GenomeNet

Database: Pfam
Entry: DUF1391
LinkDB: DUF1391
Original site: DUF1391 
#=GF ID   DUF1391
#=GF AC   PF07151.7
#=GF DE   Protein of unknown function (DUF1391)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_16216 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   32.20 76.00;
#=GF NC   22.70 21.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009821;
#=GF CC   This family consists of several Enterobacterial proteins of
#=GF CC   around 50 residues in length. Members of this family are found
#=GF CC   in Escherichia coli and Salmonella typhi where they are often
#=GF CC   known as YdfA. The function of this family is unknown.
#=GF SQ   588
#=GS H5J2F6_ECOLX/2-50    AC H5J2F6.1
#=GS F1YBP7_ECO57/29-77   AC F1YBP7.1
#=GS H4RSY5_ECOLX/2-50    AC H4RSY5.1
#=GS E8Y8E6_ECOKO/2-50    AC E8Y8E6.1
#=GS E7IMT7_ECOLX/2-50    AC E7IMT7.1
#=GS H5CMF5_ECOLX/2-50    AC H5CMF5.1
#=GS H4P4M3_ECOLX/2-50    AC H4P4M3.1
#=GS E7TUA3_ECO57/2-50    AC E7TUA3.1
#=GS E7HZU2_ECOLX/2-50    AC E7HZU2.1
#=GS F1YBE4_ECO57/2-50    AC F1YBE4.1
#=GS B5YSQ1_ECO5E/2-50    AC B5YSQ1.1
#=GS Q7ACT6_ECO57/2-50    AC Q7ACT6.1
#=GS E9UM64_ECOLX/2-50    AC E9UM64.1
#=GS C8TS24_ECO26/2-50    AC C8TS24.1
#=GS B6ZTP1_ECO57/2-50    AC B6ZTP1.1
#=GS H4QIL8_ECOLX/2-50    AC H4QIL8.1
#=GS H4P6U1_ECOLX/2-50    AC H4P6U1.1
#=GS D7XPU3_ECOLX/2-50    AC D7XPU3.1
#=GS H5G6K0_ECOLX/2-50    AC H5G6K0.1
#=GS C6UR76_ECO5T/28-76   AC C6UR76.1
#=GS F4LZV1_ECOLX/29-77   AC F4LZV1.1
#=GS B7LHL1_ECO55/54-102  AC B7LHL1.1
#=GS H4VEI4_ECOLX/2-50    AC H4VEI4.1
#=GS H4NPS2_ECOLX/2-50    AC H4NPS2.1
#=GS A7ZKN7_ECO24/29-77   AC A7ZKN7.1
#=GS H5K023_ECOLX/29-77   AC H5K023.1
#=GS I0VP99_ECOLX/2-50    AC I0VP99.1
#=GS H4RVJ7_ECOLX/2-50    AC H4RVJ7.1
#=GS H5IUA3_ECOLX/2-50    AC H5IUA3.1
#=GS H5AW98_ECOLX/29-77   AC H5AW98.1
#=GS B3B4H3_ECO57/2-50    AC B3B4H3.1
#=GS G1ZIX3_ECOLX/2-50    AC G1ZIX3.1
#=GS B3B6U0_ECO57/2-50    AC B3B6U0.1
#=GS H1F4T4_ECOLX/2-50    AC H1F4T4.1
#=GS G2F9A1_ECOLX/2-50    AC G2F9A1.1
#=GS B3X3M5_SHIDY/2-50    AC B3X3M5.1
#=GS E7I3R1_ECOLX/29-71   AC E7I3R1.1
#=GS G7RMT2_ECOC1/29-77   AC G7RMT2.1
#=GS E7H881_ECOLX/31-64   AC E7H881.1
#=GS H4SC04_ECOLX/2-50    AC H4SC04.1
#=GS E7II79_ECOLX/2-50    AC E7II79.1
#=GS H4WSB5_ECOLX/29-77   AC H4WSB5.1
#=GS E6BR75_ECOLX/20-68   AC E6BR75.1
#=GS B3B7A9_ECO57/2-50    AC B3B7A9.1
#=GS H4J6K7_ECOLX/2-50    AC H4J6K7.1
#=GS F1YBA2_ECO57/2-50    AC F1YBA2.1
#=GS B1IR17_ECOLC/2-50    AC B1IR17.1
#=GS E6A941_ECOLX/29-77   AC E6A941.1
#=GS E7J2R2_ECOLX/2-50    AC E7J2R2.1
#=GS D2ABD4_SHIF2/20-68   AC D2ABD4.1
#=GS H5PGX7_ECOLX/2-50    AC H5PGX7.1
#=GS C5W504_ECOBD/2-50    AC C5W504.2
#=GS H4STL1_ECOLX/29-77   AC H4STL1.1
#=GS D8ETL0_ECOLX/2-50    AC D8ETL0.1
#=GS E6BN63_ECOLX/2-50    AC E6BN63.1
#=GS C8U502_ECO10/29-77   AC C8U502.1
#=GS H5R6P7_ECOLX/29-77   AC H5R6P7.1
#=GS H5B9K4_ECOLX/2-50    AC H5B9K4.1
#=GS G2ATP5_ECOLX/29-77   AC G2ATP5.1
#=GS B2PTX4_ECO57/2-50    AC B2PTX4.1
#=GS B2NWG9_ECO57/28-76   AC B2NWG9.1
#=GS D3QTS9_ECOCB/28-76   AC D3QTS9.1
#=GS G5XQS2_ECOLX/29-77   AC G5XQS2.1
#=GS H5KNZ2_ECOLX/2-50    AC H5KNZ2.1
#=GS H5DH78_ECOLX/2-50    AC H5DH78.1
#=GS C2DWU3_ECOLX/2-50    AC C2DWU3.1
#=GS E6B899_ECOLX/29-77   AC E6B899.1
#=GS H5HPB2_ECOLX/2-50    AC H5HPB2.1
#=GS H4ZEX7_ECOLX/2-50    AC H4ZEX7.1
#=GS E2KT66_ECO57/29-77   AC E2KT66.1
#=GS H4YH97_ECOLX/29-77   AC H4YH97.1
#=GS H4LB03_ECOLX/29-77   AC H4LB03.1
#=GS E3XMV1_ECOLX/29-77   AC E3XMV1.1
#=GS G1Z4N8_ECOLX/2-50    AC G1Z4N8.1
#=GS H4JWR1_ECOLX/2-50    AC H4JWR1.1
#=GS H4RCE0_ECOLX/2-50    AC H4RCE0.1
#=GS H4Y119_ECOLX/2-50    AC H4Y119.1
#=GS B6IA71_ECOSE/2-50    AC B6IA71.1
#=GS H4J1N4_ECOLX/2-50    AC H4J1N4.1
#=GS B3AS51_ECO57/2-50    AC B3AS51.1
#=GS H4QBM8_ECOLX/2-50    AC H4QBM8.1
#=GS D3QX46_ECOCB/54-102  AC D3QX46.1
#=GS H5NPC0_ECOLX/54-102  AC H5NPC0.1
#=GS C8ULJ9_ECO1A/31-79   AC C8ULJ9.1
#=GS H4PGJ8_ECOLX/2-50    AC H4PGJ8.1
#=GS E7TV42_ECO57/2-50    AC E7TV42.1
#=GS E1S4V3_ECOUM/29-77   AC E1S4V3.1
#=GS E8HFW7_ECOLX/29-68   AC E8HFW7.1
#=GS F8YF21_ECOLX/2-50    AC F8YF21.1
#=GS G2D076_ECOLX/2-50    AC G2D076.1
#=GS H4KFI9_ECOLX/2-50    AC H4KFI9.1
#=GS E6BSX9_ECOLX/29-77   AC E6BSX9.1
#=GS E9WE41_ECOLX/2-50    AC E9WE41.1
#=GS H5QTW3_ECOLX/2-50    AC H5QTW3.1
#=GS H5E0R3_ECOLX/29-77   AC H5E0R3.1
#=GS D7Z7Q0_ECOLX/2-50    AC D7Z7Q0.1
#=GS C8U3V8_ECO10/2-50    AC C8U3V8.1
#=GS D3QSB4_ECOCB/2-50    AC D3QSB4.1
#=GS H4M928_ECOLX/2-50    AC H4M928.1
#=GS E7IAW1_ECOLX/28-76   AC E7IAW1.1
#=GS F4TDS6_ECOLX/2-50    AC F4TDS6.1
#=GS H5EF56_ECOLX/2-50    AC H5EF56.1
#=GS E8HTK8_ECOLX/2-50    AC E8HTK8.1
#=GS H4YG00_ECOLX/2-50    AC H4YG00.1
#=GS B3IN08_ECOLX/2-50    AC B3IN08.1
#=GS C8U723_ECO10/37-85   AC C8U723.1
#=GS G0D4I2_ECOLX/2-44    AC G0D4I2.1
#=GS Q8FIL2_ECOL6/29-77   AC Q8FIL2.1
#=GS G2AEW1_ECOLX/2-50    AC G2AEW1.1
#=GS E8IZQ0_ECOLX/2-50    AC E8IZQ0.1
#=GS D7JQ42_ECOLX/20-68   AC D7JQ42.1
#=GS E8HUX8_ECOLX/29-68   AC E8HUX8.1
#=GS E9WY00_ECOLX/20-68   AC E9WY00.1
#=GS G1Z648_ECOLX/2-50    AC G1Z648.1
#=GS B3AC68_ECO57/2-50    AC B3AC68.1
#=GS B5YWK0_ECO5E/28-76   AC B5YWK0.1
#=GS G1Z213_ECOLX/2-50    AC G1Z213.1
#=GS B3WUZ4_ECOLX/2-50    AC B3WUZ4.1
#=GS B7A3U3_ECO57/2-50    AC B7A3U3.1
#=GS Q1RCG9_ECOUT/29-77   AC Q1RCG9.1
#=GS H4VFW3_ECOLX/29-77   AC H4VFW3.1
#=GS D8ABG9_ECOLX/28-76   AC D8ABG9.1
#=GS H5GSA0_ECOLX/2-50    AC H5GSA0.1
#=GS B3BPI7_ECO57/28-76   AC B3BPI7.1
#=GS B3IDK1_ECOLX/29-77   AC B3IDK1.1
#=GS G1Y8I9_ECOLX/2-50    AC G1Y8I9.1
