_HBV/1-352     AC Q09GP2.1
#=GS H9XRU5_HBV/1-91      AC H9XRU5.1
#=GS C9WDD1_HBV/1-341     AC C9WDD1.1
#=GS I0C9B8_HBV/1-334     AC I0C9B8.1
#=GS B5BPM5_HBV/1-352     AC B5BPM5.1
#=GS B7TUN0_HBV/1-352     AC B7TUN0.1
#=GS I0DGF1_HBV/1-352     AC I0DGF1.1
#=GS B1ABP9_HBV/1-352     AC B1ABP9.1
#=GS H6WFB4_HBV/1-112     AC H6WFB4.1
#=GS A5LG90_HBV/1-344     AC A5LG90.1
#=GS B2CZU2_HBV/1-352     AC B2CZU2.1
#=GS I0C8N5_HBV/1-231     AC I0C8N5.1
#=GS Q2F4Z3_HBV/1-348     AC Q2F4Z3.1
#=GS B9VKG0_HBV/1-352     AC B9VKG0.1
#=GS B0FCU2_HBV/1-352     AC B0FCU2.1
#=GS F5C0T5_HBV/1-351     AC F5C0T5.1
#=GS G9G9V7_HBV/1-330     AC G9G9V7.1
#=GS Q9IX78_HBV/1-52      AC Q9IX78.1
#=GS G3GDP4_HBV/1-352     AC G3GDP4.1
#=GS Q8JXG0_HBV/1-352     AC Q8JXG0.1
#=GS B5BUU8_HBV/1-354     AC B5BUU8.1
#=GS Q6R6I9_HBV/1-352     AC Q6R6I9.1
#=GS B2LRV0_HBV/1-352     AC B2LRV0.1
#=GS Q67948_HBV/1-341     AC Q67948.1
#=GS B5TXR8_HBV/1-352     AC B5TXR8.1
#=GS D0VXJ3_HBV/1-352     AC D0VXJ3.1
#=GS H9XRD8_HBV/1-91      AC H9XRD8.1
#=GS D2JMN6_HBV/1-352     AC D2JMN6.1
#=GS B5M609_HBV/1-341     AC B5M609.1
#=GS Q67856_HBV/1-305     AC Q67856.1
#=GS G4XMI7_HBV/1-352     AC G4XMI7.1
#=GS B5BPQ7_HBV/1-352     AC B5BPQ7.1
#=GS D5LBD0_HBV/1-352     AC D5LBD0.1
#=GS A9QPY7_HBV/1-351     AC A9QPY7.1
#=GS Q8QZP4_HBV/262-306   AC Q8QZP4.1
#=GS H6WFL7_HBV/1-112     AC H6WFL7.1
#=GS Q9IR26_HBV/1-174     AC Q9IR26.1
#=GS B4YKN7_HBV/1-354     AC B4YKN7.1
#=GS Q5UAY3_HBV/1-352     AC Q5UAY3.1
#=GS Q20BR7_HBV/1-56      AC Q20BR7.1
#=GS Q5DVY2_HBV/1-341     AC Q5DVY2.1
#=GS B5M563_HBV/1-352     AC B5M563.1
#=GS F5C0T8_HBV/1-351     AC F5C0T8.1
#=GS B5B4A7_HBV/1-240     AC B5B4A7.1
#=GS C6F4T1_HBV/1-354     AC C6F4T1.1
#=GS F5C0J8_HBV/1-354     AC F5C0J8.1
#=GS C7G2Z3_HBV/1-352     AC C7G2Z3.1
#=GS Q4KR86_HBV/1-354     AC Q4KR86.1
#=GS Q99HV4_HBV/1-352     AC Q99HV4.1
#=GS H6UN88_HBV/1-340     AC H6UN88.1
#=GS Q8B4B0_HBV/1-341     AC Q8B4B0.1
#=GS I0C8C5_HBV/1-354     AC I0C8C5.1
#=GS Q4FDJ4_HBV/1-352     AC Q4FDJ4.1
#=GS D3TIJ3_HBV/1-352     AC D3TIJ3.1
#=GS B0FCK5_HBV/1-352     AC B0FCK5.1
#=GS H9N871_HBV/1-341     AC H9N871.1
#=GS A8CEJ6_HBV/1-352     AC A8CEJ6.1
#=GS C7DNK8_HBV/1-351     AC C7DNK8.1
#=GS I0C8U1_HBV/1-354     AC I0C8U1.1
#=GS G3XH28_HBV/1-332     AC G3XH28.1
#=GS O91554_HBV/1-352     AC O91554.1
#=GS F5C150_HBV/1-354     AC F5C150.1
#=GS D2JMC6_HBV/1-352     AC D2JMC6.1
#=GS Q67895_HBV/1-354     AC Q67895.1
#=GS Q1PD12_HBV/1-352     AC Q1PD12.1
#=GS Q8B4H4_HBV/1-354     AC Q8B4H4.1
#=GS B0YK40_HBV/1-352     AC B0YK40.1
#=GS I0C869_HBV/1-354     AC I0C869.1
#=GS E9L2L4_HBV/1-171     AC E9L2L4.1
#=GS B7TUX8_HBV/1-352     AC B7TUX8.1
#=GS G4XI57_HBV/1-160     AC G4XI57.1
#=GS H6UN37_HBV/1-341     AC H6UN37.1
#=GS Q2MLQ8_HBV/1-341     AC Q2MLQ8.1
#=GS F5C7M5_HBV/1-352     AC F5C7M5.1
#=GS Q80MR4_HBV/1-352     AC Q80MR4.1
#=GS D3TK96_HBV/1-352     AC D3TK96.1
#=GS E5RD41_HBV/1-352     AC E5RD41.1
#=GS I0DDY2_HBV/1-328     AC I0DDY2.1
#=GS Q80IL1_HBV/1-351     AC Q80IL1.1
#=GS Q76B37_HBV/1-352     AC Q76B37.1
#=GS G9G9V0_HBV/1-341     AC G9G9V0.1
#=GS D3TJZ7_HBV/1-246     AC D3TJZ7.1
#=GS Q5U7S1_HBV/1-341     AC Q5U7S1.1
#=GS Q6UBL0_HBV/1-354     AC Q6UBL0.1
#=GS Q8UYE3_HBV/1-352     AC Q8UYE3.1
#=GS H6WFE2_HBV/1-112     AC H6WFE2.1
#=GS I0DGI7_HBV/1-352     AC I0DGI7.1
#=GS C1K1S1_HBV/1-352     AC C1K1S1.1
#=GS I0DDQ7_HBV/1-328     AC I0DDQ7.1
#=GS C5WK18_HBV/1-352     AC C5WK18.1
#=GS B2CY23_HBV/1-352     AC B2CY23.1
#=GS Q6XGJ2_HBV/1-341     AC Q6XGJ2.1
#=GS Q4FD61_HBV/1-352     AC Q4FD61.1
#=GS Q80H36_HBV/1-352     AC Q80H36.1
#=GS H9XQG2_HBV/1-91      AC H9XQG2.1
#=GS A7L365_HBV/1-30      AC A7L365.1
#=GS B5TFI5_HBV/1-112     AC B5TFI5.1
#=GS Q8JJT5_HBV/1-352     AC Q8JJT5.1
#=GS DPOL_HBVD3/1-341     AC P03156.1
#=GS Q9IX93_HBV/1-52      AC Q9IX93.1
#=GS I0DGE5_HBV/1-352     AC I0DGE5.1
#=GS E5RPN9_HBV/1-341     AC E5RPN9.1
#=GS I0C8X1_HBV/1-354     AC I0C8X1.1
#=GS E8Z623_HBV/1-352     AC E8Z623.1
#=GS Q8B4H8_HBV/1-354     AC Q8B4H8.1
#=GS H9XR78_HBV/1-91      AC H9XR78.1
#=GS Q1T7D9_HBV/1-341     AC Q1T7D9.1
#=GS Q9IX84_HBV/1-52      AC Q9IX84.1
#=GS B5B4C0_HBV/1-240     AC B5B4C0.1
#=GS B3V3Q1_HBV/287-321   AC B3V3Q1.1
#=GS Q67907_HBV/1-49      AC Q67907.1
#=GS Q9IXD8_HBV/1-52      AC Q9IXD8.1
#=GS E3Q0H5_HBV/1-352     AC E3Q0H5.1
#=GS D5LC48_HBV/1-352     AC D5LC48.1
#=GS A8J456_HBV/1-352     AC A8J456.1
#=GS Q8B4F6_HBV/258-303   AC Q8B4F6.1
#=GS H9XR22_HBV/1-91      AC H9XR22.1
#=GS B9VL09_HBV/1-352     AC B9VL09.1
#=GS Q5DVZ4_HBV/1-352     AC Q5DVZ4.1
#=GS Q0PML7_HBV/1-352     AC Q0PML7.1
#=GS G1C8M4_HBV/1-338     AC G1C8M4.1
#=GS D0E5G1_HBV/1-352     AC D0E5G1.1
#=GS I0DGD0_HBV/1-352     AC I0DGD0.1
#=GS Q918N8_9HEPA/1-393   AC Q918N8.1
#=GS G1E8E0_HBV/1-341     AC G1E8E0.1
#=GS Q1JUS6_HBV/1-334     AC Q1JUS6.1
#=GS Q2LCA4_HBV/1-341     AC Q2LCA4.1
#=GS H2ERF1_HBV/1-352     AC H2ERF1.1
#=GS D3TIL0_HBV/1-286     AC D3TIL0.1
#=GS Q2LC98_HBV/1-341     AC Q2LC98.1
#=GS C9WDJ3_HBV/1-352     AC C9WDJ3.1
#=GS Q5UFS2_HBV/1-341     AC Q5UFS2.1
#=GS B0YK32_HBV/1-354     AC B0YK32.1
#=GS I0DDG6_HBV/1-328     AC I0DDG6.1
#=GS Q5U7T3_HBV/1-341     AC Q5U7T3.1
#=GS A1Z0N2_HBV/1-352     AC A1Z0N2.1
#=GS B9VL60_HBV/189-323   AC B9VL60.1
#=GS B2LWD0_HBV/1-287     AC B2LWD0.1
#=GS Q2LCE8_HBV/1-341     AC Q2LCE8.1
#=GS B5ATE6_HBV/1-276     AC B5ATE6.1
#=GS B9VKP9_HBV/1-352     AC B9VKP9.1
#=GS DPOL_HBVC7/1-352     AC Q913A7.1
#=GS D0EEN1_HBV/1-354     AC D0EEN1.1
#=GS Q20C08_HBV/1-42      AC Q20C08.1
#=GS C7DN89_HBV/1-351     AC C7DN89.1
#=GS G4XI39_HBV/1-160     AC G4XI39.1
#=GS B0FD53_HBV/1-352     AC B0FD53.1
#=GS I0DCE3_HBV/1-328     AC I0DCE3.1
#=GS B9VKP2_HBV/1-352     AC B9VKP2.1
#=GS I0C9G8_HBV/1-338     AC I0C9G8.1
#=GS I0C8V7_HBV/1-354     AC I0C8V7.1
#=GS I0DGA1_HBV/1-352     AC I0DGA1.1
#=GS A8J4G8_HBV/1-352     AC A8J4G8.1
#=GS D2X4V8_HBV/4-171     AC D2X4V8.1
#=GS B5M653_HBV/1-352     AC B5M653.1
#=GS D6QW45_HBV/1-352     AC D6QW45.1
#=GS C1K1B2_HBV/1-352     AC C1K1B2.1
#=GS H6UG94_HBV/1-341     AC H6UG94.1
#=GS A0MMM0_HBV/1-352     AC A0MMM0.1
#=GS E9L2N7_HBV/1-171     AC E9L2N7.1
#=GS Q8B5Q3_HBV/1-190     AC Q8B5Q3.1
#=GS B6DXD3_HBV/1-304     AC B6DXD3.1
#=GS H9XRL6_HBV/1-91      AC H9XRL6.1
#=GS E3Q0I2_HBV/1-352     AC E3Q0I2.1
#=GS B7TTL5_HBV/1-352     AC B7TTL5.1
#=GS H1ACX6_HBV/1-352     AC H1ACX6.1
#=GS F1AEU6_HBV/1-354     AC F1AEU6.1
#=GS B5M5M8_HBV/1-352     AC B5M5M8.1
#=GS B5BPK5_HBV/1-352     AC B5BPK5.1
#=GS B0YK59_HBV/1-352     AC B0YK59.1
#=GS B5M659_HBV/1-352     AC B5M659.1
#=GS D5LCW4_HBV/1-352     AC D5LCW4.1
#=GS Q9IX63_HBV/1-52      AC Q9IX63.1
#=GS Q2ABZ8_HBV/1-352     AC Q2ABZ8.1
#=GS H9XRJ2_HBV/1-91      AC H9XRJ2.1
#=GS Q9YPV7_HBV/1-341     AC Q9YPV7.1
#=GS D3TJW9_HBV/1-352     AC D3TJW9.1
#=GS G4XMJ9_HBV/1-352     AC G4XMJ9.1
#=GS F5C0W3_HBV/1-354     AC F5C0W3.1
#=GS Q4FD53_HBV/1-352     AC Q4FD53.1
#=GS D0E5E3_HBV/1-341     AC D0E5E3.1
#=GS I0DDY6_HBV/1-176     AC I0DDY6.1
#=GS B5M5B0_HBV/233-291   AC B5M5B0.1
#=GS Q9WP51_HBV/1-214     AC Q9WP51.1
#=GS D2JMC1_HBV/1-352     AC D2JMC1.1
#=GS Q5KR31_HBV/1-352     AC Q5KR31.1
#=GS DPOL_HBVCP/1-341     AC P12900.1
#=GS D9U5E8_HBV/1-352     AC D9U5E8.1
#=GS H9XQU8_HBV/1-91      AC H9XQU8.1
#=GS C3W3R2_HBV/1-341     AC C3W3R2.1
#=GS B5MEV7_HBV/1-352     AC B5MEV7.1
#=GS I0DGI1_HBV/1-352     AC I0DGI1.1
