GenomeNet

Database: Pfam
Entry: DUF1359
LinkDB: DUF1359
Original site: DUF1359 
#=GF ID   DUF1359
#=GF AC   PF07097.9
#=GF DE   Protein of unknown function (DUF1359)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_14784 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   35.40 148.00;
#=GF NC   21.60 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR010772;
#=GF CC   This family consists of several hypothetical bacterial and phage
#=GF CC   proteins of around 100 residues in length. Members of this
#=GF CC   family seem to be found exclusively in Lactococcus lactis and
#=GF CC   the bacteriophages that infect this species. The function of
#=GF CC   this family is unknown.
#=GF SQ   3
#=GS Q9CIA5_LACLA/1-97    AC Q9CIA5.1
#=GS Q9CIA3_LACLA/28-129  AC Q9CIA3.1
#=GS Q9CGR3_LACLA/1-97    AC Q9CGR3.1
Q9CIA5_LACLA/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK
Q9CIA3_LACLA/28-129             MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE
Q9CGR3_LACLA/1-97               MPQEITIdfSEQIAKVQTKIARLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK
#=GC seq_cons                   MsQEITIDFSEQIAKlQTKIsRLKDMIHDVRDQ....KIVLDDIKNNHMPRDTKLELNLG...GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK
//
DBGET integrated database retrieval system