GenomeNet

Database: Pfam
Entry: DUF1386
LinkDB: DUF1386
Original site: DUF1386 
#=GF ID   DUF1386
#=GF AC   PF07138.9
#=GF DE   Protein of unknown function (DUF1386)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_16196 (release 10.0)
#=GF GA   21.40 21.40;
#=GF TC   807.80 807.60;
#=GF NC   20.30 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009815;
#=GF CC   This family consists of several hypothetical
#=GF CC   Nucleopolyhedrovirus proteins of around 350 residues in length.
#=GF CC   The function of this family is unknown.
#=GF SQ   1
#=GS Q773I6_NPVR1/1-334  AC Q773I6.1
Q773I6_NPVR1/1-334             MSLAAKLIVYNYYAKYNEVHDVYGESYHHYRIVQEYLSESYVNGMSCIERDVTAMRRLKSGSCTFDEAVKMIDACDSIKSLSHWFSTSEMMGINDNVREVLEQIDAVVPVSVRVQNGWQIFSLNNFEREISQDMLDCLQIILGRFEYFMRNGKLLRLSTVFNPNNNVVGWWYNKFCVVTYVHRIMYQSVPAELAPRLSEAVKKFIRLRKSDYDDRLHLDESYNCPRVIAEIYGRFCGIGKEHFSKHKLSCMHILFQYLRGKTTQEEESFPCYRVIKDFGRQCKDVYKNLKDVFDVLHAHSMSDKDKNSLMDLLCVMDCEEIDVDCFYYIFEAFL
#=GC seq_cons                  MSLAAKLIVYNYYAKYNEVHDVYGESYHHYRIVQEYLSESYVNGMSCIERDVTAMRRLKSGSCTFDEAVKMIDACDSIKSLSHWFSTSEMMGINDNVREVLEQIDAVVPVSVRVQNGWQIFSLNNFEREISQDMLDCLQIILGRFEYFMRNGKLLRLSTVFNPNNNVVGWWYNKFCVVTYVHRIMYQSVPAELAPRLSEAVKKFIRLRKSDYDDRLHLDESYNCPRVIAEIYGRFCGIGKEHFSKHKLSCMHILFQYLRGKTTQEEESFPCYRVIKDFGRQCKDVYKNLKDVFDVLHAHSMSDKDKNSLMDLLCVMDCEEIDVDCFYYIFEAFL
//
DBGET integrated database retrieval system