#=GS B4YKW3_HBV/1-341     AC B4YKW3.1
#=GS B4Y7D6_HBV/1-352     AC B4Y7D6.2
#=GS D2X3V8_HBV/1-98      AC D2X3V8.1
#=GS I0C9A9_HBV/1-341     AC I0C9A9.1
#=GS Q80GZ4_HBV/1-352     AC Q80GZ4.1
#=GS F5C168_HBV/1-354     AC F5C168.1
#=GS I0C8D2_HBV/1-354     AC I0C8D2.1
#=GS Q5R2P0_HBV/1-341     AC Q5R2P0.1
#=GS D2JMZ8_HBV/1-350     AC D2JMZ8.1
#=GS G9HNR3_HBV/2-159     AC G9HNR3.1
#=GS I0DGG3_HBV/1-352     AC I0DGG3.1
#=GS B5TFD7_HBV/1-112     AC B5TFD7.1
#=GS C3W494_HBV/1-234     AC C3W494.1
#=GS D7NKY9_HBV/1-341     AC D7NKY9.1
#=GS E5RDA5_HBV/1-341     AC E5RDA5.1
#=GS F5C1A1_HBV/1-354     AC F5C1A1.1
#=GS H9XQJ6_HBV/1-91      AC H9XQJ6.1
#=GS D2JMP1_HBV/1-352     AC D2JMP1.1
#=GS I0C8Q0_HBV/1-231     AC I0C8Q0.1
#=GS D3TK56_HBV/1-352     AC D3TK56.1
#=GS O91541_HBV/1-352     AC O91541.1
#=GS I0DCA9_HBV/1-328     AC I0DCA9.1
#=GS G3XLB1_HBV/1-352     AC G3XLB1.1
#=GS F1AEQ8_HBV/1-354     AC F1AEQ8.1
#=GS F5C152_HBV/1-354     AC F5C152.1
#=GS G4XI95_HBV/1-160     AC G4XI95.1
#=GS D3TK11_HBV/1-37      AC D3TK11.1
#=GS A9CM49_HBV/1-352     AC A9CM49.1
#=GS B2CXY9_HBV/1-352     AC B2CXY9.1
#=GS E5RPY3_HBV/1-343     AC E5RPY3.1
#=GS I0C8A7_HBV/1-354     AC I0C8A7.1
#=GS D0EYZ8_HBV/1-341     AC D0EYZ8.1
#=GS Q20C02_HBV/1-55      AC Q20C02.1
#=GS H6UN17_HBV/1-341     AC H6UN17.1
#=GS B3VLK8_HBV/1-176     AC B3VLK8.1
#=GS Q5KR16_HBV/1-352     AC Q5KR16.1
#=GS B3VLM2_HBV/1-176     AC B3VLM2.1
#=GS Q5Q0Z2_HBV/1-341     AC Q5Q0Z2.1
#=GS F5C0Y6_HBV/1-354     AC F5C0Y6.1
#=GS Q8BCB9_HBV/1-354     AC Q8BCB9.1
#=GS B4YLI8_HBV/1-341     AC B4YLI8.1
#=GS D3TK10_HBV/1-199     AC D3TK10.1
#=GS H6WF70_HBV/1-112     AC H6WF70.1
#=GS Q5UFS7_HBV/1-341     AC Q5UFS7.1
#=GS B5B4J3_HBV/1-352     AC B5B4J3.1
#=GS H6WFC2_HBV/1-112     AC H6WFC2.1
#=GS Q20BX9_HBV/1-52      AC Q20BX9.1
#=GS Q7TDT1_HBV/1-352     AC Q7TDT1.1
#=GS D9U5D5_HBV/1-352     AC D9U5D5.1
#=GS A5JIC3_HBV/1-112     AC A5JIC3.1
#=GS O09504_HBV/205-310   AC O09504.1
#=GS C9WD75_HBV/1-341     AC C9WD75.1
#=GS G1E7T3_HBV/1-322     AC G1E7T3.1
#=GS H6UN80_HBV/1-341     AC H6UN80.1
#=GS F5C0U4_HBV/1-351     AC F5C0U4.1
#=GS E5RPX3_HBV/1-343     AC E5RPX3.1
#=GS H9XRP8_HBV/1-91      AC H9XRP8.1
#=GS Q4KRA0_HBV/1-354     AC Q4KRA0.1
#=GS I0C9E9_HBV/1-338     AC I0C9E9.1
#=GS I0C8P8_HBV/1-341     AC I0C8P8.1
#=GS F5C0X1_HBV/1-354     AC F5C0X1.1
#=GS D2K7P1_HBV/73-121    AC D2K7P1.1
#=GS G9G8L9_HBV/1-341     AC G9G8L9.1
#=GS F5C0M6_HBV/1-354     AC F5C0M6.1
#=GS Q20BT5_HBV/1-57      AC Q20BT5.1
#=GS I0DDS5_HBV/1-328     AC I0DDS5.1
#=GS Q2L4M4_HBV/1-341     AC Q2L4M4.1
#=GS Q461A8_HBV/1-351     AC Q461A8.1
#=GS A5JHS4_HBV/1-112     AC A5JHS4.1
#=GS I0DGE0_HBV/1-352     AC I0DGE0.1
#=GS B5ATA3_HBV/1-352     AC B5ATA3.1
#=GS B4YLG3_HBV/1-341     AC B4YLG3.1
#=GS B0FCU9_HBV/1-352     AC B0FCU9.1
#=GS Q8QKZ0_HBV/1-354     AC Q8QKZ0.1
#=GS O09504_HBV/1-211     AC O09504.1
#=GS E5F0V4_HBV/1-44      AC E5F0V4.1
#=GS Q8B3N9_9HEPA/1-370   AC Q8B3N9.1
#=GS G1C8H6_HBV/1-341     AC G1C8H6.1
#=GS Q9E9A1_HBV/1-352     AC Q9E9A1.1
#=GS Q00KA0_HBV/1-352     AC Q00KA0.1
#=GS Q00K96_HBV/1-352     AC Q00K96.1
#=GS I0C8B9_HBV/1-354     AC I0C8B9.1
#=GS A5JI00_HBV/1-112     AC A5JI00.1
#=GS B7TTC8_HBV/1-352     AC B7TTC8.1
#=GS E3Q0J5_HBV/1-352     AC E3Q0J5.1
#=GS Q8B4D0_HBV/1-341     AC Q8B4D0.1
#=GS A5JJ36_HBV/68-125    AC A5JJ36.1
#=GS F5C087_HBV/1-352     AC F5C087.1
#=GS I0DCB3_HBV/1-325     AC I0DCB3.1
#=GS I0C908_HBV/1-354     AC I0C908.1
#=GS B1ABQ7_HBV/1-352     AC B1ABQ7.1
#=GS G9G8M6_HBV/1-340     AC G9G8M6.1
#=GS I0DCN8_HBV/1-327     AC I0DCN8.1
#=GS F5C161_HBV/1-354     AC F5C161.1
#=GS B6VA67_HBV/1-352     AC B6VA67.1
#=GS Q20BU5_HBV/1-57      AC Q20BU5.1
#=GS A2A151_HBV/1-341     AC A2A151.1
#=GS Q69594_HBV/1-352     AC Q69594.1
#=GS B5M553_HBV/1-352     AC B5M553.1
#=GS Q9IXC0_HBV/1-52      AC Q9IXC0.1
#=GS A0FDU8_HBV/1-193     AC A0FDU8.1
#=GS C7AY29_HBV/182-274   AC C7AY29.1
#=GS G9BNJ3_HBV/1-354     AC G9BNJ3.1
#=GS I0DGD2_HBV/1-352     AC I0DGD2.1
#=GS Q9IX87_HBV/1-52      AC Q9IX87.1
#=GS A8R7G0_HBV/1-337     AC A8R7G0.1
#=GS G1C8N1_HBV/1-339     AC G1C8N1.1
#=GS Q8B4C2_HBV/1-231     AC Q8B4C2.1
#=GS I0C959_HBV/1-354     AC I0C959.1
#=GS G4XI13_HBV/1-160     AC G4XI13.1
#=GS I0DDZ0_HBV/1-328     AC I0DDZ0.1
#=GS Q9IHC7_HBV/1-352     AC Q9IHC7.1
#=GS O91511_HBV/1-352     AC O91511.1
#=GS H9XRF8_HBV/1-91      AC H9XRF8.1
#=GS I0C8B7_HBV/1-354     AC I0C8B7.1
#=GS B1PI59_9HEPA/51-421  AC B1PI59.1
#=GS B5AT32_HBV/1-352     AC B5AT32.1
#=GS Q9YPU7_HBV/1-341     AC Q9YPU7.1
#=GS I0DC86_HBV/1-312     AC I0DC86.1
#=GS G3XH36_HBV/1-332     AC G3XH36.1
#=GS I0DGD5_HBV/1-352     AC I0DGD5.1
#=GS B4YLK2_HBV/1-341     AC B4YLK2.1
#=GS D5LFG6_HBV/1-352     AC D5LFG6.1
#=GS C7DMV3_HBV/1-347     AC C7DMV3.1
#=GS D0E656_HBV/1-352     AC D0E656.1
#=GS Q9J5S0_HBV/1-341     AC Q9J5S0.1
#=GS C6F4J7_HBV/1-354     AC C6F4J7.1
#=GS E5F0W0_HBV/1-48      AC E5F0W0.1
#=GS Q91IP1_HBV/1-352     AC Q91IP1.1
#=GS B5BPM2_HBV/1-336     AC B5BPM2.1
#=GS A5JHX6_HBV/1-112     AC A5JHX6.1
#=GS E5RPU1_HBV/1-343     AC E5RPU1.1
#=GS G1E8H1_HBV/1-341     AC G1E8H1.1
#=GS I0C8A6_HBV/1-354     AC I0C8A6.1
#=GS I0DG89_HBV/1-352     AC I0DG89.1
#=GS Q7TG39_9HEPA/51-413  AC Q7TG39.1
#=GS H6UN48_HBV/1-341     AC H6UN48.1
#=GS C7DM78_HBV/1-351     AC C7DM78.1
#=GS Q8B4F0_HBV/228-282   AC Q8B4F0.1
#=GS B7TUG2_HBV/1-352     AC B7TUG2.1
#=GS D0E592_HBV/1-352     AC D0E592.1
#=GS H3K3R2_HBV/1-354     AC H3K3R2.1
#=GS G4XIA5_HBV/1-130     AC G4XIA5.1
#=GS H6UNC4_HBV/1-341     AC H6UNC4.1
#=GS H2ERF6_HBV/1-334     AC H2ERF6.1
#=GS Q6IT53_9HEPA/1-388   AC Q6IT53.1
#=GS B5B4C7_HBV/229-286   AC B5B4C7.1
#=GS B4UU51_HBV/1-352     AC B4UU51.2
#=GS E5RPY7_HBV/1-332     AC E5RPY7.1
#=GS B4YLB0_HBV/1-341     AC B4YLB0.1
#=GS Q1HHB1_HBV/1-341     AC Q1HHB1.1
#=GS I0DDH0_HBV/1-328     AC I0DDH0.1
#=GS H6UN13_HBV/1-341     AC H6UN13.1
#=GS D0E6C8_HBV/1-352     AC D0E6C8.1
#=GS H9N863_HBV/1-341     AC H9N863.1
#=GS Q7THR7_HBV/1-255     AC Q7THR7.1
#=GS C7DSL8_HBV/1-341     AC C7DSL8.1
#=GS D0EYZ1_HBV/1-341     AC D0EYZ1.1
#=GS A0MMM4_HBV/120-155   AC A0MMM4.1
#=GS C3W445_HBV/1-341     AC C3W445.1
#=GS G1E8P5_HBV/1-341     AC G1E8P5.1
#=GS D5MSH3_HBV/1-335     AC D5MSH3.1
#=GS Q20BW7_HBV/1-56      AC Q20BW7.1
#=GS D2X4X2_HBV/1-172     AC D2X4X2.1
#=GS D2JMX1_HBV/1-341     AC D2JMX1.1
#=GS G9G8Z8_HBV/1-341     AC G9G8Z8.1
#=GS D0VXG9_HBV/1-352     AC D0VXG9.1
#=GS Q65Z47_HBV/1-352     AC Q65Z47.1
#=GS O91558_HBV/1-352     AC O91558.1
#=GS F5C109_HBV/1-354     AC F5C109.1
#=GS I0DCJ9_HBV/1-328     AC I0DCJ9.1
#=GS E5RPK7_HBV/1-341     AC E5RPK7.1
#=GS I0C982_HBV/1-354     AC I0C982.1
#=GS G9G9U3_HBV/1-334     AC G9G9U3.1
#=GS F5C130_HBV/1-354     AC F5C130.1
#=GS A5JIJ9_HBV/1-112     AC A5JIJ9.1
#=GS A5JIJ1_HBV/1-112     AC A5JIJ1.1
#=GS Q7T7V3_HBV/1-341     AC Q7T7V3.1
#=GS D5LBQ2_HBV/1-352     AC D5LBQ2.1
#=GS Q4FD77_HBV/1-352     AC Q4FD77.1
#=GS H9XQQ9_HBV/1-91      AC H9XQQ9.1
#=GS H9XQD8_HBV/1-91      AC H9XQD8.1
#=GS A5LG22_HBV/1-352     AC A5LG22.1
#=GS Q1T7D5_HBV/1-341     AC Q1T7D5.1
#=GS Q5DVY6_HBV/1-341     AC Q5DVY6.1
#=GS Q9WP64_HBV/258-310   AC Q9WP64.1
#=GS B7TTN3_HBV/1-352     AC B7TTN3.1
#=GS Q7T4V3_HBV/1-341     AC Q7T4V3.1
#=GS H6UNE4_HBV/1-333     AC H6UNE4.1
#=GS B5ASV3_HBV/1-352     AC B5ASV3.1
#=GS Q8V0N1_HBV/1-352     AC Q8V0N1.1
#=GS Q8QXP7_HBV/1-341     AC Q8QXP7.1