#=GS H5GAA2_ECOLX/29-77   AC H5GAA2.1
#=GS H5JHM4_ECOLX/2-50    AC H5JHM4.1
#=GS G5W297_ECOLX/29-77   AC G5W297.1
#=GS G2CJG1_ECOLX/2-50    AC G2CJG1.1
#=GS F3LXI4_ECOLX/29-77   AC F3LXI4.1
#=GS G5TWL5_ECOLX/29-77   AC G5TWL5.1
#=GS E2KL39_ECO57/2-50    AC E2KL39.1
#=GS E6BBV7_ECOLX/29-77   AC E6BBV7.1
#=GS D8C4L1_ECOLX/1-35    AC D8C4L1.1
#=GS B6IB05_ECOSE/29-77   AC B6IB05.1
#=GS E3PJU4_ECOH1/29-77   AC E3PJU4.1
#=GS B2PTF1_ECO57/2-50    AC B2PTF1.1
#=GS D6IQ54_ECOLX/20-68   AC D6IQ54.1
#=GS E1IYN7_ECOLX/29-77   AC E1IYN7.1
#=GS E1IK58_ECOLX/54-102  AC E1IK58.1
#=GS E9VNB4_ECOLX/2-50    AC E9VNB4.1
#=GS C6UUV7_ECO5T/29-77   AC C6UUV7.1
#=GS H5IHA2_ECOLX/29-77   AC H5IHA2.1
#=GS H3KMJ4_ECOLX/29-77   AC H3KMJ4.1
#=GS H5BQD5_ECOLX/2-50    AC H5BQD5.1
#=GS G5VMK0_ECOLX/29-77   AC G5VMK0.1
#=GS D7Z9D1_ECOLX/20-68   AC D7Z9D1.1
#=GS H4RDP1_ECOLX/28-76   AC H4RDP1.1
#=GS B7A3M7_ECO57/2-50    AC B7A3M7.1
#=GS YDFA_ECO57/2-50      AC P0ACW9.1
#=GS H4K1F2_ECOLX/2-50    AC H4K1F2.1
#=GS H5L504_ECOLX/2-50    AC H5L504.1
#=GS D5D179_ECOKI/29-77   AC D5D179.1
#=GS E8IMP5_ECOLX/2-50    AC E8IMP5.1
#=GS B5YVC8_ECO5E/2-50    AC B5YVC8.1
#=GS H4VV57_ECOLX/2-50    AC H4VV57.1
#=GS E2QMD6_ECOLX/29-77   AC E2QMD6.1
#=GS B3C381_ECO57/29-77   AC B3C381.1
#=GS H5KAU1_ECOLX/2-50    AC H5KAU1.1
#=GS B7LZW2_ECO8A/28-76   AC B7LZW2.1
#=GS F9CGX4_ECOLX/8-54    AC F9CGX4.1
#=GS F4U875_ECOLX/2-50    AC F4U875.1
#=GS H4NLX7_ECOLX/2-50    AC H4NLX7.1
#=GS H5FED5_ECOLX/2-50    AC H5FED5.1
#=GS H1BVN6_ECOLX/2-50    AC H1BVN6.1
#=GS H5I2P1_ECOLX/29-77   AC H5I2P1.1
#=GS B7UQF5_ECO27/29-77   AC B7UQF5.1
#=GS H5ICR9_ECOLX/2-50    AC H5ICR9.1
#=GS G5W4T2_ECOLX/29-77   AC G5W4T2.1
#=GS G5M2B8_SALET/1-39    AC G5M2B8.1
#=GS F4VXH0_ECOLX/29-77   AC F4VXH0.1
#=GS H5QEA0_ECOLX/2-50    AC H5QEA0.1
#=GS C8TM94_ECO26/2-50    AC C8TM94.1
#=GS H4IC24_ECOLX/2-50    AC H4IC24.1
#=GS H5EZZ8_ECOLX/29-77   AC H5EZZ8.1
#=GS F5Q8T0_SHIFL/2-50    AC F5Q8T0.1
#=GS H5R9N6_ECOLX/2-50    AC H5R9N6.1
#=GS C8TPK0_ECO26/2-50    AC C8TPK0.1
#=GS D7XMG2_ECOLX/20-68   AC D7XMG2.1
#=GS B3C009_ECO57/2-50    AC B3C009.1
#=GS H4UUD0_ECOLX/29-77   AC H4UUD0.1
#=GS B3BMQ4_ECO57/2-50    AC B3BMQ4.1
#=GS E9UKS0_ECOLX/2-50    AC E9UKS0.1
#=GS E1JG06_ECOLX/29-62   AC E1JG06.1
#=GS G0FAI9_ECOLX/29-77   AC G0FAI9.1
#=GS Q8X8C6_ECO57/28-76   AC Q8X8C6.1
#=GS D5D5G0_ECOKI/28-76   AC D5D5G0.1
#=GS B2PB91_ECO57/29-77   AC B2PB91.1
#=GS H4N3F9_ECOLX/2-50    AC H4N3F9.1
#=GS E1JF35_ECOLX/20-68   AC E1JF35.1
#=GS A8GLQ0_SERP5/25-73   AC A8GLQ0.1
#=GS H5AVI6_ECOLX/2-50    AC H5AVI6.1
#=GS E7JT18_SHISO/2-50    AC E7JT18.1
#=GS E7HTE8_ECOLX/2-50    AC E7HTE8.1
#=GS E7TXT8_ECO57/2-50    AC E7TXT8.1
#=GS H4YXS5_ECOLX/2-50    AC H4YXS5.1
#=GS D8EEU4_ECOLX/29-77   AC D8EEU4.1
#=GS G2CJP1_ECOLX/2-50    AC G2CJP1.1
#=GS H5H617_ECOLX/2-50    AC H5H617.1
#=GS E9W4R8_ECOLX/2-50    AC E9W4R8.1
#=GS E9XLP4_ECOLX/2-50    AC E9XLP4.1
#=GS Q83LQ2_SHIFL/2-50    AC Q83LQ2.4
#=GS C6UPE4_ECO5T/2-50    AC C6UPE4.1
#=GS C8UQ66_ECO1A/2-50    AC C8UQ66.1
#=GS H5N9K8_ECOLX/2-50    AC H5N9K8.1
#=GS H5PYZ4_ECOLX/2-50    AC H5PYZ4.1
#=GS A8A0B7_ECOHS/1-35    AC A8A0B7.1
#=GS E8I7G1_ECOLX/2-50    AC E8I7G1.1
#=GS H5PWI0_ECOLX/2-50    AC H5PWI0.1
#=GS H5J0I8_ECOLX/29-77   AC H5J0I8.1
#=GS D3GYI0_ECO44/29-77   AC D3GYI0.1
#=GS H4ZDQ9_ECOLX/2-50    AC H4ZDQ9.1
#=GS E8HHA1_ECOLX/2-47    AC E8HHA1.1
#=GS H4W9K2_ECOLX/2-50    AC H4W9K2.1
#=GS Q3Z435_SHISS/2-50    AC Q3Z435.1
#=GS E9WSC4_ECOLX/2-50    AC E9WSC4.1
#=GS E7I529_ECOLX/2-50    AC E7I529.1
#=GS E7JH63_ECOLX/29-77   AC E7JH63.1
#=GS H4XK92_ECOLX/2-50    AC H4XK92.1
#=GS B3IDV6_ECOLX/2-50    AC B3IDV6.1
#=GS E2KQH7_ECO57/2-50    AC E2KQH7.1
#=GS E7H947_ECOLX/2-50    AC E7H947.1
#=GS H5GCG5_ECOLX/29-77   AC H5GCG5.1
#=GS F4VV81_ECOLX/2-50    AC F4VV81.1
#=GS B3XC81_ECOLX/2-50    AC B3XC81.1
#=GS Q8X8X0_ECO57/2-50    AC Q8X8X0.2
#=GS G0FAM7_ECOLX/29-77   AC G0FAM7.1
#=GS H5FUQ1_ECOLX/29-77   AC H5FUQ1.1
#=GS D7YQ64_ECOLX/2-50    AC D7YQ64.1
#=GS YDFA_ECOLI/2-50      AC P0ACW8.1
#=GS B7N512_ECOLU/54-102  AC B7N512.1
#=GS H5CMP3_ECOLX/29-77   AC H5CMP3.1
#=GS H4QXF9_ECOLX/28-76   AC H4QXF9.1
#=GS B7ML18_ECO45/29-77   AC B7ML18.1
#=GS A7ZL44_ECO24/33-81   AC A7ZL44.1
#=GS F1XU52_ECO57/2-50    AC F1XU52.1
#=GS H5C5W7_ECOLX/2-50    AC H5C5W7.1
#=GS E7SQ37_SHIDY/2-50    AC E7SQ37.1
#=GS H4IQ28_ECOLX/2-50    AC H4IQ28.1
#=GS E2JZB5_ECO57/28-76   AC E2JZB5.1
#=GS H4HUX2_ECOLX/2-50    AC H4HUX2.1
#=GS D8BR89_ECOLX/2-50    AC D8BR89.1
#=GS E0IUQ3_ECOLW/2-50    AC E0IUQ3.1
#=GS H4LSS1_ECOLX/2-50    AC H4LSS1.1
#=GS F4V1L9_ECOLX/2-50    AC F4V1L9.1
#=GS H5ART3_ECOLX/2-50    AC H5ART3.1
#=GS G5XVQ4_ECOLX/29-77   AC G5XVQ4.1
#=GS G1Y8D7_ECOLX/2-50    AC G1Y8D7.1
#=GS H4JKJ8_ECOLX/2-50    AC H4JKJ8.1
#=GS H4MN74_ECOLX/2-50    AC H4MN74.1
#=GS G2BMQ2_ECOLX/2-50    AC G2BMQ2.1
#=GS E3XUB1_ECOLX/2-50    AC E3XUB1.1
#=GS B3BA81_ECO57/29-77   AC B3BA81.1
#=GS E7SIK8_SHIDY/2-50    AC E7SIK8.1
#=GS H4PLC7_ECOLX/2-50    AC H4PLC7.1
#=GS C6UH02_ECOBR/2-50    AC C6UH02.1
#=GS F4V287_ECOLX/28-76   AC F4V287.1
#=GS A7ZM31_ECO24/2-50    AC A7ZM31.1
#=GS H5FY29_ECOLX/29-77   AC H5FY29.1
#=GS H4ZV59_ECOLX/2-50    AC H4ZV59.1
#=GS H4LRF6_ECOLX/2-50    AC H4LRF6.1
#=GS D3GTD9_ECO44/2-50    AC D3GTD9.1
#=GS G1YRH1_ECOLX/2-50    AC G1YRH1.1
#=GS H5E1K4_ECOLX/29-77   AC H5E1K4.1
#=GS G2F9Y0_ECOLX/2-50    AC G2F9Y0.1
#=GS H5AUJ2_ECOLX/2-50    AC H5AUJ2.1
#=GS H5KBN3_ECOLX/29-77   AC H5KBN3.1
#=GS E7IWM0_ECOLX/2-50    AC E7IWM0.1
