GenomeNet

Database: Pfam
Entry: DUF1560
LinkDB: DUF1560
Original site: DUF1560 
#=GF ID   DUF1560
#=GF AC   PF07597.6
#=GF DE   Protein of unknown function (DUF1560)
#=GF AU   Studholme DJ
#=GF SE   Blast clustering of Pirellula genome
#=GF GA   25.00 25.00;
#=GF TC   25.90 37.10;
#=GF NC   20.40 17.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR011454;
#=GF CC   Small family of short hypothetical proteins in Rhodopirellula
#=GF CC   baltica.
#=GF SQ   4
#=GS Q7UHW2_RHOBA/5-39   AC Q7UHW2.1
#=GS F2AWH5_RHOBT/5-39   AC F2AWH5.1
#=GS Q7UUU5_RHOBA/42-90  AC Q7UUU5.1
#=GS Q7USN5_RHOBA/21-55  AC Q7USN5.1
Q7UHW2_RHOBA/5-39              CvgNTGVLKPNILCPKT----------------ISVRSAEISVPLAALAEH
F2AWH5_RHOBT/5-39              CvgNTGVLKPNIPGPGI----------------ISVRSAEISVPLVALAEH
Q7UUU5_RHOBA/42-90             C..TLGFLHPTSFAKRSRWECRRFEAKHPLSKNISVRSAEISVPLAALAEH
Q7USN5_RHOBA/21-55             CvgNTGVLKPNILCPRT----------------ISVRSAKISVPLAALAEH
#=GC seq_cons                  CVGNTGVLKPNIhsP+o................ISVRSAEISVPLAALAEH
//
DBGET integrated database retrieval system