#=GS C3W409_HBV/1-341     AC C3W409.1
#=GS Q80GU6_HBV/1-352     AC Q80GU6.1
#=GS C7AY23_HBV/1-354     AC C7AY23.1
#=GS F5C0L2_HBV/1-354     AC F5C0L2.1
#=GS D3TJ92_HBV/1-349     AC D3TJ92.1
#=GS G9G9M2_HBV/1-341     AC G9G9M2.1
#=GS D0VXJ7_HBV/1-341     AC D0VXJ7.1
#=GS Q2L4Q3_HBV/1-341     AC Q2L4Q3.1
#=GS D5LB47_HBV/1-352     AC D5LB47.1
#=GS I0DDI6_HBV/1-328     AC I0DDI6.1
#=GS G3XH02_HBV/1-343     AC G3XH02.1
#=GS D3GIJ7_HBV/1-352     AC D3GIJ7.1
#=GS H6WF58_HBV/1-112     AC H6WF58.1
#=GS B4YL66_HBV/1-239     AC B4YL66.1
#=GS D2JME5_HBV/1-352     AC D2JME5.1
#=GS Q9YKJ5_HBV/1-352     AC Q9YKJ5.1
#=GS G4XI75_HBV/1-160     AC G4XI75.1
#=GS Q4FDG7_HBV/1-352     AC Q4FDG7.1
#=GS B5BPT1_HBV/1-352     AC B5BPT1.1
#=GS D9U570_HBV/1-352     AC D9U570.1
#=GS I0C8N5_HBV/226-280   AC I0C8N5.1
#=GS D5LET0_HBV/1-352     AC D5LET0.1
#=GS Q5DW06_HBV/1-352     AC Q5DW06.1
#=GS I0C8K8_HBV/1-335     AC I0C8K8.1
#=GS D5MSG3_HBV/1-352     AC D5MSG3.1
#=GS D5LB54_HBV/1-352     AC D5LB54.1
#=GS F5C0U3_HBV/1-351     AC F5C0U3.1
#=GS Q8B4C6_HBV/1-341     AC Q8B4C6.1
#=GS E9L5E2_HBV/1-352     AC E9L5E2.1
#=GS I0DGG2_HBV/1-247     AC I0DGG2.1
#=GS Q77BF7_HBV/1-167     AC Q77BF7.1
#=GS I0DG94_HBV/1-352     AC I0DG94.1
#=GS B5M515_HBV/1-352     AC B5M515.1
#=GS D2JMW2_HBV/1-352     AC D2JMW2.1
#=GS E7FK66_HBV/1-352     AC E7FK66.1
#=GS I0C887_HBV/1-354     AC I0C887.1
#=GS D3TK69_HBV/1-348     AC D3TK69.1
#=GS G3XGX0_HBV/1-343     AC G3XGX0.1
#=GS Q7T7U6_HBV/1-341     AC Q7T7U6.1
#=GS B5TF10_HBV/1-112     AC B5TF10.1
#=GS Q9J0U4_HBV/1-341     AC Q9J0U4.1
#=GS Q20BP9_HBV/1-57      AC Q20BP9.1
#=GS H6UGI5_HBV/1-341     AC H6UGI5.1
#=GS A5LG94_HBV/1-352     AC A5LG94.1
#=GS B9VJY1_HBV/1-341     AC B9VJY1.1
#=GS I0C8E1_HBV/1-354     AC I0C8E1.1
#=GS Q9WKD2_HBV/1-354     AC Q9WKD2.1
#=GS Q8V1M4_HBV/1-352     AC Q8V1M4.1
#=GS D2JMV3_HBV/1-352     AC D2JMV3.1
#=GS H9XQT3_HBV/1-91      AC H9XQT3.1
#=GS B2Y6S9_HBV/1-354     AC B2Y6S9.1
#=GS I0DE76_HBV/1-328     AC I0DE76.1
#=GS Q1JUR8_HBV/1-354     AC Q1JUR8.1
#=GS F5C7N2_HBV/1-352     AC F5C7N2.1
#=GS A0FGR1_HBV/1-352     AC A0FGR1.1
#=GS Q81124_HBV/1-352     AC Q81124.1
#=GS H6UNA0_HBV/1-341     AC H6UNA0.1
#=GS B1NYA9_HBV/1-341     AC B1NYA9.1
#=GS B0FDB1_HBV/1-346     AC B0FDB1.1
#=GS H9XR74_HBV/1-91      AC H9XR74.1
#=GS D6QVG2_HBV/1-352     AC D6QVG2.1
#=GS H6UG59_HBV/1-341     AC H6UG59.1
#=GS Q6X7Z6_9HEPA/1-363   AC Q6X7Z6.1
#=GS B9VKG8_HBV/289-322   AC B9VKG8.1
#=GS F5C1Q6_HBV/1-341     AC F5C1Q6.1
#=GS A9PLI4_HBV/2-43      AC A9PLI4.1
#=GS F5C131_HBV/1-354     AC F5C131.1
#=GS G4XMJ1_HBV/1-352     AC G4XMJ1.1
#=GS I0DGA4_HBV/1-352     AC I0DGA4.1
#=GS Q8UYY1_HHBV/1-354    AC Q8UYY1.1
#=GS Q9YPU3_HBV/1-341     AC Q9YPU3.1
#=GS B7SXU2_HBV/1-351     AC B7SXU2.1
#=GS B5M5N1_HBV/1-352     AC B5M5N1.1
#=GS Q9DGY8_HBV/1-352     AC Q9DGY8.1
#=GS F5C1A4_HBV/1-354     AC F5C1A4.1
#=GS A7YET7_HBV/1-352     AC A7YET7.1
#=GS Q1XHF4_HBV/1-340     AC Q1XHF4.1
#=GS O91569_HBV/1-337     AC O91569.1
#=GS F5C138_HBV/1-354     AC F5C138.1
#=GS I0DCZ4_HBV/1-313     AC I0DCZ4.1
#=GS Q6XGW1_HBV/1-354     AC Q6XGW1.1
#=GS F5C0L7_HBV/1-354     AC F5C0L7.1
#=GS G4XIA1_HBV/1-130     AC G4XIA1.1
#=GS D6QW32_HBV/1-247     AC D6QW32.1
#=GS Q8JN11_HBV/1-341     AC Q8JN11.1
#=GS D2JM96_HBV/1-352     AC D2JM96.1
#=GS Q6Y5I8_HBV/1-352     AC Q6Y5I8.1
#=GS I0C8M1_HBV/1-335     AC I0C8M1.1
#=GS A9CM66_HBV/180-276   AC A9CM66.1
#=GS F5C116_HBV/280-320   AC F5C116.1
#=GS B9VKE4_HBV/1-352     AC B9VKE4.1
#=GS B5ATB4_HBV/1-346     AC B5ATB4.1
#=GS A5JHU8_HBV/1-112     AC A5JHU8.1
#=GS B5BPH7_HBV/1-352     AC B5BPH7.1
#=GS E0AD08_9HEPA/1-368   AC E0AD08.1
#=GS Q2LCB2_HBV/1-341     AC Q2LCB2.1
#=GS C6F569_HBV/1-354     AC C6F569.1
#=GS B0YK65_HBV/1-347     AC B0YK65.1
#=GS Q8QSD1_HBV/1-352     AC Q8QSD1.1
#=GS Q4FDH5_HBV/1-352     AC Q4FDH5.1
#=GS Q9QAG0_HBV/1-341     AC Q9QAG0.1
#=GS O91589_HBV/1-352     AC O91589.1
#=GS B9VKJ9_HBV/1-352     AC B9VKJ9.1
#=GS I0DDM8_HBV/1-328     AC I0DDM8.1
#=GS Q20BZ6_HBV/1-57      AC Q20BZ6.1
#=GS B5TFD3_HBV/1-112     AC B5TFD3.1
#=GS E9L2J0_HBV/1-354     AC E9L2J0.1
#=GS H2ERG2_HBV/1-281     AC H2ERG2.1
#=GS Q9IR24_HBV/1-174     AC Q9IR24.1
#=GS D0UDN9_HBV/1-352     AC D0UDN9.1
#=GS Q67942_HBV/1-170     AC Q67942.1
#=GS B9VKZ7_HBV/1-352     AC B9VKZ7.1
#=GS Q9IGV8_HBV/1-341     AC Q9IGV8.1
#=GS E0ZRY1_HBV/1-351     AC E0ZRY1.1
#=GS C3W3Q6_HBV/1-337     AC C3W3Q6.1
#=GS G9G9A4_HBV/1-333     AC G9G9A4.1
#=GS D2X4X8_HBV/2-172     AC D2X4X8.1
#=GS C3W488_HBV/1-341     AC C3W488.1
#=GS F5C7P6_HBV/1-352     AC F5C7P6.1
#=GS I0DC89_HBV/1-328     AC I0DC89.1
#=GS G1C8G2_HBV/1-341     AC G1C8G2.1
#=GS H6WFG6_HBV/1-112     AC H6WFG6.1
#=GS G1E8L8_HBV/1-341     AC G1E8L8.1
#=GS I0C8Z6_HBV/1-354     AC I0C8Z6.1
#=GS D3YGP0_HBV/1-341     AC D3YGP0.1
#=GS B5M5A8_HBV/1-336     AC B5M5A8.1
#=GS Q6UBK6_HBV/1-354     AC Q6UBK6.1
#=GS E5RDB3_HBV/1-341     AC E5RDB3.1
#=GS A3F6I9_HBV/1-354     AC A3F6I9.1
#=GS B2LW92_HBV/1-350     AC B2LW92.1
#=GS B5ASU2_HBV/1-352     AC B5ASU2.1
#=GS I0DCU8_HBV/1-325     AC I0DCU8.1
#=GS B5ATC3_HBV/1-346     AC B5ATC3.1
#=GS A9QPW9_HBV/1-351     AC A9QPW9.1
#=GS E5RPJ9_HBV/1-352     AC E5RPJ9.1
#=GS DPOL_DHBV1/51-413    AC P03162.2
#=GS D5LC69_HBV/1-352     AC D5LC69.1
#=GS I0C8U6_HBV/1-354     AC I0C8U6.1
#=GS E9L2U2_HBV/1-171     AC E9L2U2.1
#=GS C7AYL1_HBV/1-354     AC C7AYL1.1
#=GS D0E5K0_HBV/1-352     AC D0E5K0.1
#=GS I0C8Q1_HBV/1-341     AC I0C8Q1.1
#=GS H9XQH4_HBV/1-91      AC H9XQH4.1
#=GS E7EFD0_HBV/1-352     AC E7EFD0.1
#=GS H6V5R0_HBV/1-352     AC H6V5R0.1
#=GS G1E863_HBV/1-341     AC G1E863.1
#=GS C1K231_HBV/1-343     AC C1K231.1
#=GS D2JMU5_HBV/1-352     AC D2JMU5.1
#=GS DPOL_DHBV3/1-360     AC P0C691.1
#=GS B9VKJ5_HBV/1-352     AC B9VKJ5.1
#=GS I0C8Q7_HBV/1-341     AC I0C8Q7.1
#=GS I0C8V2_HBV/1-354     AC I0C8V2.1
#=GS H6WFL4_HBV/1-112     AC H6WFL4.1
#=GS F5C0J3_HBV/1-341     AC F5C0J3.1
#=GS D9U591_HBV/1-352     AC D9U591.1
#=GS H6WF46_HBV/1-112     AC H6WF46.1
#=GS Q2F501_HBV/1-274     AC Q2F501.1
#=GS D3TK76_HBV/1-338     AC D3TK76.1
#=GS C7DQR3_HBV/1-354     AC C7DQR3.1
#=GS D3YGB3_HBV/1-341     AC D3YGB3.1
#=GS B2CZU9_HBV/1-352     AC B2CZU9.1
#=GS Q5DVX8_HBV/1-351     AC Q5DVX8.1
#=GS F5C0K0_HBV/1-348     AC F5C0K0.1
#=GS D3TIS0_HBV/1-217     AC D3TIS0.1
#=GS I0DE44_HBV/1-328     AC I0DE44.1
#=GS Q6XGN4_HBV/1-354     AC Q6XGN4.1
#=GS D7R7X4_9HEPA/1-367   AC D7R7X4.1
#=GS I0C938_HBV/1-354     AC I0C938.1
#=GS Q9IXE1_HBV/1-52      AC Q9IXE1.1
#=GS A5JIL1_HBV/1-112     AC A5JIL1.1
#=GS E7CT88_HBV/1-352     AC E7CT88.1
#=GS Q9WJS9_HBV/1-352     AC Q9WJS9.1
#=GS C7DMC4_HBV/1-351     AC C7DMC4.1
#=GS G1E8A1_HBV/1-341     AC G1E8A1.1
#=GS Q20BZ8_HBV/1-55      AC Q20BZ8.1
#=GS B5M536_HBV/1-349     AC B5M536.1
#=GS I0DCP6_HBV/1-317     AC I0DCP6.1
#=GS D3TJC3_HBV/1-218     AC D3TJC3.1
#=GS B0FC83_HBV/1-352     AC B0FC83.1
#=GS A5JIM7_HBV/1-77      AC A5JIM7.1
#=GS B5LX83_HBV/1-341     AC B5LX83.1
#=GS B9VKS7_HBV/1-352     AC B9VKS7.1
#=GS I0C904_HBV/1-354     AC I0C904.1
#=GS D3TIS0_HBV/209-291   AC D3TIS0.1
#=GS B4ZYX2_HBV/1-341     AC B4ZYX2.1
#=GS C6F499_HBV/1-354     AC C6F499.1
#=GS I0C915_HBV/1-354     AC I0C915.1
#=GS D2JMV7_HBV/1-352     AC D2JMV7.1
#=GS G9G943_HBV/1-259     AC G9G943.1
#=GS E5RPX5_HBV/1-343     AC E5RPX5.1
#=GS B7TTP0_HBV/1-352     AC B7TTP0.1
#=GS F5C177_HBV/1-354     AC F5C177.1
