GenomeNet

Database: Pfam
Entry: DUF2482
LinkDB: DUF2482
Original site: DUF2482 
#=GF ID   DUF2482
#=GF AC   PF10655.6
#=GF DE   Hypothetical protein of unknown function (DUF2482)
#=GF AU   FIGfam, Mistry J, Coggill P
#=GF SE   FIG030041 (Release 2.0)
#=GF GA   25.00 25.00;
#=GF TC   26.60 214.70;
#=GF NC   23.50 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR018917;
#=GF CC   All the members of this very small, very short family are
#=GF CC   derived from bacteriophages, of the SA bacteriophages 11, Mu50B,
#=GF CC   system, and from the Staphylococcal_phi-Mu50B-like_prophages
#=GF CC   subsystem. All members are hypothetical proteins.
#=GF SQ   1
#=GS E8SHZ4_STAPH/1-98  AC E8SHZ4.1
E8SHZ4_STAPH/1-98             MKFKNMTEEQIIEVVTAKSRELYDLIVKIDKETDFNMSLITGIALDKGDVQNIFNQIVVGKPSSIVNMLVTADNFKKIVESTIAIKSLRDYVENNEKD
#=GC seq_cons                 MKFKNMTEEQIIEVVTAKSRELYDLIVKIDKETDFNMSLITGIALDKGDVQNIFNQIVVGKPSSIVNMLVTADNFKKIVESTIAIKSLRDYVENNEKD
//
DBGET integrated database retrieval system