GenomeNet

Database: Pfam
Entry: DUF1945
LinkDB: DUF1945
Original site: DUF1945 
#=GF ID   DUF1945
#=GF AC   PF09178.8
#=GF DE   Domain of unknown function (DUF1945)
#=GF AU   Sammut SJ
#=GF SE   pdb_1lwh
#=GF GA   21.20 21.20;
#=GF TC   23.00 128.20;
#=GF NC   19.00 21.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   12139940
#=GF RT   Crystal structure of Thermotoga maritima
#=GF RT   4-alpha-glucanotransferase and its acarbose complex:
#=GF RT   implications for substrate specificity and catalysis. 
#=GF RA   Roujeinikova A, Raasch C, Sedelnikova S, Liebl W, Rice DW; 
#=GF RL   J Mol Biol. 2002;321:149-162.
#=GF DR   INTERPRO; IPR015261;
#=GF DR   SCOP; 1lwh; fa;
#=GF CC   Members of this family, which are predominantly found in
#=GF CC   prokaryotic 4-alpha-glucanotransferase, adopt a structure
#=GF CC   composed of six antiparallel beta-strands, four of which form a
#=GF CC   beta-sheet and another two form a type I' beta-hairpin. The role
#=GF CC   of this family of domains, has not, as yet, been defined [1].
#=GF SQ   1
#=GS MGTA_THEMA/392-441  AC P80099.2
#=GS MGTA_THEMA/392-441  DR PDB; 1LWH B; 833-882;
#=GS MGTA_THEMA/392-441  DR PDB; 1LWJ B; 833-882;
#=GS MGTA_THEMA/392-441  DR PDB; 1LWJ A; 392-441;
#=GS MGTA_THEMA/392-441  DR PDB; 1LWH A; 392-441;
MGTA_THEMA/392-441             AKLEFLCKEDKFLVYRLYDDQHSLKVFHNLSGEEVVFEGVKMKPYKTEVV
#=GR MGTA_THEMA/392-441  SS    -EEEEEEEESSEEEEEEEETTEEEEEEEE-SSS-EEETTEEE-TT-EEE-
#=GC SS_cons                   -EEEEEEEESSEEEEEEEETTEEEEEEEE-SSS-EEETTEEE-TT-EEE-
#=GC seq_cons                  AKLEFLCKEDKFLVYRLYDDQHSLKVFHNLSGEEVVFEGVKMKPYKTEVV
//
DBGET integrated database retrieval system