#=GS D6QVJ6_HBV/1-352     AC D6QVJ6.1
#=GS D0VXG5_HBV/1-352     AC D0VXG5.1
#=GS D2JMI3_HBV/1-352     AC D2JMI3.1
#=GS C7AYX1_HBV/1-354     AC C7AYX1.1
#=GS DPOL_WMHBV/1-340     AC O71304.1
#=GS C7AYB7_HBV/1-354     AC C7AYB7.1
#=GS C7AYT0_HBV/1-354     AC C7AYT0.1
#=GS Q81111_HBV/1-352     AC Q81111.2
#=GS D5LC01_HBV/1-352     AC D5LC01.1
#=GS A5JHR6_HBV/1-112     AC A5JHR6.1
#=GS I0DDK9_HBV/1-328     AC I0DDK9.1
#=GS C5WK06_HBV/1-352     AC C5WK06.1
#=GS F5C0S8_HBV/1-333     AC F5C0S8.1
#=GS F5C0W8_HBV/1-354     AC F5C0W8.1
#=GS D5LFL5_HBV/1-352     AC D5LFL5.1
#=GS D9U5M6_HBV/1-341     AC D9U5M6.1
#=GS Q03765_9HEPA/1-363   AC Q03765.1
#=GS A5JIG7_HBV/1-112     AC A5JIG7.1
#=GS I0DCW3_HBV/1-328     AC I0DCW3.1
#=GS B2CSB9_HBV/1-352     AC B2CSB9.1
#=GS Q4FD41_HBV/1-352     AC Q4FD41.1
#=GS H9XRP0_HBV/1-91      AC H9XRP0.1
#=GS H9XQP1_HBV/1-91      AC H9XQP1.1
#=GS C1K227_HBV/287-330   AC C1K227.1
#=GS F5C081_HBV/1-352     AC F5C081.1
#=GS F2X0J5_HBV/1-352     AC F2X0J5.1
#=GS Q1PD04_HBV/1-352     AC Q1PD04.1
#=GS Q9J0U9_HBV/1-341     AC Q9J0U9.1
#=GS A9PLI5_HBV/2-43      AC A9PLI5.1
#=GS D2JMQ6_HBV/1-352     AC D2JMQ6.1
#=GS Q80GY9_HBV/1-341     AC Q80GY9.1
#=GS G0YVM3_HBV/1-249     AC G0YVM3.1
#=GS D2X3T4_HBV/13-161    AC D2X3T4.1
#=GS B5BPV4_HBV/1-337     AC B5BPV4.1
#=GS I0DGE3_HBV/1-352     AC I0DGE3.1
#=GS G9G9K1_HBV/1-341     AC G9G9K1.1
#=GS F4ZCB1_HBV/1-36      AC F4ZCB1.1
#=GS DPOL_HBVF2/1-352     AC Q8JMY4.1
#=GS F5C1P2_HBV/1-341     AC F5C1P2.1
#=GS I0DEA1_HBV/1-328     AC I0DEA1.1
#=GS B5AT20_HBV/1-352     AC B5AT20.1
#=GS Q65Z73_HBV/1-341     AC Q65Z73.1
#=GS E0ZRJ5_HBV/1-351     AC E0ZRJ5.1
#=GS G4XI91_HBV/1-54      AC G4XI91.1
#=GS O91585_HBV/1-342     AC O91585.1
#=GS I0DDL3_HBV/1-328     AC I0DDL3.1
#=GS F5C1K7_HBV/1-341     AC F5C1K7.1
#=GS Q80JA4_HBV/1-352     AC Q80JA4.1
#=GS G9G9T1_HBV/1-275     AC G9G9T1.1
#=GS I0C9G5_HBV/1-338     AC I0C9G5.1
#=GS I0DCX0_HBV/1-317     AC I0DCX0.1
#=GS I0C9H7_HBV/1-344     AC I0C9H7.1
#=GS G1E7N4_HBV/1-341     AC G1E7N4.1
#=GS I0C8L1_HBV/1-350     AC I0C8L1.1
#=GS H6WF22_HBV/1-112     AC H6WF22.1
#=GS Q5R2R5_HBV/1-341     AC Q5R2R5.1
#=GS B9VL37_HBV/1-352     AC B9VL37.1
#=GS Q4FDD9_HBV/1-352     AC Q4FDD9.1
#=GS Q9IXD5_HBV/1-52      AC Q9IXD5.1
#=GS F5C1B6_HBV/1-354     AC F5C1B6.1
#=GS F5C145_HBV/1-354     AC F5C145.1
#=GS B9VAY7_HBV/1-352     AC B9VAY7.1
#=GS D2JMT3_HBV/1-352     AC D2JMT3.1
#=GS I0C9B3_HBV/1-341     AC I0C9B3.1
#=GS I0C975_HBV/1-354     AC I0C975.1
#=GS I0C878_HBV/1-354     AC I0C878.1
#=GS F5C0K3_HBV/1-326     AC F5C0K3.1
#=GS G3XL97_HBV/1-352     AC G3XL97.1
#=GS Q7TDZ0_HBV/1-352     AC Q7TDZ0.1
#=GS B5TXL3_HBV/1-352     AC B5TXL3.1
#=GS I0C8R7_HBV/1-231     AC I0C8R7.1
#=GS Q4W6E0_HBV/1-351     AC Q4W6E0.1
#=GS I0C912_HBV/1-354     AC I0C912.1
#=GS B5MEW5_HBV/1-339     AC B5MEW5.1
#=GS Q9WRJ9_HBV/1-354     AC Q9WRJ9.1
#=GS Q9E945_HBV/1-342     AC Q9E945.1
#=GS I0DGH3_HBV/1-352     AC I0DGH3.1
#=GS B7TUK7_HBV/1-352     AC B7TUK7.1
#=GS I0DGJ7_HBV/1-352     AC I0DGJ7.1
#=GS G9G9J4_HBV/1-341     AC G9G9J4.1
#=GS D6QVE1_HBV/1-352     AC D6QVE1.1
#=GS I0C933_HBV/1-354     AC I0C933.1
#=GS F5C134_HBV/1-354     AC F5C134.1
#=GS A7L366_HBV/1-30      AC A7L366.1
#=GS C1K222_HBV/1-300     AC C1K222.1
#=GS Q9QBE2_HBV/1-352     AC Q9QBE2.1
#=GS Q99HU5_HBV/1-352     AC Q99HU5.1
#=GS H9XRD0_HBV/1-91      AC H9XRD0.1
#=GS I0C8W2_HBV/1-354     AC I0C8W2.1
#=GS Q5U7V7_HBV/1-341     AC Q5U7V7.1
#=GS Q2F516_HBV/1-341     AC Q2F516.1
#=GS Q404G6_HBV/1-341     AC Q404G6.1
#=GS B0YJS9_HBV/1-351     AC B0YJS9.1
#=GS D0EDU1_HBV/1-341     AC D0EDU1.1
#=GS D7NKU7_HBV/1-341     AC D7NKU7.1
#=GS Q67834_HBV/1-111     AC Q67834.1
#=GS H6UGK9_HBV/1-341     AC H6UGK9.1
#=GS A5YKK0_HBV/19-167    AC A5YKK0.1
#=GS B5M5Z1_HBV/1-352     AC B5M5Z1.1
#=GS D0UEA3_HBV/1-341     AC D0UEA3.1
#=GS Q2ABZ2_HBV/1-352     AC Q2ABZ2.1
#=GS I0DCF1_HBV/1-328     AC I0DCF1.1
#=GS B5M5V5_HBV/1-346     AC B5M5V5.1
#=GS I0C8C4_HBV/1-354     AC I0C8C4.1
#=GS Q4R1T8_HBV/1-351     AC Q4R1T8.1
#=GS B5ATD2_HBV/1-347     AC B5ATD2.1
#=GS E0ZRZ7_HBV/1-351     AC E0ZRZ7.1
#=GS Q20BN9_HBV/1-55      AC Q20BN9.1
#=GS B5AT75_HBV/1-352     AC B5AT75.1
#=GS D5LF25_HBV/1-352     AC D5LF25.1
#=GS F5C1B5_HBV/1-354     AC F5C1B5.1
#=GS D3TK10_HBV/288-317   AC D3TK10.1
#=GS Q4FDE3_HBV/1-352     AC Q4FDE3.1
#=GS Q9DTC5_HBV/1-352     AC Q9DTC5.1
#=GS G4XI31_HBV/1-160     AC G4XI31.1
#=GS Q3ZKR9_HBV/1-354     AC Q3ZKR9.1
#=GS A5JIM3_HBV/1-112     AC A5JIM3.1
#=GS Q9YZU3_HBV/1-336     AC Q9YZU3.1
#=GS Q9IXA8_HBV/1-52      AC Q9IXA8.1
#=GS C7DMH8_HBV/1-351     AC C7DMH8.1
#=GS D5LEN8_HBV/1-352     AC D5LEN8.1
#=GS I0DG96_HBV/1-352     AC I0DG96.1
#=GS G1E856_HBV/1-341     AC G1E856.1
#=GS I0DDD4_HBV/1-328     AC I0DDD4.1
#=GS Q7TG33_9HEPA/1-363   AC Q7TG33.1
#=GS F5C164_HBV/1-354     AC F5C164.1
#=GS Q9E9A8_HBV/1-352     AC Q9E9A8.1
#=GS E5RPQ5_HBV/1-343     AC E5RPQ5.1
#=GS E3VLB4_HBV/1-341     AC E3VLB4.1
#=GS D2JMY0_HBV/1-352     AC D2JMY0.1
#=GS H9XSZ0_HBV/1-84      AC H9XSZ0.1
#=GS G4XHY1_HBV/1-160     AC G4XHY1.1
#=GS D7NKL3_HBV/1-341     AC D7NKL3.1
#=GS Q5Q0T2_HBV/1-352     AC Q5Q0T2.1
#=GS I0DDU5_HBV/1-328     AC I0DDU5.1
#=GS B5M5L2_HBV/1-352     AC B5M5L2.1
#=GS DPOL_ASHV/1-388      AC Q64898.1
#=GS D6QVP1_HBV/1-351     AC D6QVP1.1
#=GS B5M539_HBV/1-348     AC B5M539.1
#=GS C6F4A6_HBV/1-354     AC C6F4A6.1
#=GS DPOL_HBVCJ/1-352     AC Q69028.2
#=GS D0UE27_HBV/1-343     AC D0UE27.1
#=GS B5M501_HBV/1-352     AC B5M501.1
#=GS A5GZI1_HBV/1-352     AC A5GZI1.1
#=GS F4ZCB7_HBV/1-49      AC F4ZCB7.1
#=GS D5LBK7_HBV/1-352     AC D5LBK7.1
#=GS B7TTT7_HBV/1-352     AC B7TTT7.1
#=GS G1C980_HBV/1-341     AC G1C980.1
#=GS F5C0R4_HBV/1-351     AC F5C0R4.1
#=GS E5RPS5_HBV/1-343     AC E5RPS5.1
#=GS D0E6L2_HBV/1-352     AC D0E6L2.1
#=GS D2JMR5_HBV/1-352     AC D2JMR5.1
#=GS B7TTI0_HBV/1-352     AC B7TTI0.1
#=GS B5M647_HBV/1-352     AC B5M647.1
#=GS B9VL72_HBV/207-315   AC B9VL72.1
#=GS G4XMK7_HBV/1-352     AC G4XMK7.1
#=GS B3VLL9_HBV/1-175     AC B3VLL9.1
#=GS F2WS80_HBV/1-352     AC F2WS80.1
#=GS Q918N7_9HEPA/1-393   AC Q918N7.1
#=GS F5C0K2_HBV/1-354     AC F5C0K2.1
#=GS G1E8I5_HBV/1-341     AC G1E8I5.1
#=GS C5WK22_HBV/1-352     AC C5WK22.1
#=GS H6UGS8_HBV/1-341     AC H6UGS8.1
#=GS E5D5M5_HBV/1-354     AC E5D5M5.1
#=GS D5LE07_HBV/1-352     AC D5LE07.1
#=GS D2U634_HBV/1-351     AC D2U634.1
#=GS G1C8E8_HBV/1-341     AC G1C8E8.1
#=GS A4UBL9_HBV/1-75      AC A4UBL9.1
#=GS C1K191_HBV/1-352     AC C1K191.1
#=GS C7AYD7_HBV/1-354     AC C7AYD7.1
#=GS A9QPU8_HBV/1-351     AC A9QPU8.1
#=GS Q2LCG0_HBV/1-341     AC Q2LCG0.1
#=GS G9G8U9_HBV/1-341     AC G9G8U9.1
#=GS F5C0I9_HBV/1-341     AC F5C0I9.1
#=GS A5JI71_HBV/1-112     AC A5JI71.1
#=GS A5JI55_HBV/1-112     AC A5JI55.1
#=GS I0DGH5_HBV/1-352     AC I0DGH5.1
#=GS Q5Q0S5_HBV/1-352     AC Q5Q0S5.1
#=GS B2LXP6_HBV/1-352     AC B2LXP6.1
#=GS Q20BU7_HBV/1-57      AC Q20BU7.1
#=GS D5LDQ5_HBV/1-352     AC D5LDQ5.1
#=GS I0C867_HBV/1-354     AC I0C867.1
#=GS G3E5B5_HBV/1-341     AC G3E5B5.1
#=GS B9VKN2_HBV/1-352     AC B9VKN2.1
#=GS I0DGF6_HBV/1-352     AC I0DGF6.1
#=GS D0EED9_HBV/1-354     AC D0EED9.1
#=GS C7DM92_HBV/1-351     AC C7DM92.1
#=GS I0C8L5_HBV/1-335     AC I0C8L5.1
#=GS I0C905_HBV/1-354     AC I0C905.1
#=GS H6WF34_HBV/1-112     AC H6WF34.1
#=GS E5F0V2_HBV/1-49      AC E5F0V2.1
#=GS I0C907_HBV/1-354     AC I0C907.1
