GenomeNet

Database: Pfam
Entry: DUF1359
LinkDB: DUF1359
Original site: DUF1359 
#=GF ID   DUF1359
#=GF AC   PF07097.7
#=GF DE   Protein of unknown function (DUF1359)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_14784 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   35.40 131.10;
#=GF NC   22.60 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR010772;
#=GF CC   This family consists of several hypothetical bacterial and phage
#=GF CC   proteins of around 100 residues in length. Members of this
#=GF CC   family seem to be found exclusively in Lactococcus lactis and
#=GF CC   the bacteriophages that infect this species. The function of
#=GF CC   this family is unknown.
#=GF SQ   17
#=GS Q9AZ70_9CAUD/1-97    AC Q9AZ70.1
#=GS T0W4S3_LACLL/1-102   AC T0W4S3.1
#=GS Q9AZZ2_9CAUD/1-97    AC Q9AZZ2.1
#=GS Q9AZN4_9CAUD/1-97    AC Q9AZN4.1
#=GS Q02XP6_LACLS/1-97    AC Q02XP6.1
#=GS T0WJF7_LACLL/1-97    AC T0WJF7.1
#=GS Q9AZN2_9CAUD/28-129  AC Q9AZN2.1
#=GS Q9CIA5_LACLA/1-97    AC Q9CIA5.1
#=GS Q9CIA3_LACLA/28-129  AC Q9CIA3.1
#=GS V2WAU2_LACLL/28-129  AC V2WAU2.1
#=GS Q9CGR3_LACLA/1-97    AC Q9CGR3.1
#=GS V2WHV5_LACLL/1-97    AC V2WHV5.1
#=GS U5PU42_LACLL/1-97    AC U5PU42.1
#=GS T0UXU4_LACLL/1-97    AC T0UXU4.1
#=GS O53058_9LACT/1-97    AC O53058.1
#=GS V2WEV1_LACLL/1-97    AC V2WEV1.1
#=GS T0VC20_LACLL/1-102   AC T0VC20.1
Q9AZ70_9CAUD/1-97               MPQEITVdfSEQIAKTQTKIDRLQKLIHHVRNQ----KIVLDDFKNNHISTDTKFELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTVLINELAKELGIDIK.
T0W4S3_LACLL/1-102              MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE.
Q9AZZ2_9CAUD/1-97               MPQEITIdfSEQIAKVQTKIARLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
Q9AZN4_9CAUD/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
Q02XP6_LACLS/1-97               MPQEITVdfSEQIAKTQTKIDRLQKLIHHVRNQ----KIVLDDFKNNHISTDTKFELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTVLINELAKELGIDIK.
T0WJF7_LACLL/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
Q9AZN2_9CAUD/28-129             MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE.
Q9CIA5_LACLA/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
Q9CIA3_LACLA/28-129             MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE.
V2WAU2_LACLL/28-129             MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE.
Q9CGR3_LACLA/1-97               MPQEITIdfSEQIAKVQTKIARLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
V2WHV5_LACLL/1-97               MPQEITIdfSEQIAKVQTKIARLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
U5PU42_LACLL/1-97               MPQEITVdfSEQIAKVQTKIARLKDMIHDVRDQ----KIVLDDIKNNHIPRDTKLGFNLG---GVLKCFVKIDVGTLIPLLEQNIEDNTALIHELAKELGIEV-v
T0UXU4_LACLL/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
O53058_9LACT/1-97               MPQEITVdfSEQIAKTQTKIDRLQKLIHHVRNQ----KIVLDDFKNNHISTDTKFELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTVLINELAKELGIDIK.
V2WEV1_LACLL/1-97               MSQEITVdfSEQIAKAQTKIDRLKDMIHDVRDQ----KIVLDDIKNNHMPRDTKLELNLG---GVLKCSVKINVGTLIPLLEQNIEDNTALIHELAKELGIDIK.
T0VC20_LACLL/1-102              MLSETKI..RRNIETIEQKTCRLKNVIHAIKRQTELVELLEDKLQSGEIKKTDKFGAELTDRFSFFESNFNIPVGTLISLLKDNIEGNTTIASELVAKLGIEVE.
#=GC seq_cons                   MsQEITlDFSEQIAKsQTKIsRLKchIHcVRcQ....KIVLDDlKNNHhs+DTKhELNLG...GVLKCSVKINVGTLIPLLEQNIEDNTsLIpELAKELGIDIK.
//
DBGET integrated database retrieval system