GenomeNet

Database: Pfam
Entry: DUF1953
LinkDB: DUF1953
Original site: DUF1953 
#=GF ID   DUF1953
#=GF AC   PF09196.5
#=GF DE   Domain of unknown function (DUF1953)
#=GF AU   Sammut SJ
#=GF SE   pdb_1iv8
#=GF GA   25.00 25.00;
#=GF TC   41.80 122.20;
#=GF NC   22.90 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR015279;
#=GF DR   SCOP; 1iv8; fa;
#=GF CC   This domain is found in the Archaeal protein maltooligosyl
#=GF CC   trehalose synthase produced by Sulfolobus spp. Its function has
#=GF CC   not, as yet, been defined.
#=GF SQ   2
#=GS Q973H2_SULTO/642-704  AC Q973H2.1
#=GS Q973H2_SULTO/642-704  DR PDB; 3HJE A; 642-704;
#=GS Q53688_9CREN/654-719  AC Q53688.1
#=GS Q53688_9CREN/654-719  DR PDB; 1IV8 A; 654-719;
Q973H2_SULTO/642-704             EYKPLKLQKGLCGFMRGDKVLVIVKT---LNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
#=GR Q973H2_SULTO/642-704  SS    -EEE----TTEEEEEETTTEEEEEES---SSS-EEEEEEEEEEETTTTEEEEEEEEE-SS-EEEE-
Q53688_9CREN/654-719             EYKGLDLEEGLCGFIRFNKILVIIKTKGSVNYKLKLEEGAIYTDVLTGEEIKKEVQINELPRILVR
#=GR Q53688_9CREN/654-719  SS    -EEEE---TTEEEEEETTTEEEEEES-TT--EEEE--SS-EEEETTT--EEESEEEE-SS-EEEEE
#=GC SS_cons                     -EEEE---TTEEEEEETTTEEEEEES-TTSSCEEEEECCEEEEETTTTEEEECEEEE-SS-EEEEE
#=GC seq_cons                    EYKsLcLpcGLCGFhRhsKlLVIlKT...lNhchclE.su.YTDVlTsEpl+tcVplscLPhILV+
//
DBGET integrated database retrieval system