#=GS B3V8T9_HBV/1-250     AC B3V8T9.1
#=GS B9VK94_HBV/1-352     AC B9VK94.1
#=GS D7NL82_HBV/1-341     AC D7NL82.1
#=GS A8J4G4_HBV/1-352     AC A8J4G4.1
#=GS Q91S85_HBV/1-220     AC Q91S85.1
#=GS A5JHT6_HBV/1-112     AC A5JHT6.1
#=GS D2U616_HBV/1-351     AC D2U616.1
#=GS H9XRB4_HBV/1-91      AC H9XRB4.1
#=GS Q67851_9HEPA/1-367   AC Q67851.1
#=GS G1E8H8_HBV/1-341     AC G1E8H8.1
#=GS B3VLM5_HBV/1-175     AC B3VLM5.1
#=GS Q5DW16_HBV/1-352     AC Q5DW16.1
#=GS Q8QZQ0_HBV/1-348     AC Q8QZQ0.1
#=GS G1C966_HBV/1-341     AC G1C966.1
#=GS H9XQJ0_HBV/1-91      AC H9XQJ0.1
#=GS Q9WRL0_HBV/1-354     AC Q9WRL0.1
#=GS B5M530_HBV/244-330   AC B5M530.1
#=GS B5TF34_HBV/1-112     AC B5TF34.1
#=GS C8C9S8_HBV/1-352     AC C8C9S8.1
#=GS B7TUQ5_HBV/1-352     AC B7TUQ5.1
#=GS G1C925_HBV/1-341     AC G1C925.1
#=GS C7DN23_HBV/1-351     AC C7DN23.1
#=GS F1AEY6_HBV/1-352     AC F1AEY6.1
#=GS H2ERD1_HBV/1-352     AC H2ERD1.1
#=GS G4XI61_HBV/1-160     AC G4XI61.1
#=GS F5C0T1_HBV/1-351     AC F5C0T1.1
#=GS Q2EIG5_HBV/1-352     AC Q2EIG5.1
#=GS D0E5N4_HBV/1-352     AC D0E5N4.1
#=GS A7J8K6_HBV/1-354     AC A7J8K6.1
#=GS Q9YQ40_HBV/1-167     AC Q9YQ40.1
#=GS B5BPJ7_HBV/1-352     AC B5BPJ7.1
#=GS C7AY39_HBV/1-354     AC C7AY39.1
#=GS G1E7Z4_HBV/1-341     AC G1E7Z4.1
#=GS DPOL_HBVB8/1-352     AC P0C676.1
#=GS B2LWB2_HBV/1-337     AC B2LWB2.1
#=GS H6WF98_HBV/1-112     AC H6WF98.1
#=GS B6CEV3_HBV/1-352     AC B6CEV3.1
#=GS Q6RSG7_9HEPA/1-366   AC Q6RSG7.1
#=GS Q4R1T5_HBV/1-351     AC Q4R1T5.1
#=GS H6WFG2_HBV/1-112     AC H6WFG2.1
#=GS B2CZH6_HBV/1-352     AC B2CZH6.1
#=GS I0C891_HBV/1-354     AC I0C891.1
#=GS A9PLI7_HBV/2-43      AC A9PLI7.1
#=GS H6UGN8_HBV/1-341     AC H6UGN8.1
#=GS I0C8A3_HBV/1-354     AC I0C8A3.1
#=GS B9VJX8_HBV/1-352     AC B9VJX8.1
#=GS B2LWA2_HBV/188-286   AC B2LWA2.1
#=GS D0E6B4_HBV/1-352     AC D0E6B4.1
#=GS B5ATB9_HBV/272-318   AC B5ATB9.1
#=GS O91582_HBV/1-279     AC O91582.1
#=GS C5WK30_HBV/1-352     AC C5WK30.1
#=GS Q4FDN0_HBV/1-341     AC Q4FDN0.1
#=GS H6UGU1_HBV/1-341     AC H6UGU1.1
#=GS B9VKT1_HBV/1-342     AC B9VKT1.1
#=GS H6WFL0_HBV/1-112     AC H6WFL0.1
#=GS G4XMM7_HBV/1-352     AC G4XMM7.1
#=GS I0C8G9_HBV/1-354     AC I0C8G9.1
#=GS F5C0P7_HBV/1-347     AC F5C0P7.1
#=GS D2N0Y6_HBV/1-354     AC D2N0Y6.1
#=GS E5RPQ3_HBV/1-343     AC E5RPQ3.1
#=GS A9CM57_HBV/1-352     AC A9CM57.1
#=GS I0C961_HBV/1-354     AC I0C961.1
#=GS Q9WFA2_9HEPA/1-365   AC Q9WFA2.1
#=GS Q4FD69_HBV/1-352     AC Q4FD69.1
#=GS I0C906_HBV/1-354     AC I0C906.1
#=GS O39877_HBV/1-352     AC O39877.1
#=GS D2JMI8_HBV/1-352     AC D2JMI8.1
#=GS D5LCE7_HBV/1-352     AC D5LCE7.1
#=GS DPOL_HBVC2/1-352     AC Q9YZR5.1
#=GS H9XRF4_HBV/1-91      AC H9XRF4.1
#=GS B2CSA6_HBV/1-352     AC B2CSA6.1
#=GS B7TV03_HBV/1-352     AC B7TV03.1
#=GS D5LF92_HBV/1-352     AC D5LF92.1
#=GS B2LWD9_HBV/1-287     AC B2LWD9.1
#=GS I0CF23_HBV/1-271     AC I0CF23.1
#=GS Q8JMZ3_HBV/1-352     AC Q8JMZ3.1
#=GS D6QVS3_HBV/1-352     AC D6QVS3.1
#=GS I0C8R5_HBV/1-341     AC I0C8R5.1
#=GS I0C996_HBV/1-341     AC I0C996.1
#=GS D0EEL8_HBV/1-354     AC D0EEL8.1
#=GS Q8V1M0_HBV/1-352     AC Q8V1M0.1
#=GS Q19T06_HBV/1-340     AC Q19T06.1
#=GS F5C0Z2_HBV/1-354     AC F5C0Z2.1
#=GS G4XMP3_HBV/1-352     AC G4XMP3.1
#=GS DPOL_HBVA6/1-347     AC Q91C36.1
#=GS B2LRU3_HBV/1-352     AC B2LRU3.1
#=GS D5MSJ1_HBV/1-332     AC D5MSJ1.1
#=GS Q3V648_HBV/1-352     AC Q3V648.1
#=GS Q20BY3_HBV/1-52      AC Q20BY3.1
#=GS I0DE80_HBV/1-328     AC I0DE80.1
#=GS C5WK34_HBV/1-352     AC C5WK34.1
#=GS H9XRE6_HBV/1-91      AC H9XRE6.1
#=GS I0C8R3_HBV/1-341     AC I0C8R3.1
#=GS B5B4D3_HBV/1-352     AC B5B4D3.1
#=GS Q8B5R1_HBV/1-203     AC Q8B5R1.1
#=GS Q80J74_HBV/280-314   AC Q80J74.1
#=GS D5LEB2_HBV/1-352     AC D5LEB2.1
#=GS H9XRK8_HBV/1-91      AC H9XRK8.1
#=GS Q5KR35_HBV/1-352     AC Q5KR35.1
#=GS H2ERI7_HBV/265-303   AC H2ERI7.1
#=GS F5C0Y9_HBV/1-354     AC F5C0Y9.1
#=GS D0EDW2_HBV/1-354     AC D0EDW2.1
#=GS A5JHS0_HBV/1-112     AC A5JHS0.1
#=GS B5B4K7_HBV/1-352     AC B5B4K7.1
#=GS C1K1V7_HBV/1-352     AC C1K1V7.1
#=GS G3XH30_HBV/1-230     AC G3XH30.1
#=GS G1E7M8_HBV/1-341     AC G1E7M8.1
#=GS I0DC47_HBV/1-328     AC I0DC47.1
#=GS D2JN10_HBV/1-112     AC D2JN10.1
#=GS G3XGU0_HBV/1-348     AC G3XGU0.1
#=GS H9XR14_HBV/1-91      AC H9XR14.1
#=GS Q5C830_HBV/1-352     AC Q5C830.1
#=GS D7NL41_HBV/1-341     AC D7NL41.1
#=GS G3XGZ4_HBV/1-343     AC G3XGZ4.1
#=GS G3XLC5_HBV/1-352     AC G3XLC5.1
#=GS H9XR26_HBV/1-91      AC H9XR26.1
#=GS D5LEM4_HBV/1-352     AC D5LEM4.1
#=GS C7DSM5_HBV/1-341     AC C7DSM5.1
#=GS I0DGG7_HBV/1-352     AC I0DGG7.1
#=GS D3GIL3_HBV/1-352     AC D3GIL3.1
#=GS I0C9F2_HBV/1-352     AC I0C9F2.1
#=GS B7TTD5_HBV/1-352     AC B7TTD5.1
#=GS C3W3R8_HBV/1-341     AC C3W3R8.1
#=GS B2WSR6_HBV/1-352     AC B2WSR6.1
#=GS B5ASP4_HBV/1-352     AC B5ASP4.1
#=GS Q7THP5_HBV/1-352     AC Q7THP5.1
#=GS A5JHW0_HBV/1-112     AC A5JHW0.1
#=GS D0E6A6_HBV/1-352     AC D0E6A6.1
#=GS C4RU79_HBV/1-341     AC C4RU79.1
#=GS Q20BS5_HBV/1-52      AC Q20BS5.1
#=GS H1ACZ2_HBV/1-352     AC H1ACZ2.1
#=GS I0C9C4_HBV/1-334     AC I0C9C4.1
#=GS F5C1N5_HBV/1-341     AC F5C1N5.1
#=GS B2CZT5_HBV/1-352     AC B2CZT5.1
#=GS Q9WRK5_HBV/1-354     AC Q9WRK5.1
#=GS G9G9T1_HBV/272-321   AC G9G9T1.1
#=GS I0C9G9_HBV/1-338     AC I0C9G9.1
#=GS A5JIL5_HBV/1-112     AC A5JIL5.1
#=GS E0ZRI1_HBV/1-351     AC E0ZRI1.1
#=GS B7TUU8_HBV/1-352     AC B7TUU8.1
#=GS I0C965_HBV/1-351     AC I0C965.1
#=GS Q4FDF5_HBV/1-352     AC Q4FDF5.1
#=GS F5C0X0_HBV/1-354     AC F5C0X0.1
#=GS E5RPT1_HBV/1-343     AC E5RPT1.1
#=GS G4XMH1_HBV/1-352     AC G4XMH1.1
#=GS G1E8B9_HBV/1-341     AC G1E8B9.1
#=GS C7G301_HBV/1-352     AC C7G301.1
#=GS C7AY45_HBV/1-354     AC C7AY45.1
#=GS A7YEX9_HBV/1-352     AC A7YEX9.1
#=GS A5A355_HBV/1-112     AC A5A355.1
#=GS I0C8X8_HBV/1-354     AC I0C8X8.1
#=GS B9VK67_HBV/1-352     AC B9VK67.1
#=GS Q81110_HBV/275-401   AC Q81110.1
#=GS B4YKS8_HBV/1-354     AC B4YKS8.1
#=GS B5M5M5_HBV/1-352     AC B5M5M5.1
#=GS Q20BY5_HBV/1-57      AC Q20BY5.1
#=GS D2JMU9_HBV/1-352     AC D2JMU9.1
#=GS B9VKZ3_HBV/1-352     AC B9VKZ3.1
#=GS Q2PWY0_HBV/1-354     AC Q2PWY0.1
#=GS F5C196_HBV/1-354     AC F5C196.1
#=GS G4XI01_HBV/1-160     AC G4XI01.1
#=GS Q2EID9_HBV/1-352     AC Q2EID9.1
#=GS D2JML8_HBV/1-352     AC D2JML8.1
#=GS E9L2F1_HBV/1-171     AC E9L2F1.1
#=GS E5RPU5_HBV/1-340     AC E5RPU5.1
#=GS B4YKU9_HBV/1-341     AC B4YKU9.1
#=GS I0DGD4_HBV/1-352     AC I0DGD4.1
#=GS I0DDS1_HBV/1-328     AC I0DDS1.1
#=GS E0ZRT5_HBV/1-351     AC E0ZRT5.1
#=GS F5C0X8_HBV/1-354     AC F5C0X8.1
#=GS I0C9G2_HBV/1-338     AC I0C9G2.1
#=GS H6WF26_HBV/1-112     AC H6WF26.1
#=GS B4YKP3_HBV/1-354     AC B4YKP3.1
#=GS I0DCA1_HBV/1-328     AC I0DCA1.1
#=GS D0UE72_HBV/1-352     AC D0UE72.1
#=GS H6WFF4_HBV/1-112     AC H6WFF4.1
#=GS Q8V1I8_HBV/1-352     AC Q8V1I8.1
#=GS Q4FD73_HBV/1-352     AC Q4FD73.1
#=GS B5TXM4_HBV/1-352     AC B5TXM4.1
#=GS B5BPI9_HBV/1-352     AC B5BPI9.1
#=GS Q4FD65_HBV/1-352     AC Q4FD65.1
#=GS F5C169_HBV/1-354     AC F5C169.1
#=GS G4XMB9_HBV/1-341     AC G4XMB9.1
#=GS Q9WP68_HBV/1-304     AC Q9WP68.1
#=GS D3Y5Q2_HBV/1-352     AC D3Y5Q2.1
#=GS E5RD29_HBV/1-352     AC E5RD29.1
#=GS F5C0P4_HBV/1-354     AC F5C0P4.1
#=GS B5TXI8_HBV/1-347     AC B5TXI8.1
#=GS D3TIQ6_HBV/1-352     AC D3TIQ6.1
#=GS E9L5G3_HBV/1-352     AC E9L5G3.1
#=GS A5JI44_HBV/1-112     AC A5JI44.1
#=GS D0UDS9_HBV/1-352     AC D0UDS9.1