#=GS E4P639_ECO8N/2-50    AC E4P639.1
#=GS E2WP54_ECOLX/2-50    AC E2WP54.1
#=GS H4PZE9_ECOLX/29-77   AC H4PZE9.1
#=GS C4ZWY8_ECOBW/2-50    AC C4ZWY8.1
#=GS D6HVX8_ECOLX/28-76   AC D6HVX8.1
#=GS F1XU01_ECO57/28-76   AC F1XU01.1
#=GS H4N4S5_ECOLX/28-76   AC H4N4S5.1
#=GS H5P4F1_ECOLX/2-50    AC H5P4F1.1
#=GS H6MEL6_ECOLX/2-50    AC H6MEL6.1
#=GS F1ZH81_ECOLX/2-50    AC F1ZH81.1
#=GS G0FD84_ECOLX/2-50    AC G0FD84.1
#=GS E8HER6_ECO57/3-51    AC E8HER6.1
#=GS H4U3S2_ECOLX/2-50    AC H4U3S2.1
#=GS H5I575_ECOLX/2-50    AC H5I575.1
#=GS H4FRM3_ECOLX/1-49    AC H4FRM3.1
#=GS E7JT15_SHISO/2-50    AC E7JT15.1
#=GS H5FXC4_ECOLX/2-50    AC H5FXC4.1
#=GS I1B866_ECOLX/2-50    AC I1B866.1
#=GS F9R644_ECOLX/2-50    AC F9R644.1
#=GS F1XPU9_ECO57/2-50    AC F1XPU9.1
#=GS G5TG30_ECOLX/29-77   AC G5TG30.1
#=GS D7JMC3_ECOLX/20-68   AC D7JMC3.1
#=GS G5WRZ4_ECOLX/29-77   AC G5WRZ4.1
#=GS B2PDX5_ECO57/2-50    AC B2PDX5.1
#=GS H1E7I8_ECOLX/2-50    AC H1E7I8.1
#=GS H4ZTY9_ECOLX/2-50    AC H4ZTY9.1
#=GS F4VC44_ECOLX/2-50    AC F4VC44.1
#=GS B3AUU9_ECO57/28-76   AC B3AUU9.1
#=GS H4N687_ECOLX/2-50    AC H4N687.1
#=GS H4ZFK7_ECOLX/29-77   AC H4ZFK7.1
#=GS D6I777_ECOLX/59-107  AC D6I777.1
#=GS E7HAP4_ECOLX/2-50    AC E7HAP4.1
#=GS G2ADI2_ECOLX/2-50    AC G2ADI2.1
#=GS C6VDQ7_ECOBD/20-68   AC C6VDQ7.1
#=GS E1HZ82_ECOLX/2-50    AC E1HZ82.1
#=GS G2AFB3_ECOLX/2-50    AC G2AFB3.1
#=GS E9X3J9_ECOLX/20-68   AC E9X3J9.1
#=GS H4SQX2_ECOLX/2-50    AC H4SQX2.1
#=GS H5EHL8_ECOLX/2-50    AC H5EHL8.1
#=GS H4QY63_ECOLX/29-77   AC H4QY63.1
#=GS G1ZIV1_ECOLX/2-50    AC G1ZIV1.1
#=GS B2U005_SHIB3/29-77   AC B2U005.1
#=GS H5DZE1_ECOLX/2-50    AC H5DZE1.1
#=GS H5H5K1_ECOLX/29-77   AC H5H5K1.1
#=GS B3XJJ0_ECOLX/2-50    AC B3XJJ0.1
#=GS H4UHI9_ECOLX/29-77   AC H4UHI9.1
#=GS H4T7S9_ECOLX/28-76   AC H4T7S9.1
#=GS H4P2W0_ECOLX/28-76   AC H4P2W0.1
#=GS C1HK00_9ESCH/29-77   AC C1HK00.1
#=GS H4PI45_ECOLX/2-50    AC H4PI45.1
#=GS H4QEP8_ECOLX/28-76   AC H4QEP8.1
#=GS F8XCS2_ECOLX/2-50    AC F8XCS2.1
#=GS H5D0P6_ECOLX/29-77   AC H5D0P6.1
#=GS E7HJ35_ECOLX/29-77   AC E7HJ35.1
#=GS F1XTW1_ECO57/29-77   AC F1XTW1.1
#=GS E8YBH0_ECOKO/2-50    AC E8YBH0.1
#=GS H5KTM5_ECOLX/2-50    AC H5KTM5.1
#=GS D8E4K4_ECOLX/29-77   AC D8E4K4.1
#=GS H5HHF0_ECOLX/2-50    AC H5HHF0.1
#=GS B3HKB6_ECOLX/29-77   AC B3HKB6.1
#=GS H4RGV5_ECOLX/2-50    AC H4RGV5.1
#=GS H5I1F9_ECOLX/2-50    AC H5I1F9.1
#=GS C6UIB3_ECOBR/20-68   AC C6UIB3.1
#=GS E7IBG5_ECOLX/2-50    AC E7IBG5.1
#=GS E1JBV2_ECOLX/2-50    AC E1JBV2.1
#=GS H4WR61_ECOLX/2-50    AC H4WR61.1
#=GS D7X1J9_ECOLX/2-50    AC D7X1J9.1
#=GS D7X158_ECOLX/54-102  AC D7X158.1
#=GS F4T075_ECOLX/2-50    AC F4T075.1
#=GS B1LPX7_ECOSM/2-50    AC B1LPX7.1
#=GS F1XND7_ECO57/2-50    AC F1XND7.1
#=GS H4SB88_ECOLX/28-76   AC H4SB88.1
#=GS H4MPI1_ECOLX/28-76   AC H4MPI1.1
#=GS G2C606_ECOLX/2-50    AC G2C606.1
#=GS F4SHR2_ECOLX/2-50    AC F4SHR2.1
#=GS H5FTV3_ECOLX/2-50    AC H5FTV3.1
#=GS B2PC68_ECO57/2-50    AC B2PC68.1
#=GS E7URA2_ECOLX/1-45    AC E7URA2.1
#=GS E2KH79_ECO57/28-76   AC E2KH79.1
#=GS C6EFM9_ECOBD/2-50    AC C6EFM9.1
#=GS E6B2S8_ECOLX/29-77   AC E6B2S8.1
#=GS H4MQC5_ECOLX/29-77   AC H4MQC5.1
#=GS H5DJJ8_ECOLX/2-50    AC H5DJJ8.1
#=GS F9HV88_ECOLX/29-77   AC F9HV88.1
#=GS H4HVC6_ECOLX/1-48    AC H4HVC6.1
#=GS D7YUC8_ECOLX/29-77   AC D7YUC8.1
#=GS H5B850_ECOLX/29-77   AC H5B850.1
#=GS E8ILM6_ECOLX/29-76   AC E8ILM6.1
#=GS G4PUL9_ECOLX/29-77   AC G4PUL9.1
#=GS H4Q277_ECOLX/2-50    AC H4Q277.1
#=GS H5IZ89_ECOLX/29-77   AC H5IZ89.1
#=GS F4UMY7_ECOLX/2-50    AC F4UMY7.1
#=GS C9QWZ6_ECOD1/2-50    AC C9QWZ6.1
#=GS E7I408_ECOLX/2-50    AC E7I408.1
#=GS H5B757_ECOLX/29-77   AC H5B757.1
#=GS E9VXB3_ECOLX/29-77   AC E9VXB3.1
#=GS H5H8M6_ECOLX/29-77   AC H5H8M6.1
#=GS E7SZ04_SHIBO/43-91   AC E7SZ04.1
#=GS F5MJH6_SHIFL/2-50    AC F5MJH6.1
#=GS H4QG62_ECOLX/29-77   AC H4QG62.1
#=GS H5IYI1_ECOLX/2-50    AC H5IYI1.1
#=GS G2B8E2_ECOLX/2-45    AC G2B8E2.1
#=GS E2KK06_ECO57/2-50    AC E2KK06.1
#=GS H6MBI9_ECOLX/2-50    AC H6MBI9.1
#=GS B3ICK4_ECOLX/2-50    AC B3ICK4.1
#=GS H5BK63_ECOLX/29-77   AC H5BK63.1
#=GS C6USR8_ECO5T/2-50    AC C6USR8.1
#=GS B7A4G5_ECO57/29-77   AC B7A4G5.1
#=GS YDAF_ECO57/2-50      AC P0ACW1.1
#=GS H4LS84_ECOLX/29-77   AC H4LS84.1
#=GS C9QV14_ECOD1/2-50    AC C9QV14.1
#=GS H5DG92_ECOLX/2-50    AC H5DG92.1
#=GS H4RXJ4_ECOLX/2-50    AC H4RXJ4.1
#=GS E2K469_ECO57/29-77   AC E2K469.1
#=GS H1ELG8_ECOLX/29-77   AC H1ELG8.1
#=GS H5JG24_ECOLX/2-50    AC H5JG24.1
#=GS H5JX01_ECOLX/29-77   AC H5JX01.1
#=GS H4PXJ5_ECOLX/2-50    AC H4PXJ5.1
#=GS H4LUQ0_ECOLX/2-50    AC H4LUQ0.1
#=GS B2NY42_ECO57/2-50    AC B2NY42.1
#=GS Q8XC56_ECO57/29-77   AC Q8XC56.1
#=GS H5LKF2_ECOLX/2-50    AC H5LKF2.1
#=GS F1YB67_ECO57/28-76   AC F1YB67.1
#=GS H5IGS2_ECOLX/2-50    AC H5IGS2.1
#=GS H4M737_ECOLX/28-76   AC H4M737.1
#=GS H4M7Z5_ECOLX/29-77   AC H4M7Z5.1
#=GS H4N890_ECOLX/2-50    AC H4N890.1
#=GS E7HIE6_ECOLX/2-50    AC E7HIE6.1
#=GS Q3Z1T6_SHISS/20-68   AC Q3Z1T6.1
#=GS E9XM46_ECOLX/37-85   AC E9XM46.1
#=GS H1EDS3_ECOLX/29-77   AC H1EDS3.1
#=GS H4Z769_ECOLX/2-50    AC H4Z769.1
#=GS E7K7F7_SHISO/20-68   AC E7K7F7.1
#=GS G1ZGJ9_ECOLX/2-50    AC G1ZGJ9.1
#=GS E3XZN7_SHIFL/2-50    AC E3XZN7.1
#=GS E6A4E1_ECOLX/29-77   AC E6A4E1.1
#=GS H4MD32_ECOLX/2-50    AC H4MD32.1
#=GS G5UPE6_ECOLX/29-77   AC G5UPE6.1
#=GS H4Y2D1_ECOLX/29-77   AC H4Y2D1.1
#=GS G1Y9Z7_ECOLX/2-50    AC G1Y9Z7.1
#=GS H4KFK4_ECOLX/29-77   AC H4KFK4.1
#=GS H5HHU4_ECOLX/2-50    AC H5HHU4.1
#=GS C8U5T7_ECO10/29-77   AC C8U5T7.1
