GenomeNet

Database: Pfam
Entry: DUF1147
LinkDB: DUF1147
Original site: DUF1147 
#=GF ID   DUF1147
#=GF AC   PF06615.6
#=GF DE   Protein of unknown function (DUF1147)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_20563 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   32.70 53.20;
#=GF NC   20.20 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009527;
#=GF CC   This family consists of several short Circovirus proteins of
#=GF CC   unknown function.
#=GF SQ   8
#=GS Q77GS3_PCV2/1-59  AC Q77GS3.1
#=GS NS0_PCV2/1-23     AC Q8BB12.1
#=GS Q9YQS9_PCV2/1-59  AC Q9YQS9.1
#=GS Q9YQX2_PCV2/1-59  AC Q9YQX2.1
#=GS Q9YIU3_PCV2/1-59  AC Q9YIU3.1
#=GS Q9YR12_PCV2/1-59  AC Q9YR12.1
#=GS O92288_PCV2/1-59  AC O92288.1
#=GS Q77S04_PCV2/1-59  AC Q77S04.1
Q77GS3_PCV2/1-59             MYTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
NS0_PCV2/1-23                ------------------------------------MVTMVKKWLLLMTFMAGCRGMIY
Q9YQS9_PCV2/1-59             MYTSLWGHLGVAKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
Q9YQX2_PCV2/1-59             MSTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
Q9YIU3_PCV2/1-59             MYTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
Q9YR12_PCV2/1-59             MYTSLWGHLGVAKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMVGCRGMIY
O92288_PCV2/1-59             MYTSLWGHLGVVKANGLLILQTRKPHTGNHLKTSGGMVTMVKKWLLLMTFMAGCRGMIY
Q77S04_PCV2/1-59             MYTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
#=GC seq_cons                MYTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY
//
DBGET integrated database retrieval system