GenomeNet

Database: Pfam
Entry: DUF1391
LinkDB: DUF1391
Original site: DUF1391 
#=GF ID   DUF1391
#=GF AC   PF07151.10
#=GF DE   Protein of unknown function (DUF1391)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_16216 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   32.60 98.10;
#=GF NC   22.30 17.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009821;
#=GF CC   This family consists of several Enterobacterial proteins of
#=GF CC   around 50 residues in length. Members of this family are found
#=GF CC   in Escherichia coli and Salmonella typhi where they are often
#=GF CC   known as YdfA. The function of this family is unknown.
#=GF SQ   5
#=GS I6H7C0_SHIFL/2-49   AC I6H7C0.1
#=GS A8GLQ0_SERP5/25-72  AC A8GLQ0.1
#=GS YDFA_ECOLI/2-49     AC P0ACW8.1
#=GS K8AWU3_9ENTR/2-49   AC K8AWU3.1
#=GS YDAF_ECOLI/2-49     AC P0ACW0.1
I6H7C0_SHIFL/2-49              n-TIDLGNNESPVYGVFPNQDGTFTAITYTKSKTFKTEAGARRWLGRH-s
A8GLQ0_SERP5/25-72             .ETLDCGNNERVKMGVFPNGDGTFTAMTYTQSRTFKTESGAAKWLLRQL.
YDFA_ECOLI/2-49                .DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN-s
K8AWU3_9ENTR/2-49              t-NLDLGNNESLTCGVFRNSDGTYTAMTFTKSKTFKTEAGARRWLARNT.
YDAF_ECOLI/2-49                .QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT.
#=GC seq_cons                  .pTIDLGNNESLVhGVFPNQDGTFTAMTYTKSKTFKTEuGARRWLtRph.
//
DBGET integrated database retrieval system