#=GS H5EG76_ECOLX/2-50    AC H5EG76.1
#=GS G5U764_ECOLX/29-77   AC G5U764.1
#=GS H4QGA5_ECOLX/2-50    AC H4QGA5.1
#=GS H5H751_ECOLX/2-50    AC H5H751.1
#=GS E8H244_ECO57/2-49    AC E8H244.1
#=GS B2NPY2_ECO57/29-77   AC B2NPY2.1
#=GS H4P534_ECOLX/2-50    AC H4P534.1
#=GS H4NKC6_ECOLX/2-50    AC H4NKC6.1
#=GS H4LAH7_ECOLX/2-50    AC H4LAH7.1
#=GS H4ZW30_ECOLX/2-50    AC H4ZW30.1
#=GS E2K561_ECO57/2-50    AC E2K561.1
#=GS H4QJG6_ECOLX/2-50    AC H4QJG6.1
#=GS E7J1C7_ECOLX/2-50    AC E7J1C7.1
#=GS H4KWG3_ECOLX/2-50    AC H4KWG3.1
#=GS H4UXJ8_ECOLX/2-50    AC H4UXJ8.1
#=GS B2PM28_ECO57/29-77   AC B2PM28.1
#=GS B3AD53_ECO57/29-77   AC B3AD53.1
#=GS G7REA7_ECOC2/29-77   AC G7REA7.1
#=GS H4M5H2_ECOLX/15-63   AC H4M5H2.1
#=GS H4SA84_ECOLX/29-77   AC H4SA84.1
#=GS B7A355_ECO57/2-50    AC B7A355.1
#=GS H4XM68_ECOLX/29-77   AC H4XM68.1
#=GS F7R5E0_SHIFL/2-50    AC F7R5E0.1
#=GS E9VEY1_ECOLX/29-77   AC E9VEY1.1
#=GS F3V3N4_SHIDY/2-50    AC F3V3N4.1
#=GS F4V2C7_ECOLX/54-93   AC F4V2C7.1
#=GS H5DK96_ECOLX/2-50    AC H5DK96.1
#=GS E7H971_ECOLX/2-50    AC E7H971.1
#=GS E7JQ31_ECOLX/2-50    AC E7JQ31.1
#=GS D7XQB1_ECOLX/29-77   AC D7XQB1.1
#=GS H4J6Z1_ECOLX/29-77   AC H4J6Z1.1
#=GS E7K143_SHISO/2-50    AC E7K143.1
#=GS F5QLT6_SHIFL/2-50    AC F5QLT6.1
#=GS F8XHM4_ECOLX/2-50    AC F8XHM4.1
#=GS H4R0P7_ECOLX/2-50    AC H4R0P7.1
#=GS F4TGA3_ECOLX/20-68   AC F4TGA3.1
#=GS H4PHF3_ECOLX/28-76   AC H4PHF3.1
#=GS H4NLA4_ECOLX/2-50    AC H4NLA4.1
#=GS H5HR13_ECOLX/2-50    AC H5HR13.1
#=GS E7IJC8_ECOLX/2-50    AC E7IJC8.1
#=GS H5JFQ6_ECOLX/2-50    AC H5JFQ6.1
#=GS H1FAQ6_ECOLX/2-50    AC H1FAQ6.1
#=GS H5D0H0_ECOLX/29-77   AC H5D0H0.1
#=GS D3H4D4_ECO44/7-55    AC D3H4D4.1
#=GS B1XCI4_ECODH/2-50    AC B1XCI4.1
#=GS YDAF_ECOLI/2-50      AC P0ACW0.1
#=GS E7TZH4_ECO57/28-76   AC E7TZH4.1
#=GS H4TPJ5_ECOLX/28-76   AC H4TPJ5.1
#=GS A9N4J2_SALPB/1-39    AC A9N4J2.1
#=GS H4ZX17_ECOLX/2-50    AC H4ZX17.1
#=GS E7UCQ2_ECOLX/29-77   AC E7UCQ2.1
#=GS B2PAT9_ECO57/28-76   AC B2PAT9.1
#=GS H5BRZ2_ECOLX/29-77   AC H5BRZ2.1
#=GS C8UCK2_ECO1A/29-77   AC C8UCK2.1
#=GS H4IQJ9_ECOLX/29-77   AC H4IQJ9.1
#=GS H4X5P8_ECOLX/2-50    AC H4X5P8.1
#=GS F4M984_ECOLX/2-50    AC F4M984.1
#=GS H5PJD3_ECOLX/2-50    AC H5PJD3.1
#=GS G5KM02_ECOLX/29-77   AC G5KM02.1
#=GS H5BAX7_ECOLX/2-50    AC H5BAX7.1
#=GS E6A635_ECOLX/11-59   AC E6A635.1
#=GS H1FR43_ECOLX/2-50    AC H1FR43.1
#=GS B3B920_ECO57/28-76   AC B3B920.1
#=GS C6UZE7_ECO5T/2-50    AC C6UZE7.1
#=GS H4YVG9_ECOLX/2-50    AC H4YVG9.1
#=GS F7MVZ3_ECOLX/29-77   AC F7MVZ3.1
#=GS H4RTX8_ECOLX/28-76   AC H4RTX8.1
#=GS H4ZAS9_ECOLX/2-50    AC H4ZAS9.1
#=GS E9YNB2_ECOLX/28-76   AC E9YNB2.1
#=GS H5W6I6_SALEN/5-53    AC H5W6I6.1
#=GS H5QRI7_ECOLX/29-77   AC H5QRI7.1
#=GS H4TPS6_ECOLX/2-50    AC H4TPS6.1
#=GS D6IMJ2_ECOLX/20-68   AC D6IMJ2.1
#=GS E7T7U9_SHIFL/2-50    AC E7T7U9.1
#=GS H5MU72_ECOLX/2-50    AC H5MU72.1
#=GS H5AD64_ECOLX/2-50    AC H5AD64.1
#=GS E2KKG0_ECO57/29-77   AC E2KKG0.1
#=GS B7MV19_ECO81/66-114  AC B7MV19.1
#=GS E7TUQ6_ECO57/29-77   AC E7TUQ6.1
#=GS E8JEP7_ECO57/29-68   AC E8JEP7.1
#=GS G5YFL0_ECOLX/29-77   AC G5YFL0.1
#=GS H5MCL0_ECOLX/2-50    AC H5MCL0.1
#=GS H4MR37_ECOLX/2-50    AC H4MR37.1
#=GS B3IRN0_ECOLX/2-50    AC B3IRN0.1
#=GS D8A5B2_ECOLX/28-76   AC D8A5B2.1
#=GS B1EPG7_9ESCH/2-50    AC B1EPG7.1
#=GS H4QW04_ECOLX/2-50    AC H4QW04.1
#=GS D6I8D9_ECOLX/2-50    AC D6I8D9.1
#=GS G2ASZ8_ECOLX/2-50    AC G2ASZ8.1
#=GS E0IWY9_ECOLW/2-50    AC E0IWY9.1
#=GS G0FEI7_ECOLX/2-50    AC G0FEI7.1
#=GS H3KM41_ECOLX/2-50    AC H3KM41.1
#=GS H4P210_ECOLX/2-50    AC H4P210.1
#=GS C8U8P1_ECO10/2-50    AC C8U8P1.1
#=GS H4Z6G8_ECOLX/2-50    AC H4Z6G8.1
#=GS H4VUQ4_ECOLX/2-50    AC H4VUQ4.1
#=GS B7LE79_ECO55/2-50    AC B7LE79.1
#=GS H5EZ09_ECOLX/2-50    AC H5EZ09.1
#=GS F1ZHI5_ECOLX/28-76   AC F1ZHI5.1
#=GS H5FW76_ECOLX/2-50    AC H5FW76.1
#=GS H4ZSL0_ECOLX/2-50    AC H4ZSL0.1
#=GS B2TV02_SHIB3/2-50    AC B2TV02.1
#=GS H4P3K8_ECOLX/29-77   AC H4P3K8.1
#=GS G2CYL7_ECOLX/2-50    AC G2CYL7.1
#=GS G1ZX92_ECOLX/2-50    AC G1ZX92.1
#=GS H4RUT3_ECOLX/29-77   AC H4RUT3.1
#=GS H5JX26_ECOLX/2-50    AC H5JX26.1
#=GS H5ABM8_ECOLX/2-50    AC H5ABM8.1
#=GS H4UZG2_ECOLX/29-77   AC H4UZG2.1
#=GS E9TXH9_ECOLX/23-71   AC E9TXH9.1
#=GS H5EXB3_ECOLX/29-77   AC H5EXB3.1
#=GS H5PJT6_ECOLX/29-77   AC H5PJT6.1
#=GS H4FIH6_ECOLX/2-50    AC H4FIH6.1
#=GS H4SCL8_ECOLX/2-50    AC H4SCL8.1
#=GS E2KY50_ECO57/28-76   AC E2KY50.1
#=GS B3XKC8_ECOLX/29-77   AC B3XKC8.1
#=GS E8HWC5_ECOLX/2-50    AC E8HWC5.1
#=GS H1ECJ7_ECOLX/29-77   AC H1ECJ7.1
#=GS H4T954_ECOLX/2-50    AC H4T954.1
#=GS G1Z3V4_ECOLX/2-50    AC G1Z3V4.1
#=GS B3ACP2_ECO57/28-76   AC B3ACP2.1
#=GS B7UPZ6_ECO27/33-81   AC B7UPZ6.1
#=GS F5R6X6_SHIFL/2-50    AC F5R6X6.1
#=GS H5D2M6_ECOLX/2-50    AC H5D2M6.1
#=GS H5EJC8_ECOLX/2-44    AC H5EJC8.1
#=GS H5HN11_ECOLX/2-50    AC H5HN11.1
#=GS H5EID1_ECOLX/2-50    AC H5EID1.1
#=GS H4T7D3_ECOLX/29-77   AC H4T7D3.1
#=GS E8I9P3_ECOLX/2-50    AC E8I9P3.1
#=GS I0ZRU3_ECOLX/2-50    AC I0ZRU3.1
#=GS B3ISN2_ECOLX/29-77   AC B3ISN2.1
#=GS H5AFD2_ECOLX/2-50    AC H5AFD2.1
#=GS G2BNU6_ECOLX/2-50    AC G2BNU6.1
#=GS E5ZQE6_ECOLX/29-77   AC E5ZQE6.1
#=GS H5M081_ECOLX/2-50    AC H5M081.1
#=GS C8TT56_ECO26/31-79   AC C8TT56.1
#=GS C4ZVA3_ECOBW/2-50    AC C4ZVA3.1
#=GS B7MS90_ECO81/29-77   AC B7MS90.1
#=GS G5X782_ECOLX/29-77   AC G5X782.1
#=GS F5PNF3_SHIFL/2-50    AC F5PNF3.1
#=GS F4TET0_ECOLX/29-77   AC F4TET0.1
#=GS B2NZG7_ECO57/2-50    AC B2NZG7.1
#=GS G2ASD9_ECOLX/20-68   AC G2ASD9.1
