GenomeNet

Database: Pfam
Entry: DUF1391
LinkDB: DUF1391
Original site: DUF1391 
#=GF ID   DUF1391
#=GF AC   PF07151.11
#=GF DE   Protein of unknown function (DUF1391)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_16216 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   32.60 104.60;
#=GF NC   22.30 17.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR009821;
#=GF CC   This family consists of several Enterobacterial proteins of
#=GF CC   around 50 residues in length. Members of this family are found
#=GF CC   in Escherichia coli and Salmonella typhi where they are often
#=GF CC   known as YdfA. The function of this family is unknown.
#=GF SQ   4
#=GS A0A0T9XIM4_SALET/2-49  AC A0A0T9XIM4.1
#=GS A8GLQ0_SERP5/25-72     AC A8GLQ0.1
#=GS YDFA_ECOLI/2-49        AC P0ACW8.1
#=GS YDAF_ECOLI/2-49        AC P0ACW0.1
A0A0T9XIM4_SALET/2-49             k-AIDLGNNESVVYGVFPNNDGTFTAMTFTRSKTFKTEAGARRWLTRN-h
A8GLQ0_SERP5/25-72                .ETLDCGNNERVKMGVFPNGDGTFTAMTYTQSRTFKTESGAAKWLLRQL.
YDFA_ECOLI/2-49                   .DTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERN-s
YDAF_ECOLI/2-49                   .QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT.
#=GC seq_cons                     .psIDLGNNESlVhGVFPNpDGTFTAMTYT+SKTFKTEsGARRWLpRp..
//
DBGET integrated database retrieval system