GenomeNet

Database: Pfam
Entry: DUF1921
LinkDB: DUF1921
Original site: DUF1921 
#=GF ID   DUF1921
#=GF AC   PF09081.5
#=GF DE   Domain of unknown function (DUF1921)
#=GF AU   Sammut SJ
#=GF SE   pdb_1gcy
#=GF GA   25.00 25.00;
#=GF TC   29.30 89.70;
#=GF NC   24.80 17.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   11272837
#=GF RT   Crystallization and structural analysis of intact
#=GF RT   maltotetraose-forming exo-amylase from Pseudomonas stutzeri. 
#=GF RA   Mezaki Y, Katsuya Y, Kubota M, Matsuura Y; 
#=GF RL   Biosci Biotechnol Biochem. 2001;65:222-225.
#=GF DR   INTERPRO; IPR015165;
#=GF DR   SCOP; 1gcy; fa;
#=GF CC   This domain, which is found in a set of prokaryotic amylases,
#=GF CC   has no known function [1].
#=GF SQ   11
#=GS A5CVD5_9PSED/390-440  AC A5CVD5.1
#=GS Q2SEA8_HAHCH/396-446  AC Q2SEA8.1
#=GS Q1EJP2_9PSED/388-438  AC Q1EJP2.1
#=GS A4XX23_PSEMY/396-446  AC A4XX23.1
#=GS H7EX07_PSEST/388-438  AC H7EX07.1
#=GS A4VQ66_PSEU5/448-498  AC A4VQ66.1
#=GS AMT4_PSEST/388-438    AC P13507.2
#=GS AMT4_PSEST/388-438    DR PDB; 1QI5 A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1JDC A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 2AMG A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1QPK A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1JDD A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1QI4 A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1JDA A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1GCY A; 367-417;
#=GS AMT4_PSEST/388-438    DR PDB; 1QI3 A; 367-417;
#=GS A4BAT5_9GAMM/385-433  AC A4BAT5.1
#=GS F8H0A3_PSEUT/388-438  AC F8H0A3.1
#=GS F2N5X7_PSEU6/388-438  AC F2N5X7.1
#=GS AMT4_PSESA/388-438    AC P22963.1
A5CVD5_9PSED/390-440             SGYSGLVATVRGTAQTLVMALGSNLSSPAEVSSGSFSQALNQDSGQLRIWT
Q2SEA8_HAHCH/396-446             DGFSGLVGTTSGSNGKLLFAIDSNFSSPNQVAGGAWNLAVNEDNGRIRIWR
Q1EJP2_9PSED/388-438             SGYSGLVATVSGSQQTLVVALNSDLANPGQVASGSFSEAVNASNGQVRVWR
A4XX23_PSEMY/396-446             TGFSGLVATISGSQQQLLIALDSNLSSPGQVASGDFTQALNTDNGAIRIWR
H7EX07_PSEST/388-438             SGYSGLVATVSGTQQTLVVALNSNLSNPGQVASGSFSEAVNASNGQVRVWR
A4VQ66_PSEU5/448-498             SGYSGLVATVTGSQQTLVVALNSNLSNPGQVASGSFSEAVNTSNGQVRVWR
AMT4_PSEST/388-438               SGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWR
#=GR AMT4_PSEST/388-438    SS    TTSSSEEEEEE-SS-EEEEEES-----GGGT-SS--EEEEEETTTTEEEEE
A4BAT5_9GAMM/385-433             NQFSGLNGVTQGVNKKVVFAIDSNLSNPNQVTSGSFSMVMNE--GGVRVWK
F8H0A3_PSEUT/388-438             SGYSGLVATVTGSQQTLVVALNSNLSNPGQVASGSFSEAVNTSNGQVRVWR
F2N5X7_PSEU6/388-438             SGYSGLVATVTGSQQTLVVALNSNLSNPGQVASGSFSEAVNTSNGQVRVWR
AMT4_PSESA/388-438               SGYSGLVATVSGSQQTLVVALNSDLANPGQVASGSFSEAVNASNGQVRVWR
#=GC SS_cons                     TTSSSEEEEEE-SS-EEEEEES-----GGGT-SS--EEEEEETTTTEEEEE
#=GC seq_cons                    SGYSGLVATVoGSQQTLVVALNSNLSNPGQVASGSFSEAVNsSNGQVRVWR
//
DBGET integrated database retrieval system