#=GS F5P8G7_SHIFL/2-50    AC F5P8G7.1
#=GS H4PYL9_ECOLX/28-76   AC H4PYL9.1
#=GS B7L5C2_ECO55/2-50    AC B7L5C2.1
#=GS H1FHY6_ECOLX/29-77   AC H1FHY6.1
#=GS E9TDM1_ECOLX/29-77   AC E9TDM1.1
#=GS E1PH05_ECOAB/2-50    AC E1PH05.1
#=GS D8EUD3_ECOLX/1-35    AC D8EUD3.1
#=GS H4MT02_ECOLX/2-50    AC H4MT02.1
#=GS C8TRW2_ECO26/54-102  AC C8TRW2.1
#=GS H5GQ39_ECOLX/29-77   AC H5GQ39.1
#=GS B5Z301_ECO5E/29-77   AC B5Z301.1
#=GS H4QEF1_ECOLX/2-50    AC H4QEF1.1
#=GS H5QBN2_ECOLX/29-77   AC H5QBN2.1
#=GS I1B9C2_ECOLX/2-50    AC I1B9C2.1
#=GS H5GR41_ECOLX/2-50    AC H5GR41.1
#=GS E2KDY7_ECO57/2-50    AC E2KDY7.1
#=GS G0D3L6_ECOLX/29-77   AC G0D3L6.1
#=GS D8E758_ECOLX/2-50    AC D8E758.1
#=GS E2K2N7_ECO57/2-50    AC E2K2N7.1
#=GS B3C339_ECO57/2-50    AC B3C339.1
#=GS H6MBP2_ECOLX/2-50    AC H6MBP2.1
#=GS B1XF39_ECODH/2-50    AC B1XF39.1
#=GS B6ZZS8_ECO57/28-76   AC B6ZZS8.1
#=GS H4I9R2_ECOLX/2-50    AC H4I9R2.1
#=GS D7ZJR8_ECOLX/2-50    AC D7ZJR8.1
#=GS G2C3N2_ECOLX/2-50    AC G2C3N2.1
#=GS F4UMV2_ECOLX/2-50    AC F4UMV2.1
#=GS G2B8D9_ECOLX/2-50    AC G2B8D9.1
#=GS Q8Z5Z4_SALTI/2-50    AC Q8Z5Z4.1
#=GS H4IA73_ECOLX/29-77   AC H4IA73.1
#=GS I0ZR26_ECOLX/2-50    AC I0ZR26.1
#=GS B2PRS8_ECO57/28-76   AC B2PRS8.1
#=GS C8TR53_ECO26/29-77   AC C8TR53.1
H5J2F6_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F1YBP7_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4RSY5_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8Y8E6_ECOKO/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7IMT7_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5CMF5_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4P4M3_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
E7TUA3_ECO57/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
E7HZU2_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
F1YBE4_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
B5YSQ1_ECO5E/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
Q7ACT6_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E9UM64_ECOLX/2-50               ..DTINLGNNESLAYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
C8TS24_ECO26/2-50               ..DTLNLGNNESLVCGVFSNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
B6ZTP1_ECO57/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4QIL8_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
H4P6U1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D7XPU3_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5G6K0_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
C6UR76_ECO5T/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
F4LZV1_ECOLX/29-77              ..DTIVLGNNESLVYGVFPNLDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B7LHL1_ECO55/54-102             ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H4VEI4_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGAHRWLARNS-d........
H4NPS2_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
A7ZKN7_ECO24/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
H5K023_ECOLX/29-77              ..DTLNLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
I0VP99_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGIFTAMTYTKSKTFKTESGARRWLARNT-d........
H4RVJ7_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5IUA3_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5AW98_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
B3B4H3_ECO57/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
G1ZIX3_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
B3B6U0_ECO57/2-50               ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
H1F4T4_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
G2F9A1_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B3X3M5_SHIDY/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E7I3R1_ECOLX/29-71              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFK--------------pkmvpvag.
G7RMT2_ECOC1/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7H881_ECOLX/31-64              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTF---------------.........
H4SC04_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E7II79_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4WSB5_ECOLX/29-77              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E6BR75_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3B7A9_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H4J6K7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F1YBA2_ECO57/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B1IR17_ECOLC/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E6A941_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWQERNS-g........
E7J2R2_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEASARRWLSRNT-d........
D2ABD4_SHIF2/20-68              ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
H5PGX7_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
C5W504_ECOBD/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H4STL1_ECOLX/29-77              ..DTIGLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D8ETL0_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E6BN63_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
C8U502_ECO10/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
H5R6P7_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5B9K4_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G2ATP5_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B2PTX4_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B2NWG9_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
