GenomeNet

Database: Pfam
Entry: DUF1860
LinkDB: DUF1860
Original site: DUF1860 
#=GF ID   DUF1860
#=GF AC   PF08949.5
#=GF DE   Domain of unknown function (DUF1860)
#=GF AU   Mistry J, Sammut SJ
#=GF SE   pdb_1w8x
#=GF GA   25.00 25.00;
#=GF TC   462.10 461.40;
#=GF NC   19.00 18.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   15525981
#=GF RT   Insights into assembly from structural analysis of bacteriophage
#=GF RT   PRD1. 
#=GF RA   Abrescia NG, Cockburn JJ, Grimes JM, Sutton GC, Diprose JM,
#=GF RA   Butcher SJ, Fuller SD, San Martin C, Burnett RM, Stuart DI,
#=GF RA   Bamford DH, Bamford JK; 
#=GF RL   Nature. 2004;432:68-74.
#=GF DR   INTERPRO; IPR015044;
#=GF CC   This domain has no known function. It is predominantly found in
#=GF CC   the C-terminus of bacteriophage spike proteins [1].
#=GF SQ   7
#=GS Q3T4V2_BPPRD/122-340  AC Q3T4V2.1
#=GS Q3T514_BPPRD/122-340  AC Q3T514.1
#=GS P5_BPPRD/122-340      AC P22536.2
#=GS P5_BPPRD/122-340      DR PDB; 1YQ8 A; 142-339;
#=GS P5_BPPRD/122-340      DR PDB; 1YQ5 A; 197-339;
#=GS P5_BPPRD/122-340      DR PDB; 1YQ6 B; 197-339;
#=GS P5_BPPRD/122-340      DR PDB; 1YQ6 A; 197-339;
#=GS P5_BPPRD/122-340      DR PDB; 1YQ5 B; 197-339;
#=GS P5_BPPRD/122-340      DR PDB; 1YQ6 C; 197-339;
#=GS F7IW32_BPPRD/122-340  AC F7IW32.1
#=GS Q3T4Y3_BPPRD/122-340  AC Q3T4Y3.1
#=GS Q6EDX8_BPPRD/122-340  AC Q6EDX8.1
#=GS Q3T545_BPPRD/122-340  AC Q3T545.1
Q3T4V2_BPPRD/122-340             PSGIKGDKGDPGAPGPAGGTVVVEDSGASFGESLLDTTSEPGKILVKRISGGSGITVTDYGDKVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
Q3T514_BPPRD/122-340             PSGIKGDKGDPGEPGPAGGTVVVEDSGALFGESLLDTTSEPGKILVKRISAGSGITVTDYGDEVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNTVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
P5_BPPRD/122-340                 PSGIKGDKGDPGAPGPAGGTVVVEDSGASFGESLLDTTSEPGKILVKRISGGSGITVTDYGDQVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNSVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
#=GR P5_BPPRD/122-340      SS    XXXXXXXXXXXXXXXXXXXXXXXXXXSSSXSTTTXXSSSSTTXXXXXXXXXXTTEEEEEETTEEEEEEX-XXXXXX---SEEEEEEEBTTTTS-SSB-TT-------TTSEEEEEESSSEEEESSSEEE-TT--EEEEEEEEEE-TT--SSEEEEEEEETTEEEEEEEE--SST-EEEEEEEEEE---S-TTTSEEEEEEEESSS-BSS-EEEEEEEE-X
F7IW32_BPPRD/122-340             PSGIKGDKGDPGAPGPAGGTVVVEDSGASFGESLLDTTSEPGKILVKRISGGSGITVTDYGDEVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNTVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCDVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
Q3T4Y3_BPPRD/122-340             PSGIKGDKGDPGEPGPAGGTVVVEDSGA-FGESLLDTASDPGKILVKRISAGSGITLTDYGDEIEIEATGGGGGGGGGVTDALSLFYTTSSGGPASIAANALTDFDLSGALELNKVGTGMTKAADGIQLAAGKSGLYQVTMTVKNNTVTTGNYLLRVKYGSNEYVAACPASTLTAGGTISLLIYCQVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
Q6EDX8_BPPRD/122-340             PSGIKGDKGDPGAPGPAGGTVVVEDSGASFGESLLDTTSEPGKILVKRISGGSGITVTDYGDEVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNTVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCDVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
Q3T545_BPPRD/122-340             PSGIKGDKGDPGEPGPAGGTVVVEDSGALFGESLLDTTSEPGKILVKRISAGSGITVTDYGDEVEIEAS-GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNTVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCNVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
#=GC SS_cons                     XXXXXXXXXXXXXXXXXXXXXXXXXXSSSXSTTTXXSSSSTTXXXXXXXXXXTTEEEEEETTEEEEEEX-XXXXXX---SEEEEEEEBTTTTS-SSB-TT-------TTSEEEEEESSSEEEESSSEEE-TT--EEEEEEEEEE-TT--SSEEEEEEEETTEEEEEEEE--SST-EEEEEEEEEE---S-TTTSEEEEEEEESSS-BSS-EEEEEEEE-X
#=GC seq_cons                    PSGIKGDKGDPGtPGPAGGTVVVEDSGA.FGESLLDTTSEPGKILVKRISuGSGITVTDYGDEVEIEAS.GGGGGGGGVTDALSLMYSTSTGGPASIAANALTDFDLSGALTVNoVGTGLTKSAAGIQLAAGKSGLYQITMTVKNNTVTTGNYLLRVKYGSSDFVVACPASSLTAGGTISLLIYCsVLGVPSLDVLKFSLCNDGAALSNYIINITAAKIN
//
DBGET integrated database retrieval system