#=GS B2LRX6_HBV/1-352     AC B2LRX6.1
#=GS D5LEI2_HBV/1-352     AC D5LEI2.1
#=GS Q6XGX5_HBV/1-354     AC Q6XGX5.1
#=GS B9VKE0_HBV/1-352     AC B9VKE0.1
#=GS Q9DH57_HBV/1-352     AC Q9DH57.1
#=GS I0DD48_HBV/1-328     AC I0DD48.1
#=GS C9WDF4_HBV/1-341     AC C9WDF4.1
#=GS C3W4D7_HBV/1-341     AC C3W4D7.1
#=GS I0DGI5_HBV/1-170     AC I0DGI5.1
#=GS B5TXJ8_HBV/1-352     AC B5TXJ8.1
#=GS B5BPZ0_HBV/1-350     AC B5BPZ0.1
#=GS A6MGC0_HBV/1-352     AC A6MGC0.1
#=GS Q0KG51_HBV/1-354     AC Q0KG51.1
#=GS D6QVP7_HBV/1-352     AC D6QVP7.1
#=GS Q306H1_HBV/1-352     AC Q306H1.1
#=GS E9L2G9_HBV/1-171     AC E9L2G9.1
#=GS G1E8L2_HBV/1-341     AC G1E8L2.1
#=GS Q7THQ0_HBV/1-352     AC Q7THQ0.1
#=GS C7AYQ0_HBV/1-354     AC C7AYQ0.1
#=GS B9VKI4_HBV/1-352     AC B9VKI4.1
#=GS B3V8U4_HBV/1-292     AC B3V8U4.1
#=GS A9CM70_HBV/1-352     AC A9CM70.1
#=GS H9XR62_HBV/1-91      AC H9XR62.1
#=GS H6V5I4_HBV/1-352     AC H6V5I4.1
#=GS A5JI29_HBV/1-112     AC A5JI29.1
#=GS G4XIB7_HBV/1-124     AC G4XIB7.1
#=GS D0VXI1_HBV/1-352     AC D0VXI1.1
#=GS C7DNG3_HBV/1-351     AC C7DNG3.1
#=GS B5M621_HBV/1-352     AC B5M621.1
#=GS F5C118_HBV/1-285     AC F5C118.1
#=GS G9HNQ9_HBV/2-159     AC G9HNQ9.1
#=GS H6V5S6_HBV/1-352     AC H6V5S6.1
#=GS F5C128_HBV/1-354     AC F5C128.1
#=GS Q77BH0_HBV/1-167     AC Q77BH0.1
#=GS C3W4D0_HBV/1-345     AC C3W4D0.1
#=GS Q5U7Q4_HBV/1-341     AC Q5U7Q4.1
#=GS Q3V644_HBV/1-352     AC Q3V644.1
#=GS Q9IXA5_HBV/1-52      AC Q9IXA5.1
#=GS D3YGS0_HBV/1-341     AC D3YGS0.1
#=GS B5TF49_HBV/1-112     AC B5TF49.1
#=GS Q80SD3_HBV/1-345     AC Q80SD3.1
#=GS Q1JUU2_HBV/1-352     AC Q1JUU2.1
#=GS C1K200_HBV/1-240     AC C1K200.1
#=GS DPOL_HBVG3/1-351     AC Q9IBI4.1
#=GS Q6XGP1_HBV/1-354     AC Q6XGP1.1
#=GS B5M4Z8_HBV/1-352     AC B5M4Z8.1
#=GS I0C8L4_HBV/1-335     AC I0C8L4.1
#=GS D0EDX5_HBV/1-354     AC D0EDX5.1
#=GS B4ZYU3_HBV/1-352     AC B4ZYU3.1
#=GS H9XQN7_HBV/1-91      AC H9XQN7.1
#=GS Q8B5P9_HBV/1-200     AC Q8B5P9.1
#=GS I0DDV7_HBV/1-328     AC I0DDV7.1
#=GS B2LWD9_HBV/284-317   AC B2LWD9.1
#=GS C7DM44_HBV/1-351     AC C7DM44.1
#=GS B7TUW0_HBV/1-352     AC B7TUW0.1
#=GS D0ESQ8_HBV/1-352     AC D0ESQ8.1
#=GS F5C0Q2_HBV/1-347     AC F5C0Q2.1
#=GS Q9E8L4_HBV/1-352     AC Q9E8L4.1
#=GS B5B496_HBV/1-239     AC B5B496.1
#=GS Q9QRQ7_HBV/136-178   AC Q9QRQ7.1
#=GS Q004A5_HBV/1-352     AC Q004A5.1
#=GS B5M5G5_HBV/1-352     AC B5M5G5.1
#=GS I0C8R8_HBV/226-280   AC I0C8R8.1
#=GS C7AYL3_HBV/1-354     AC C7AYL3.1
#=GS DPOL_HBVC0/1-352     AC Q9E6S5.1
#=GS Q3ZKP9_HBV/1-351     AC Q3ZKP9.1
#=GS O09505_HBV/1-212     AC O09505.1
#=GS G1E7L0_HBV/1-341     AC G1E7L0.1
#=GS C3W3X8_HBV/1-341     AC C3W3X8.1
#=GS D3GIM1_HBV/1-352     AC D3GIM1.1
#=GS B5TXN8_HBV/1-352     AC B5TXN8.1
#=GS C3W3S4_HBV/1-341     AC C3W3S4.1
#=GS D8VCL9_HBV/1-302     AC D8VCL9.1
#=GS Q1XHE2_HBV/1-341     AC Q1XHE2.1
#=GS D0E690_HBV/1-352     AC D0E690.1
#=GS I0C8R1_HBV/1-341     AC I0C8R1.1
#=GS G4XHX5_HBV/1-160     AC G4XHX5.1
#=GS D0E5Q7_HBV/1-352     AC D0E5Q7.1
#=GS D0EE60_HBV/1-354     AC D0EE60.1
#=GS O09517_HBV/206-310   AC O09517.1
#=GS Q8B4G2_HBV/1-279     AC Q8B4G2.1
#=GS B9VKY9_HBV/1-352     AC B9VKY9.1
#=GS E5RPW3_HBV/1-343     AC E5RPW3.1
#=GS Q00K88_HBV/1-352     AC Q00K88.1
#=GS Q6YLM0_HBV/1-352     AC Q6YLM0.1
#=GS F5C1F2_HBV/1-341     AC F5C1F2.1
#=GS D7NL61_HBV/1-341     AC D7NL61.1
#=GS C7DNE2_HBV/1-345     AC C7DNE2.1
#=GS B5TFC9_HBV/1-112     AC B5TFC9.1
#=GS D0E648_HBV/1-352     AC D0E648.1
#=GS I0C9B7_HBV/1-334     AC I0C9B7.1
#=GS H6WFK2_HBV/1-112     AC H6WFK2.1
#=GS G1E8F3_HBV/1-341     AC G1E8F3.1
#=GS I0C8Z3_HBV/1-354     AC I0C8Z3.1
#=GS F5C0U9_HBV/1-354     AC F5C0U9.1
#=GS C3W4I7_HBV/1-341     AC C3W4I7.1
#=GS B1A0B1_HBV/1-352     AC B1A0B1.1
#=GS D5LCM1_HBV/1-352     AC D5LCM1.1
#=GS G1E895_HBV/1-341     AC G1E895.1
#=GS C6KGU1_HBV/1-352     AC C6KGU1.1
#=GS C5WJU6_HBV/1-352     AC C5WJU6.1
#=GS F5C0Y7_HBV/1-354     AC F5C0Y7.1
#=GS A5LGA6_HBV/1-352     AC A5LGA6.1
#=GS D3TJC9_HBV/205-306   AC D3TJC9.1
#=GS Q9E8K2_HBV/1-341     AC Q9E8K2.1
#=GS B5TF85_HBV/1-112     AC B5TF85.1
#=GS A9CM74_HBV/1-352     AC A9CM74.1
#=GS Q6UBJ4_HBV/1-354     AC Q6UBJ4.1
#=GS H6UN64_HBV/1-341     AC H6UN64.1
#=GS Q9IX99_HBV/1-52      AC Q9IX99.1
#=GS G3E580_HBV/1-341     AC G3E580.1
#=GS E0ZR80_HBV/1-351     AC E0ZR80.1
#=GS I0C889_HBV/1-354     AC I0C889.1
#=GS B5B4K0_HBV/1-352     AC B5B4K0.1
#=GS D5LBY9_HBV/1-352     AC D5LBY9.1
#=GS D0E5A3_HBV/1-352     AC D0E5A3.1
#=GS Q8B8Q8_HBV/1-341     AC Q8B8Q8.1
#=GS C3W3N9_HBV/1-341     AC C3W3N9.1
#=GS F1CFC9_HBV/1-341     AC F1CFC9.1
#=GS Q20BQ1_HBV/1-56      AC Q20BQ1.1
#=GS B2Y6S2_HBV/1-354     AC B2Y6S2.1
#=GS D0E5H2_HBV/1-352     AC D0E5H2.1
#=GS Q9E6R8_HBV/1-352     AC Q9E6R8.1
#=GS H2ER70_HBV/1-352     AC H2ER70.1
#=GS Q1JUT0_HBV/1-334     AC Q1JUT0.1
#=GS B8PTC4_HBV/1-341     AC B8PTC4.1
#=GS F5C0U6_HBV/1-354     AC F5C0U6.1
#=GS G4XMG3_HBV/1-352     AC G4XMG3.1
#=GS Q99HT7_HBV/1-352     AC Q99HT7.1
#=GS E5RD53_HBV/1-352     AC E5RD53.1
#=GS I0DC74_HBV/1-328     AC I0DC74.1
#=GS B5M5W1_HBV/1-352     AC B5M5W1.1
#=GS B5BPL7_HBV/1-352     AC B5BPL7.1
#=GS I0C9C0_HBV/1-334     AC I0C9C0.1
#=GS I0C877_HBV/1-354     AC I0C877.1
#=GS D5LDB4_HBV/1-352     AC D5LDB4.1
#=GS H9XQK0_HBV/1-91      AC H9XQK0.1
#=GS D3YGE9_HBV/1-341     AC D3YGE9.1
#=GS Q918N4_9HEPA/1-393   AC Q918N4.1
#=GS F5C1A0_HBV/1-354     AC F5C1A0.1
#=GS D5LBL4_HBV/1-352     AC D5LBL4.1
#=GS E5CZ50_HBV/1-352     AC E5CZ50.1
#=GS I0DG97_HBV/1-352     AC I0DG97.1
#=GS D5LB75_HBV/1-352     AC D5LB75.1
#=GS B9VKJ2_HBV/1-273     AC B9VKJ2.1
#=GS Q9WP59_HBV/268-322   AC Q9WP59.1
#=GS E1U7M3_HBV/1-341     AC E1U7M3.1
#=GS G1E7K3_HBV/1-341     AC G1E7K3.1
#=GS B0FCA6_HBV/1-345     AC B0FCA6.1
#=GS I0DD52_HBV/1-328     AC I0DD52.1
#=GS Q2F505_HBV/1-341     AC Q2F505.1
#=GS A5JI67_HBV/1-112     AC A5JI67.1
#=GS A7M688_HBV/1-344     AC A7M688.1
#=GS D0EDU8_HBV/1-341     AC D0EDU8.1
#=GS B5BUV2_HBV/1-354     AC B5BUV2.1
#=GS A0FDJ7_HBV/1-352     AC A0FDJ7.1
#=GS F5C0N0_HBV/1-354     AC F5C0N0.1
#=GS F5C0Y8_HBV/1-354     AC F5C0Y8.1
#=GS D5LDK8_HBV/1-352     AC D5LDK8.1
#=GS C3W433_HBV/1-341     AC C3W433.1
#=GS Q58W12_HBV/1-352     AC Q58W12.1
#=GS D9U1L5_HBV/1-352     AC D9U1L5.1
#=GS I0C8P9_HBV/1-341     AC I0C8P9.1
#=GS B5MEX3_HBV/1-352     AC B5MEX3.1
#=GS Q7THS7_HBV/1-352     AC Q7THS7.1
#=GS A5JHY8_HBV/1-112     AC A5JHY8.1
#=GS E3Q0I9_HBV/1-352     AC E3Q0I9.1
#=GS H9XQI2_HBV/1-91      AC H9XQI2.1
#=GS Q6UBK2_HBV/1-341     AC Q6UBK2.1
#=GS B5M4Z3_HBV/1-346     AC B5M4Z3.1
#=GS G3E552_HBV/1-341     AC G3E552.1
#=GS B3IWU7_HBV/1-352     AC B3IWU7.1
#=GS G1E870_HBV/1-341     AC G1E870.1
#=GS Q8B6N3_HBV/1-352     AC Q8B6N3.1
#=GS Q8B5Q2_HBV/1-190     AC Q8B5Q2.1
#=GS B0FCL9_HBV/1-352     AC B0FCL9.1
#=GS Q06AN0_HBV/1-352     AC Q06AN0.1
#=GS D6QW25_HBV/1-352     AC D6QW25.1
#=GS G1C8T6_HBV/1-341     AC G1C8T6.1
#=GS B5ASS4_HBV/1-352     AC B5ASS4.1
#=GS B3VLI1_HBV/1-176     AC B3VLI1.1
#=GS A5GZH7_HBV/1-352     AC A5GZH7.1
H9XRG9_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
G9G9S0_HBV/1-206                .......................MPLSYQHFRRLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPYWKTPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKSGILYKRETTHSASFCGSPYSWEQE.--LQRGA---.--------ESFHQQSSGILSRP......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------pvgsslqsk.......................