D3QTS9_ECOCB/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
G5XQS2_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H5KNZ2_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5DH78_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
C2DWU3_ECOLX/2-50               ..DTIELGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E6B899_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5HPB2_ECOLX/2-50               ..DTIDLGSNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4ZEX7_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
E2KT66_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4YH97_ECOLX/29-77              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4LB03_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E3XMV1_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
G1Z4N8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H4JWR1_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4RCE0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4Y119_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B6IA71_ECOSE/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4J1N4_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3AS51_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H4QBM8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D3QX46_ECOCB/54-102             ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5NPC0_ECOLX/54-102             ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
C8ULJ9_ECO1A/31-79              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4PGJ8_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7TV42_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E1S4V3_ECOUM/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8HFW7_ECOLX/29-68              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTE------------lar......
F8YF21_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
G2D076_ECOLX/2-50               ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4KFI9_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E6BSX9_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E9WE41_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5QTW3_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H5E0R3_ECOLX/29-77              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
D7Z7Q0_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFQTEAGARRWLTRNT-d........
C8U3V8_ECO10/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D3QSB4_ECOCB/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
H4M928_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E7IAW1_ECOLX/28-76              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLSRNT-d........
F4TDS6_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5EF56_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
E8HTK8_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
H4YG00_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3IN08_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
C8U723_ECO10/37-85              ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
G0D4I2_ECOLX/2-44               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEK-----------tlsgc....
Q8FIL2_ECOL6/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTALTXTKSKTFKTENGARRWLERNS-g........
G2AEW1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8IZQ0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
D7JQ42_ECOLX/20-68              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8HUX8_ECOLX/29-68              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTE------------lar......
E9WY00_ECOLX/20-68              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G1Z648_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
B3AC68_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
B5YWK0_ECO5E/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
G1Z213_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
B3WUZ4_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
B7A3U3_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
Q1RCG9_ECOUT/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4VFW3_ECOLX/29-77              ..DTIVLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D8ABG9_ECOLX/28-76              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5GSA0_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3BPI7_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B3IDK1_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G1Y8I9_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
H5GAA2_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5JHM4_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
G5W297_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
G2CJG1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGAHRWLERNS-g........
F3LXI4_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLERNS-g........
G5TWL5_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
E2KL39_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E6BBV7_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D8C4L1_ECOLX/1-35               .m---------------FPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B6IB05_ECOSE/29-77              ..DTINLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGAHRWLERNS-g........
E3PJU4_ECOH1/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMAYTRSKTFKTEAGARRWLTRNT-d........
B2PTF1_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
D6IQ54_ECOLX/20-68              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E1IYN7_ECOLX/29-77              ..DTIELGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E1IK58_ECOLX/54-102             ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E9VNB4_ECOLX/2-50               ..DTIELGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
C6UUV7_ECO5T/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5IHA2_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H3KMJ4_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H5BQD5_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G5VMK0_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
D7Z9D1_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H4RDP1_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B7A3M7_ECO57/2-50               ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
YDFA_ECO57/2-50                 ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4K1F2_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H5L504_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
D5D179_ECOKI/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8IMP5_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B5YVC8_ECO5E/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4VV57_ECOLX/2-50               ..DTIELGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E2QMD6_ECOLX/29-77              ..DTIGLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3C381_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5KAU1_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
B7LZW2_ECO8A/28-76              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F9CGX4_ECOLX/8-54               si----IGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
F4U875_ECOLX/2-50               ..QKIDLGNNESIVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4NLX7_ECOLX/2-50               ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
H5FED5_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H1BVN6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNT-d........
H5I2P1_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
B7UQF5_ECO27/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H5ICR9_ECOLX/2-50               ..DTIDLGSNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G5W4T2_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
G5M2B8_SALET/1-39               ..----------MVYGVFPNNDGTFTAMTFTRSKTFKTEAGAQRWLTRN--hc.......
F4VXH0_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5QEA0_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
C8TM94_ECO26/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4IC24_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
H5EZZ8_ECOLX/29-77              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
F5Q8T0_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
H5R9N6_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
C8TPK0_ECO26/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
D7XMG2_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3C009_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4UUD0_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
B3BMQ4_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E9UKS0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E1JG06_ECOLX/29-62              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSK-----------------nv.......
G0FAI9_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNN-e........
Q8X8C6_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
D5D5G0_ECOKI/28-76              ..DTIELGNNESLVCGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
B2PB91_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4N3F9_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E1JF35_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
A8GLQ0_SERP5/25-73              ..ETLDCGNNERVKMGVFPNGDGTFTAMTYTQSRTFKTESGAAKWLLRQL-a........
H5AVI6_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLAKNT-s........
E7JT18_SHISO/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E7HTE8_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7TXT8_ECO57/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4YXS5_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
D8EEU4_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
G2CJP1_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
H5H617_ECOLX/2-50               ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
E9W4R8_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
E9XLP4_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
Q83LQ2_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
C6UPE4_ECO5T/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
C8UQ66_ECO1A/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H5N9K8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H5PYZ4_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
A8A0B7_ECOHS/1-35               .m---------------FPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8I7G1_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
H5PWI0_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5J0I8_ECOLX/29-77              ..DTIDLGNSESLVCGVFPKQDGTFTAMTYTKSKTFKTESGARRWTGRNS-g........
D3GYI0_ECO44/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4ZDQ9_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
E8HHA1_ECOLX/2-47               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTE------------vvpvagwke
H4W9K2_ECOLX/2-50               ..DTIELGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
Q3Z435_SHISS/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E9WSC4_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E7I529_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E7JH63_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4XK92_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3IDV6_ECOLX/2-50               ..DTIDLGSNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E2KQH7_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7H947_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H5GCG5_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
F4VV81_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
B3XC81_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
Q8X8X0_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAXRWLARNAN.........
G0FAM7_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5FUQ1_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D7YQ64_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
YDFA_ECOLI/2-50                 ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B7N512_ECOLU/54-102             ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5CMP3_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
H4QXF9_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B7ML18_ECO45/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
A7ZL44_ECO24/33-81              ..ETIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLVRHS-g........
F1XU52_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H5C5W7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7SQ37_SHIDY/2-50               ..DTIDLGNSESLVCGVLPNQDGTFTAMTYTKSKTFKTEAGARRWLARNS-d........
H4IQ28_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E2JZB5_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4HUX2_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
D8BR89_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLEKHT-v........
E0IUQ3_ECOLW/2-50               ..QKIDLGNNESMVCDVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
H4LSS1_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
F4V1L9_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5ART3_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
G5XVQ4_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
G1Y8D7_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
H4JKJ8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4MN74_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G2BMQ2_ECOLX/2-50               ..DTIGLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E3XUB1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
B3BA81_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
E7SIK8_SHIDY/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLAKNT-s........
H4PLC7_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
C6UH02_ECOBR/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
F4V287_ECOLX/28-76              ..DTIDLGNNESLVYDVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
A7ZM31_ECO24/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5FY29_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
H4ZV59_ECOLX/2-50               ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
H4LRF6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D3GTD9_ECO44/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G1YRH1_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5E1K4_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
G2F9Y0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5AUJ2_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H5KBN3_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E7IWM0_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
E4P639_ECO8N/2-50               ..DTIDLGNSESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E2WP54_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTEMTYTKSKTFKTESGARRWLERNS-g........
H4PZE9_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
C4ZWY8_ECOBW/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D6HVX8_ECOLX/28-76              ..DTIDLSNNDSLVCGVFPNHDGTFTTMTYTKSKTFKTESGARRWLARNT-d........
F1XU01_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYSKSKTFKTESGARRWLARNS-d........
H4N4S5_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5P4F1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H6MEL6_ECOLX/2-50               ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
F1ZH81_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G0FD84_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGAHRWLERNS-g........
E8HER6_ECO57/3-51               ml--IDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLAKNT-s........
H4U3S2_ECOLX/2-50               ..DTIDLGNNESQVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5I575_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4FRM3_ECOLX/1-49               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKYT-v........
E7JT15_SHISO/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
H5FXC4_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQNGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
I1B866_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F9R644_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F1XPU9_ECO57/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
G5TG30_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
D7JMC3_ECOLX/20-68              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFQTEAGARRWLTRNT-d........
G5WRZ4_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
B2PDX5_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H1E7I8_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4ZTY9_ECOLX/2-50               ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
F4VC44_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B3AUU9_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4N687_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4ZFK7_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
D6I777_ECOLX/59-107             ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E7HAP4_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G2ADI2_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKKFKTEAGARRWLARNTN.........
C6VDQ7_ECOBD/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
E1HZ82_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G2AFB3_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E9X3J9_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H4SQX2_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5EHL8_ECOLX/2-50               ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
H4QY63_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
G1ZIV1_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
B2U005_SHIB3/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H5DZE1_ECOLX/2-50               ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
H5H5K1_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQYGTFTAMTYTKSKTFKTESGARRWLERNS-g........
B3XJJ0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
H4UHI9_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4T7S9_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4P2W0_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
C1HK00_9ESCH/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4PI45_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
H4QEP8_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
F8XCS2_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5D0P6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
E7HJ35_ECOLX/29-77              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
F1XTW1_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
E8YBH0_ECOKO/2-50               ..QKIDLGNNESMVCDVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
H5KTM5_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
D8E4K4_ECOLX/29-77              ..DTIDLGNNESLVYGVFSNQDGTFTAMTYTKSKTFKTETGAHRWLARNT-d........
H5HHF0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3HKB6_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4RGV5_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H5I1F9_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
C6UIB3_ECOBR/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
E7IBG5_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E1JBV2_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4WR61_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D7X1J9_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFQTEAGARRWLTRNT-d........
D7X158_ECOLX/54-102             ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F4T075_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
B1LPX7_ECOSM/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTESDARRWLERNS-g........
F1XND7_ECO57/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4SB88_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4MPI1_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
G2C606_ECOLX/2-50               ..DTIDLGNNESLVHGVFSNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F4SHR2_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5FTV3_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B2PC68_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E7URA2_ECOLX/1-45               ..----MGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
E2KH79_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
C6EFM9_ECOBD/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E6B2S8_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
H4MQC5_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5DJJ8_ECOLX/2-50               ..DTLNLGNNESLVCGVFSNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
F9HV88_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H4HVC6_ECOLX/1-48               ..-MLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
D7YUC8_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5B850_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8ILM6_ECOLX/29-76              ..DTIGLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-.........
G4PUL9_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4Q277_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H5IZ89_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F4UMY7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
C9QWZ6_ECOD1/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E7I408_ECOLX/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H5B757_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
E9VXB3_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5H8M6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
E7SZ04_SHIBO/43-91              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F5MJH6_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
H4QG62_ECOLX/29-77              ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
H5IYI1_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
G2B8E2_ECOLX/2-45               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARR-------la.......