H9XQZ9_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHIHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
B5B4C7_HBV/1-235                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLYTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQHQT---.--STRHGDKSFCSQSSGILSRS......--------.----------...-...-PVGPG...VRSQLKQSRLGLQPQ...QGSLARGKSG----------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------ha..............................
A7L372_HBV/1-30                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-------------------CWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
B5M5I1_HBV/209-314              .................pvgpcv-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..----RSQLK.QSRGSRHIHNSA.SSTSSCLHQSAV.RKTAYS.HL.ST.SKRQ..S..SS....GHAVE.FHNIPPSSARPQSEGPILSCWWLQFRNS.KPCSDYCLAHIVNLLEDWGPC................................
G4XI26_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNANLA.SKSASCLYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSAGSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
F5C1B3_HBV/1-75                 .......................MPLSYQHFRKLLL.....LDDET---EAGPLEEELPRLADADLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPIFNPE---------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------................................
H6WFM8_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCIHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
H6WF62_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHTTNLA.SKSASRLYQSPV.RKAAYT.SV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20BX1_HBV/1-55                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHHFPPNSSRSQSQGPVLSCWWLQFRNS.EPCSEYCLCHIVNLIEDWG--................................
A5JIH1_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCIYQSPV.REATYP.AV.ST.FERH..S..SS....SHAVE.FHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
E5F0X3_HBV/1-49                 ......................f-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HSFSPSSARSQSQGPVFSCWWLQFRNT.QPCSQYCLSHLVNLLEDWGPC................................
H9XQM1_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNASRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
E5F0Y0_HBV/1-49                 .....................ln-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.--PVPPGSVGSQGKGSVPPCWWLQFRDT.EPCSDYCLSHIINLLEDWGPC................................
A8IES5_HBV/1-52                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....---VE.LNPVPPGSVGSQGKGSVLPCWWLQFRDT.EPCSDYCLSHIINLLEDWGPC................................
H9XR98_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
A5JI87_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSSSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
D3TIJ9_HBV/284-316              .....................aa-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.------------------SCWWLQFRDS.EPCSEYCLCHIVNLIDDWGPC................................
C1K159_HBV/1-239                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQHGRLVF.QTSTRHGDKSFCSQSSGILSRS......--------.----------...-...-PVGPC...VRSQLKQSRLGLQPQ...QGSLARGNS-----------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------gh..............................
F5C115_HBV/280-320              ......................q-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.---------SAQSQGSVVSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
G4XHW7_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGVH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..A..SS....GHAVE.LHNRPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
H9XR90_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LX.ST.SKRH..S..SS....GHAVE.LHHFPSNSSRSQSQGSVXSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
Q9IF49_HBV/1-172                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----HGRLVF.QTSERHGDKSFCPQSPGILPRS......--------.----------...-...-SVGPC...IQSQLRNSRLGPQPA...QGQLAGRQQGGSGSIRARVH..PSPWGTVGV.EPSGSGHTYNCA.SSSSFCLHQSAV.RKTAYS.LI.ST.SKGH..S..SS....GHEVE.LPHFPPNSSRSQSQGPVLSCWWLQFRNS.EPCSEYCLCHIVNLIEDWGPC................................
B3GED9_HBV/1-33                 ......................v-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-----------------FPCWWLQFRSS.KPCSDYCLSLIVNLLEDWGPC................................
E5F0Y3_HBV/1-46                 ......................l-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----PPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
H6WFD0_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WNIRAGIH..PTARRPPGV.EPSGSGHNTNLA.SKSASCIYQSPV.RKAAYP.AV.ST.FERH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCISHIVNLLQDWGPC................................
G4XI63_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNANLA.SKSASCLYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20BV7_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNIPPSSARPQSEGPIFSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
G4XHZ6_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
Q2F501_HBV/271-320              ...............srllllpi-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-------ASQSQSERPVSPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XI80_HBV/1-54                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
B5TFG5_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNCA.SKSASCLHQSPV.RKAAYP.DL.ST.FERH..S..SS....GHAVE.LHNLPPNSARSQSERAVFPCWWLQFRNS.QPCSDYCLSLIVNLLEDWGPC................................
A5JIK3_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSTSCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....SHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
A5JI17_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRAGIH..STPWGTVGV.EPSSSGHTHNCA.NNSSSCLHQSAG.RKEAYS.PV.ST.SKRH..S..SS....GHAVE.LHHVPPNSSRSQSQGSVLSCWWLQFRNS.KPCSEHCLFHIVNLIEDWGPC................................
H9XQL1_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNXA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKRH..S..SS....GHTVE.LHHFPSNXSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLXDWGPC................................
A7L371_HBV/1-30                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-------------------CWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
G4XI49_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHTTNLA.SKSASCLYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
B5TF22_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
H9XQD4_HBV/1-91                 ......................s-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.-----GHIDNST.SSASSCLHQSAV.RKTAYS.HL.ST.SKRQ..S..SS....GHAVE.LQHIPPSSARSQSEGPILSCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
B5TF93_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPSGL.EPSGSGHTTNVA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..A..SS....GHAVE.LHNLPPNSARSQSEGPVFSCWWLQFRNS.KPCSDYCISHIVNLLEDWGPC................................
Q8BC37_HBV/1-31                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.------------------SCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20BR3_HBV/1-56                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..SS....GHAVE.LHHFPPNSSRSQSQGPVLSCWWLQFRNS.EPCSEYCLCHIVNLSK-----tgdpt...........................
G1E7Q9_HBV/198-316              ...................pvgs-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-----------SLQSKHRKSrlGLQSQQVGV.EPSGSGHTTNLA.SKSASCLYQSPV.RKAAYP.AV.ST.FEKH..A..SS....GHAVE.LHNLPPSSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
H6WF86_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCKHQSPV.RKAAYP.AV.ST.FERH..S..SS....GHAVE.LHNFPPNSARSQGERPVLPCWWLQFRNS.KPCSDYCLSHIVNLLQDWGPC................................
H9XQI6_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNGA.SSASSCLHQSAV.RKAAYS.HI.ST.SKGH..S..SS....GHAVE.LXHFPSNSSRSQSKGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
H6WFM1_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SNTASCIYQSPV.RKTAYP.AV.ST.FERH..S..SS....GHAVE.LHKFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
F4ZCA9_HBV/1-49                 ......................f-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HNLPPGSVGSEGKGSVFSCWWLQFRDT.EPCSDYCLSHIINLLEDWGPC................................
G3EQX6_HBV/1-48                 ......................h-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.--SFSPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
G3XH30_HBV/224-309              .....................rg-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.-----------A.SKSASCLHQAPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSAKSQSERPVFPCWWLQFRNS.KPCSDHCLSLIVNLLEDWGPC................................
B5TFJ7_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSVRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPD.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLSPNSARSQSERPVFPCWWLQFRSS.KPCSDYCLSLIVNLLEDWGPC................................
B3VLJ0_HBV/1-176                .....................qd-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--LQHGRLVI.KTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQLKQSRLGLQPH...QGPLASSQPGRSGSIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
G4XHZ9_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSTV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
E5F0V9_HBV/1-49                 ......................l-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
G4XI98_HBV/1-54                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
H9XRK4_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTRNCA.SNTSSCLHQSAV.RKAAYS.LI.ST.SKGH..A..SS....GHAVE.HHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
D3TK04_HBV/1-246                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLHEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQHGRLVF.PTSTRHGDESFCSQSSGILSRS......--------.----------...-...-PVGPG...VRSQLKQSRLGLQPQ...LGSLARGKSGHK--------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------velhni..........................
B5TF81_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFRV.EPSGSGHTTNVA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
C1K1K9_HBV/1-73                 .......................MPLSYQHFRKLLL.....LDDDA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPE---------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------................................
B5U8G8_HBV/34-99                ................fgansnn-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..-------PD.WDSGSGHIDNSA.SSPSSCLHQSAV.RTAAYS.HL.ST.SKRQ..S..SS....GHTVE.T---------------------------.---------------------tfhqalldpr......................
H9XQM9_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSKSQGSILSCWWLQFRNR.EPCSEYCLCHIVNLLEDWGPC................................
B1ABR0_HBV/1-236                .......................MPLSYQHFRKLLL.....LDVEA-----GPLEEELPRLADEGLNRRV.........AEDLKLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPDWQTPTFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQQTS---.---TRHGDESFRSQSSGILSRS......--------.----------...-...-PVGPC...VRSQLKQSRLGLQPQ...QGSLARGESGRT--------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------ss..............................
A5JI79_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSVRAGIH..PTARRPFGV.ESSGSGHNANIT.SKSASCIYQSPV.RKTAYP.AV.ST.FEKH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XHY6_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCLYQAPV.RKAAYP.AD.ST.FERH..S..SS....GHAVE.LNNLPPNSARSQGERPVSPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XIB0_HBV/1-130                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------LGLQYK...KGHLARRQQGRSWSIRAGVH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..A..SS....GHAVE.FHNRPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
B1ABL4_HBV/1-238                .......................MPLSYQHFRKLLL.....LDVEA-----GPLEEELPRLADEGLNRRV.........AEDLKLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQHGRLVF.QTSTRHGDESFCSQSSGILSRS......--------.----------...-...-PVGPG...VQSQLKQSRLGLQPQ...QGSLARGKS-----------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------g...............................
Q9IR30_HBV/1-174                .....................el-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----HHGAFL.DGPSRMGEESFHHQSSGIFSRP......--------.----------...-...-PVGSS...IQSKHQKSRLGPQSQ...QRPLDGSQQGRSGSIRAGVH..SPTRRPFGV.EPSGSRHAKNIA.SRSASCLHQSAV.RKAAYP.NH.ST.FERH..S..SS....GHAVE.FHNIPPSSAGSQSKRPVFSCWWLQFRNS.EPCSDHCLTHLVNLLEDWGPC................................
E9L2R8_HBV/1-171                ....................grl-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--------VS.QTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQFKQSRLGLQPH...QGPLATSQPGRSGSIRPRVH..SPTRRCFGV.EPSGSGHIGYSA.SSTSHCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHSFPPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
G4XI65_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRSGFH..PTARRPFGV.EPSGSGHTTNFA.NKTASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
G4XIC1_HBV/1-114                ................lglqsqq-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-----------------GHL..ARRQQGRSW.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPEFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
H6WFD4_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHTTNLP.SKSASCLYQSQV.RKAAYP.SV.ST.FEKH..T..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20C04_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.FHNIPPSSARPQSEGPILPCWWLQFXNS.KPCSDYCLTHIVNLLEDWGPC................................
B4ZYW8_HBV/1-230                .......................MPLSYQHFRRLLL.....LDNEA-----GPLEEDLPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVENFTGLYSSTVPVFNPNWKTPSFPNIHLHQDIIKKCDQFVGSLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTHSASFCGSPYSWEQE.--LQHGA---.--------ESFHQQSSGILSRP......--------.----------...-...-PVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGH---------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------av..............................
A5JI63_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
G9HNR1_HBV/2-159                .........esfhqqssgilsrp-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...-PVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.TV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
E9L2S0_HBV/1-171                ....................grl-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--------VS.QTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQFKQSRLGLQPH...QGPLATSQPGRSGSIRPRVH..SPTRRCFGV.EPSGSGHIGYSA.SSSSHCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHSFPPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
I0DGH9_HBV/1-253                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKRETTRSASFCG-PYSWEQE.-LQHHGRLVF.QTSTRHGDESFCSQPSGILSRS......--------.----------...-...-PVGPC...IRSQFKQSRLGLQPQ...QGSMASGTPGRSGILRARVH..STTR-----.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------q...............................
Q20BT9_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHHFPPNSSRSQSQGPIPSCWWLQFRNS.EPCSEYCLCHIVNLIEDWGPC................................
Q2F512_HBV/227-312              ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----------RT.CKSASCLHQAPV.RKAAYP.TV.ST.FERH..S..SS....GHAVE.LHNLPPNSARSQSERPEFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
A5JIT6_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.LHCLPPNSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
I0DDR1_HBV/245-280              ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.--------------SSSSSCWWLQFRNS.EPCSEYCLCHIVNLIEDWGPC................................
A5JHZ2_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
H9XRW5_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKRH..S..SS....GHAVE.LHNFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLGHIVNLLEDWGPC................................
H9XQY7_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SRHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGL..S..SS....GHXVE.HHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLGHIVNLLDDWGPC................................
B3VLH5_HBV/1-165                ..................qdlqh-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.------GAESFHQQSSGILSRP......--------.----------...-...-PVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCIYQSPV.RKAAYP.AV.ST.LEKH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
H6WFI6_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCIYQSPD.RKAAYP.TV.SA.FENH..S..SS....GHAVE.LHNFPPNSTRSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20BW3_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNIPPSSARPQSEGPILSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGA-l...............................
Q67908_HBV/1-49                 ......................l-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
A4UBL5_HBV/1-63                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.ST.FEKH..S..SS....GRAVE.LHNLQPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
E9L2T4_HBV/1-171                ....................grl-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--------VS.QTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQFKQSRLGLQPH...QGPLATSQPGRSGSIRPRVH..SPTRRCFGV.EPSGSGHIGYSA.SSTSHCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHSFPPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
Q7THR7_HBV/243-314              ................ghidnsa-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.-----S.-S.TS.SCLH..Q..SA....GHAVE.LHNIPPSSARPQSEGPIPSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
Q9WP81_HBV/1-214                .......................MPLSYQHFRKLLL.....LDDGT---EAGPLEEELPRLADADLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQTRHYLHTLWKAGILYKRGTTRSASFCGSPYSWEQE.--LQHGRLVT.KTSQRHGDESFCSQPSGILSRS......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------svgh............................
H6WFD8_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHTTNVA.SKSASCLHQSPV.RKAAYS.AV.ST.FERH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
E5F0W3_HBV/1-49                 ......................f-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
A5JIN8_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLYQSTV.GKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
A5JID1_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLNQSSV.RKAAYP.AV.ST.FERH..S..SS....GHAVE.LHNLPSNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
Q9QRQ9_HBV/136-174              .......................MPLSYQHFRKLLL.....LDDET---EAGPLEEELPRLADEDLNR--.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------pr..............................
B5TFK5_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRDGFH..PTARRPFGM.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
E9L2P3_HBV/1-171                ....................grl-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--------VS.QTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQFKQSRLGLQPH...QGPLATSQPGRSGSIRPRVH..SPTRRCFGV.EPSGSGHIGYSA.SSTSHCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHSFPPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
C3W494_HBV/231-308              ......................t-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------LHQSSV.KQAAYP.AV.ST.FKKH..S..SS....GHAVE.LHNLPSNSARSQSERPVSPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
H6WFJ3_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGVH..PTARRPFGV.EPSGSGHNTNPA.SKSASCIYQSPV.REAAYP.AV.ST.FERH..A..SS....GHAVE.FHNFSPNSARSQSERPVFSCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
B5TFI1_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.DPSGSGHNTNLA.SKSASCIYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNFPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
C9WDI5_HBV/251-295              ......................p-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-----SHSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHIVNLREDWGPC................................
D3TJC9_HBV/1-209                .......................MPLSYQHFRKLLL.....LDDDA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPSFNPQWQTPSFPDIHLQEDIINRCKQFVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQQTS---.---TRHGDKSFRPQSAGILSRS......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------pvgpciq.........................
B3V8T9_HBV/240-330              ....................sgs-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.-------IDNSA.SSTSSCLHQSAG.RKTAYS.HF.ST.SKRQ..S..SS....GHAVE.LHNIPPSSARPQSEGPIPSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
Q20BU9_HBV/1-55                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.FHNIPPSSARPQSEGPILSCWWLQFRNS.KPCSDYCLTHIVNLLEDWG--................................
B3VLJ9_HBV/1-176                .....................qd-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--LQHGRLVI.KTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQLKQSRLGLQPH...QGPLASSQPGRSGSIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
B5M5B0_HBV/1-238                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEHE.--LQHGRLVF.QTSTRHGDKSFCSQSSGILSRS......--------.----------...-...-PVGPC...VRSQLKQPRLGLQPQ...QGSLARGKS-----------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------g...............................
Q67908_HBV/271-390              ..llslgihlngaesfhqqssgi-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.------------------LSRP......--------.----------...-...-PVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNTNLA.SKSASCIYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.----------------------------.---------------------................................
Q20BX7_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNIPPSSARSQSEGPIFSCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
I0C8R9_HBV/1-231                .......................MPLSYQHFRRLLL.....LDDDA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQK.--LQHGA---.--------ESVHQQSSGILSRP......--------.----------...-...-PVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGHA--------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------ve..............................
D3YG15_HBV/233-317              ....................ihp-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.-KSASCLYPSPV.RKAANP.AD.ST.FERH..S..SS....GYAVE.FHNLPPNSARSQSDKPISPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
A5JHW8_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARVH..SPTRRCFGV.EPSGSGHIGHSA.SSSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHSFPPSSARSQSQGPVLSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
Q20BQ5_HBV/1-57                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.FHHFPPNSSRSQSQGPVLSCWWLQFRNS.EPCSEYCLCHIVNLIEDWGS-d...............................
A5JHU0_HBV/1-112                ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKEAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
I0C8Q6_HBV/226-280              ......................q-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....GHAVE.LHNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q9IX81_HBV/1-35                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....---VE.LNNLPSNSARSQSERPVFPCWWLQFRNS.KPCS-----------------................................
G8CQJ4_HBV/1-49                 ......................f-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-HSFSPSSARSQSQGPVFSCWWLQFRNT.QPCSKYCLSHLVNLLEDWGPC................................
G4XI11_HBV/1-159                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHNANLA.SKSASCLYQSPV.RKAAYP.AV.ST.FERH..S..SS....-HAVE.LNNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XI23_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGVH..PTARRPFGV.EPSGTGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
G1C8B4_HBV/270-319              .....................vr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-NNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XHW3_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRTGFH..PTARRSFGV.EPSGSGHTTNLA.SKSASCLHQSPV.GKAAYP.AV.ST.FERH..S..SS....GHAVE.FHNFPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
Q2EX95_HBV/1-68                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.RSASSCLHQAAV.KKTAYS.HL.ST.SKRQ..S..SS....GHAVE.----------------LQPCWWLKFRNR.KPCSDYCLSHIVNLLEDWGPC................................
H9XQL4_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHICA.SSTSSCLHQSAV.RTAAYS.LI.ST.SKGH..S..SS....GRAVE.LQNFPSDSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIINLLEDWGPC................................
B9VJX0_HBV/1-240                .......................MPLSYQHFRKLLL.....LDDDA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYSWEQE.--LQHGRLVF.QTSTRHGDKSFCSQSSGILSRS......--------.----------...-...-PVGPG...VRSQLKQSRLGLQPQ...QGSLARGKSG----------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------ha..............................
G4XI83_HBV/1-54                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
Q20C16_HBV/1-55                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNIPPSSARPQSEGPILSCWWLQFRNS.KPCSEYCLTHMVSLLEDWG--................................
F5C114_HBV/279-320              ......................h-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.--------QSAQSQGSVVSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
Q20BW9_HBV/1-55                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNIPPSSARSQSEGPLFSCWWLQFRNS.KPCSDYCLTHIVNLLEDWG--................................
Q20BX3_HBV/1-55                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..SS....GHAVE.LHHIPPSSVRPQSEGPILSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGP-................................
H6WFN6_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPPGSGHTTNCA.SKSTSYLHQSSV.KKAAYP.AV.ST.FERH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
B9VKJ2_HBV/264-303              .....................hi-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-----------DNSASSTSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
D2X5F1_HBV/13-171               .........gqsfcpqspgilpr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...SSVGPC...IQSQLKKSRLGPQPA...QGQLAGRQQGGSGSIRARVH..PSPWGTVGV.EPSGSGHTHNCA.SSSSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....SHAVE.LHNFPPNSSRSQSQGPVLSCWWLQFRNS.EPCSEYCLCHIVNLIEDWGPC................................
C1K1P3_HBV/1-174                .......................MPLSYQHFRKLLL.....LDDEA-----GPLEEELPRLADEGLNRRV.........AEDLNLG.NLNV.SIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRETTRSASFCGSPYS----.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.----------------------------.---------------------................................
Q9IXE4_HBV/1-52                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....---VE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
C7DMP5_HBV/1-30                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-------------------CWWLQFRNS.KPCSEYCLSHLVNLLEDWGPC................................
B5TF41_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPD.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLSPNSARSQSERPVFPCWWLQFRSS.KPCSDYCLSHIVNLLEDWGPC................................
D3TJD5_HBV/205-305              ..............vgpciqsql-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.---RQSRSHNCA.SSSSSCLHQSAG.RKEAYS.PV.ST.SKRH..S..SS....GRAVE.LHHVPPNSSRSQSQGSVLSCWWLQFRNS.EPCSEHCLFHIVNLIEDWGPC................................
A8IER8_HBV/1-52                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....---VE.FHNIPPNSAGSQSKRPVFSCWWLQFRNS.EPCSDYCLTHLVNLLEDWGPC................................
H9XR50_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNCA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSQSQGSVLSCWWLQFRNS.EPCSEYCLCHIINLLEDWGPC................................
I0C8R7_HBV/226-280              ......................q-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....GHAVE.LHNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
A5JI13_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPD.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLSPNSARSQSERPVFPCWWLQFRSS.KPCSDYCLSLIVNLLEDWGPC................................
B5TFL7_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPD.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLSPNSARSQSERPVFPCWWLQFRSS.KPCSDYCLSLIVNLLEDWGPC................................
G4XI27_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QRHLARRQQGRSWSIRAGIH..PTARRPFGV.EPSGSGHTTNLA.SKSASCLYQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
A5JJ26_HBV/67-125               ....................trg-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..KS....GHAVE.FHNIPPSSARPQSEGPILSCWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
I0DGK7_HBV/263-352              ...........xxxxxxxxxxxx-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.-----XXXQSAV.RKTAYS.XL.ST.SKRQ..S..SS....GHXVE.LQXIPPSSARSQSEGPILSCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
G4XI15_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSIRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
A5JI11_HBV/1-88                 ......................g-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...-------------SIRARVH..PPTRRCFGV.EPSGSGHIGHSA.SSSSSCLHQSAV.RKAAYS.HR.ST.SKRQ..S..SS....GHAME.FHSFPPSSAGGSSSGTL-----------.---------------------npvpnias........................
F5C119_HBV/280-320              ......................q-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.---------SAQSQGSVVSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
G4XI29_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGPLARCQQGRSWSIRAGFH..PTARRPFGV.EPSGSGHTTHFA.SKSASCLRQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.FHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
H9XQX6_HBV/1-91                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.----SGHTHNRA.SSTSSCLHQSAV.RKAAYS.LI.ST.SKGH..S..SS....GHAVE.LHHFPSNSSRSKSQGSVLSCWWLQFRNS.EPCSEYCLCHIVNLLEDWGPC................................
Q9IXE7_HBV/1-52                 ......................a-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....---VE.LHYLPPNSARSQGERPVFPCWWLQFRNS.KPCSDYCLSHIVNLLEDWGPC................................
D3TIL0_HBV/284-316              .....................aa-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.------------------SCWWLQFRDS.EPCSEYCLCHIVNLIDDWGPC................................
Q20BY7_HBV/1-56                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..S..SS....GHAVE.LHNLPPSPARSQSEGPIFSCWWLQFRNS.KPCSDYCLSHIVNLLEDWGP-................................
F5C118_HBV/280-320              ......................q-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.---------SAQSQGSVVSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
G4XHY9_HBV/1-160                ........gaesfhqqssgilsr-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...PPVGSS...LQSKHRKSRLGLQSQ...QGHLARRQQGRSWSLRAGFH..PTARRPFGV.EPSGSGHTTNFA.SKSASCLHQSPV.RKAAYP.AV.ST.FEKH..S..SS....GHAVE.LHNLPPNSARSQSERPVFPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................
B3VLJ6_HBV/1-176                .....................qd-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.--LQHGRLVI.KTSQRHGDESFCSQPSGILSRS......--------.----------...-...-SVGPC...IRSQLKQSRLGLQPH...QGPLASSQPGRSGSIRARAH..PSTRRYFGV.EPSGSGHIDHSV.NNSSSCLHQSAV.RKAAYS.HL.ST.SKRQ..S..SS....GHAVE.FHCLPPSSAGSQSQGSVFSCWWLQFRNS.KPCSEYCLSHLVNLREDWGPC................................
H6WF38_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGIH..PTARRPFGV.EPSGSGHNTNLT.SKSTSCIYQSPV.KKEAYP.AV.ST.FEKH..S..SS....GHAVE.LHNFPSNSARSQGERPVFPCWWLQFRNS.NPCSDYCLSHIVNLLEDWGPC................................
Q91IF5_HBV/2-161                ..........cdesfcsqssgil-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.-------------------S--......--------.----------...R...SPVGPC...VRSQLTQSRLGLQPQ...QGSLARGKSGRSGSIRARVH..PTTRRSFGV.EPAGSGRIDNRA.SSTSSCLHQSAV.RKTAYS.HL.ST.SKRQ..S..SS....GHAVE.LHNIPPSSARPQSEGPILSCWWLQFXNS.KPCSDYCLTHIVNLLEDWGPC................................
A7L367_HBV/1-30                 .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...--------------------..---------.------------.------------.------.--.--.----..-..--....-----.-------------------CWWLQFRNS.KPCSDYCLTHIVNLLEDWGPC................................
B5TFI9_HBV/1-112                .......................-------------.....-----------------------------.........-------.----.----------------------------------------------------------------------------------------------------------------------------------.----------.----------------------......--------.----------...-...------...---------------...------------WSIRAGFH..PTARRPFGV.EPSGSGHTTNCA.SKSASCLHQSTV.RKAADP.AL.ST.FEKH..S..SS....GHAVE.FHNLPPNSARSQSEGPVSPCWWLQFRNS.KPCSDYCLSLIVNLLEDWGPC................................