E2KK06_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H6MBI9_ECOLX/2-50               ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B3ICK4_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H5BK63_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
C6USR8_ECO5T/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B7A4G5_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
YDAF_ECO57/2-50                 ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4LS84_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
C9QV14_ECOD1/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5DG92_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4RXJ4_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E2K469_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H1ELG8_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5JG24_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5JX01_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4PXJ5_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4LUQ0_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
B2NY42_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
Q8XC56_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5LKF2_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
F1YB67_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5IGS2_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
H4M737_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4M7Z5_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4N890_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E7HIE6_ECOLX/2-50               ..DTLNLGNNESLVCGVFSNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
Q3Z1T6_SHISS/20-68              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
E9XM46_ECOLX/37-85              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H1EDS3_ECOLX/29-77              ..ETIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLVRHS-g........
H4Z769_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
E7K7F7_SHISO/20-68              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
G1ZGJ9_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E3XZN7_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
E6A4E1_ECOLX/29-77              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWQERNS-g........
H4MD32_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
G5UPE6_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H4Y2D1_ECOLX/29-77              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
G1Y9Z7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H4KFK4_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H5HHU4_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
C8U5T7_ECO10/29-77              ..DTIDLGNSESLVCGVFPNQYGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H5EG76_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
G5U764_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H4QGA5_ECOLX/2-50               ..DTLNLGNNESLVYGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
H5H751_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E8H244_ECO57/2-49               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-.........
B2NPY2_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4P534_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H4NKC6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4LAH7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4ZW30_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
E2K561_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4QJG6_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
E7J1C7_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4KWG3_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4UXJ8_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
B2PM28_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
B3AD53_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
G7REA7_ECOC2/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4M5H2_ECOLX/15-63              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4SA84_ECOLX/29-77              ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
B7A355_ECO57/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4XM68_ECOLX/29-77              ..DTINLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F7R5E0_SHIFL/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
E9VEY1_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F3V3N4_SHIDY/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
F4V2C7_ECOLX/54-93              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFK--------------pkmvp....
H5DK96_ECOLX/2-50               ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
E7H971_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
E7JQ31_ECOLX/2-50               ..DTIGLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D7XQB1_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4J6Z1_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E7K143_SHISO/2-50               ..NTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
F5QLT6_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
F8XHM4_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H4R0P7_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
F4TGA3_ECOLX/20-68              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4PHF3_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4NLA4_ECOLX/2-50               ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5HR13_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E7IJC8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARCWLARNT-d........
H5JFQ6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H1FAQ6_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
H5D0H0_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D3H4D4_ECO44/7-55               ..QKIDLGNNESIVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B1XCI4_ECODH/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
YDAF_ECOLI/2-50                 ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E7TZH4_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4TPJ5_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
A9N4J2_SALPB/1-39               ..----------MVYGVFPNNDGTFTAMTFTRSKTFKTEAGAQRWLTRN--hc.......
H4ZX17_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
E7UCQ2_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
B2PAT9_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H5BRZ2_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLTRNT-d........
C8UCK2_ECO1A/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNS-d........
H4IQJ9_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4X5P8_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
F4M984_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5PJD3_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
G5KM02_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5BAX7_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNAN.........
E6A635_ECOLX/11-59              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWQERNS-g........
H1FR43_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
B3B920_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
C6UZE7_ECO5T/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H4YVG9_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
F7MVZ3_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGARRWLARNT-d........
H4RTX8_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4ZAS9_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E9YNB2_ECOLX/28-76              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTETGAHRWLARNT-d........
H5W6I6_SALEN/5-53               ..QKIHLGNNESLVCGVFPNQDGTFTAMTYTRSRTFKTETGARRWLERNS-g........
H5QRI7_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4TPS6_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
D6IMJ2_ECOLX/20-68              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFQTEAGARRWLTRNT-d........
E7T7U9_SHIFL/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLAKNT-s........
H5MU72_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN--pg.......
H5AD64_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
E2KKG0_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
B7MV19_ECO81/66-114             ..DTIELGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
E7TUQ6_ECO57/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
E8JEP7_ECO57/29-68              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTE------------lar......
G5YFL0_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H5MCL0_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
H4MR37_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B3IRN0_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
D8A5B2_ECOLX/28-76              ..DTIELGNNESLVCGVFPNLDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
B1EPG7_9ESCH/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTLKTESGARRWLARNT-d........
H4QW04_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D6I8D9_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
G2ASZ8_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLARNS-d........
E0IWY9_ECOLW/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G0FEI7_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLARNT-c........
H3KM41_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H4P210_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
C8U8P1_ECO10/2-50               ..DTIDLGSNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4Z6G8_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4VUQ4_ECOLX/2-50               ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
B7LE79_ECO55/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5EZ09_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
F1ZHI5_ECOLX/28-76              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTETGAHRWLARNT-d........
H5FW76_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4ZSL0_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B2TV02_SHIB3/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLAKNT-s........
H4P3K8_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
G2CYL7_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G1ZX92_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGAHRWLARNT-d........
H4RUT3_ECOLX/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H5JX26_ECOLX/2-50               ..NTIDLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTENGARRWLERNS-g........
H5ABM8_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGAHRWLARNAN.........
H4UZG2_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
E9TXH9_ECOLX/23-71              ..DTIDLGNNESLVCAVFPNQDGTFTAMTYTKSKSFKTEAGARRWLAKNT-s........
H5EXB3_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
H5PJT6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H4FIH6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4SCL8_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E2KY50_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B3XKC8_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERDS-g........
E8HWC5_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLARNS-d........
H1ECJ7_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4T954_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
G1Z3V4_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B3ACP2_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B7UPZ6_ECO27/33-81              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
F5R6X6_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLRRHS-g........
H5D2M6_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5EJC8_ECOLX/2-44               ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKAFKTENGS---------psl......
H5HN11_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
H5EID1_ECOLX/2-50               ..DTLNLGNNESLVCGVFSNLDGTFTAMTYTRSKTFKTEAGARRWLARNT-d........
H4T7D3_ECOLX/29-77              ..DTIELGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAAAHRWLARNAN.........
E8I9P3_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
I0ZRU3_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B3ISN2_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5AFD2_ECOLX/2-50               ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
G2BNU6_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
E5ZQE6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5M081_ECOLX/2-50               ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
C8TT56_ECO26/31-79              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
C4ZVA3_ECOBW/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B7MS90_ECO81/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
G5X782_ECOLX/29-77              ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTAAGAHRWLARNT-d........
F5PNF3_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
F4TET0_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B2NZG7_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G2ASD9_ECOLX/20-68              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKKFKTEAGARRWLARNTN.........
F5P8G7_SHIFL/2-50               ..NTIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRHS-g........
H4PYL9_ECOLX/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B7L5C2_ECO55/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H1FHY6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E9TDM1_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
E1PH05_ECOAB/2-50               ..DTIELGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D8EUD3_ECOLX/1-35               .m---------------FPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H4MT02_ECOLX/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
C8TRW2_ECO26/54-102             ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5GQ39_ECOLX/29-77              ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B5Z301_ECO5E/29-77              ..DTLNLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLARNT-d........
H4QEF1_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
H5QBN2_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
I1B9C2_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
H5GR41_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E2KDY7_ECO57/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
G0D3L6_ECOLX/29-77              ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
D8E758_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
E2K2N7_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
B3C339_ECO57/2-50               ..DMLNLGNNESLVCGVFPNHDGTFTAMTYTRSKTFKTEAGAHRWLARNAN.........
H6MBP2_ECOLX/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
B1XF39_ECODH/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
B6ZZS8_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
H4I9R2_ECOLX/2-50               ..DTIDLGNSESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLERNS-g........
D7ZJR8_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLEKHT-v........
G2C3N2_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQNGTFIAMTYTKSKTFKTEAGARRWLIKNT-s........
F4UMV2_ECOLX/2-50               ..DTIDLGNNEYLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLERNS-g........
G2B8D9_ECOLX/2-50               ..DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS-g........
Q8Z5Z4_SALTI/2-50               ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEAGARRWLGRHS-g........
H4IA73_ECOLX/29-77              ..DMLNLGNNESLVCGVFPNQDGTFTAMTYTRSKTFKTEAGARRWLTRNT-d........
I0ZR26_ECOLX/2-50               ..QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT-v........
B2PRS8_ECO57/28-76              ..DTLDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLARNS-d........
C8TR53_ECO26/29-77              ..DTIDLGNNASLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLAKNT-s........
#=GC seq_cons                   ..DTIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTEsGARRWLtRNo.s........
//
DBGET integrated database retrieval system