GenomeNet

Database: Pfam
Entry: DUF2543
LinkDB: DUF2543
Original site: DUF2543 
#=GF ID   DUF2543
#=GF AC   PF10820.7
#=GF DE   Protein of unknown function (DUF2543)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   140.70 140.60;
#=GF NC   20.40 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020251;
#=GF CC   This family of proteins with unknown function appear to be
#=GF CC   restricted to Enterobacteriaceae. The family has a highly
#=GF CC   conserved sequence.
#=GF SQ   38
#=GS A0A0L7T5J5_9GAMM/1-81     AC A0A0L7T5J5.1
#=GS A0A0D8QBK0_RAOPL/1-81     AC A0A0D8QBK0.1
#=GS A0A0Q4MJD2_9GAMM/1-81     AC A0A0Q4MJD2.1
#=GS A0A089UK85_9ENTR/1-81     AC A0A089UK85.1
#=GS C0AU24_9GAMM/1-81         AC C0AU24.1
#=GS Q32FZ4_SHIDS/1-81         AC Q32FZ4.1
#=GS A0A071LVE4_9ENTR/1-81     AC A0A071LVE4.1
#=GS W1G593_ECOLX/1-81         AC W1G593.1
#=GS A0A0A1B3D4_9GAMM/1-81     AC A0A0A1B3D4.1
#=GS A0A0G3Q7R5_KLUIN/1-81     AC A0A0G3Q7R5.1
#=GS J7UBN3_MORMO/1-81         AC J7UBN3.1
#=GS E1SBB5_PANVC/1-81         AC E1SBB5.1
#=GS E6WK46_PANSA/1-81         AC E6WK46.1
#=GS A0A097R309_HAFAL/1-81     AC A0A097R309.1
#=GS A0A0L0GIK4_9ENTR/1-81     AC A0A0L0GIK4.1
#=GS A0A0H0CRQ2_9ENTR/1-81     AC A0A0H0CRQ2.1
#=GS A0A0U5E9A0_9GAMM/1-81     AC A0A0U5E9A0.1
#=GS H5V4W3_ESCHE/1-81         AC H5V4W3.1
#=GS A0A090UYR4_ESCVU/1-81     AC A0A090UYR4.1
#=GS A7MRM7_CROS8/1-81         AC A7MRM7.1
#=GS A0A0J5L7Z6_PLUGE/1-81     AC A0A0J5L7Z6.1
#=GS D4GCV4_PANAM/1-81         AC D4GCV4.1
#=GS K8VY27_9GAMM/1-81         AC K8VY27.1
#=GS A0A0A2WDU6_BEABA/872-952  AC A0A0A2WDU6.1
#=GS W1H1J5_KLEPN/1-81         AC W1H1J5.1
#=GS W1DQK6_KLEPN/1-81         AC W1DQK6.1
#=GS A0A085IKS2_9ENTR/1-81     AC A0A085IKS2.1
#=GS YMJA_ECOLI/1-81           AC P0ACV8.1
#=GS W1I0H7_KLEPN/1-81         AC W1I0H7.1
#=GS D8MTS1_ERWBE/1-81         AC D8MTS1.1
#=GS Q6D6U9_PECAS/1-81         AC Q6D6U9.1
#=GS V5AVN4_ENTCL/1-81         AC V5AVN4.1
#=GS W1DV62_KLEPN/1-81         AC W1DV62.1
#=GS A0A085JFD1_9GAMM/1-81     AC A0A085JFD1.1
#=GS A0A0J8YPQ8_9BACT/1-81     AC A0A0J8YPQ8.1
#=GS A4WC01_ENT38/1-81         AC A4WC01.1
#=GS A6T9K3_KLEP7/1-81         AC A6T9K3.1
#=GS J2X8U8_KLEPN/1-81         AC J2X8U8.1
A0A0L7T5J5_9GAMM/1-81                MNNEIPLKYYDIVDEYSTEAAVPVSESQRDSLAHYFQLLITRLMYNEEISEDAQKEIAREAGIDELRIDEIATFLNQWGNE
A0A0D8QBK0_RAOPL/1-81                MNNEIPLKYYDIADEYATECAKPVSEAEREPLAHYFQLLLSRLMNNEEISEEAQAEMAHEAGLHPDRIDEIATFLNQWGNE
A0A0Q4MJD2_9GAMM/1-81                MTNAIPLKYYDIVDEYATETAQPVADAERDPLARYFQLLIERLTNNEEIDEQAQQDMAVETGIAEQRIDDIANFLNQWGNE
A0A089UK85_9ENTR/1-81                MNNEIDLKYYDIADEYSTEAAKPVAEDERDAVAHYFQLLITRLMNNEEISEEAQGEMAVEAGLAEQRIDEIAEFLNQWGNE
C0AU24_9GAMM/1-81                    MNNDIHFKYYDMVEEYAMESAKPVAQAEEDALALYFQLLLTRLTNNEEISESAQQEMAKEAGIDKKRIDDIAEFLNRWGNE
Q32FZ4_SHIDS/1-81                    MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
A0A071LVE4_9ENTR/1-81                MNQAIPLKFYDITDEYSTETEQAVSEAERDALAHYFQLLITRLMNNEEISEQAQADMATEAGINAQRIDEIANFLNQWGNE
W1G593_ECOLX/1-81                    MNNDIPLKYYDIADEYATEAAKPVSDTERDALAHYFQQLITRLMNNEEISEEAQQEMATVAGVDAQRIDDIAEFLNRWGNE
A0A0A1B3D4_9GAMM/1-81                MNNEVPLKYYDIVDEYSTESAKAVGESEREPLARYFQLLITRLMNNEEIGEDAQQEMASEAGIDARRIDEIAEFLNQWGNE
A0A0G3Q7R5_KLUIN/1-81                MNNEIPLKFYDIVDEYSTESEKPVSESERDPLAHYFQLLITRLMANEEISEEAQQEMAREAGINEKRIDDVANFLNQWGNE
J7UBN3_MORMO/1-81                    MENIVPDKYYDIADEYALESEEPVEEQEYDGLAHYFQLLITCLTNNEEISEEAQKKMAAEAGINKQRIDDIAEFLNRWGND
E1SBB5_PANVC/1-81                    MNNEISLKYYDVADEYATEAAKSVSEAERTPLAHYFQLLITRLMNNEEISEESQQDMAREAGIDEQRIDDIAEFLNRWGNE
E6WK46_PANSA/1-81                    MNNDVPLKFYDIVDEYEAEAAKPVSESERDALARYFQLLITRLMNNEEISEQAQQEMASEAGIEALRIDEIATFLNQWGNE
A0A097R309_HAFAL/1-81                MNHDVSLKYYDILDEYSTESAKPVGESERDSLAHYFQLLITRLMNNEEVSEDTQKEMADEAGIDEQRIDDIAEFLNRWGNE
A0A0L0GIK4_9ENTR/1-81                MTNEIPLKFYDIVDEYSTESAMPVSESERDSLAHYFQLLITRLTNNEEISEEAQKEMAGVAGINTLRIDEIATFLNEWGNE
A0A0H0CRQ2_9ENTR/1-81                MNNDIPLKYYDIVEEYATEAAKPVSESEQDPLAHYFQLLLTRLSNNEEIDEEAQQEMAREAGVHAERIDDIANFLNQWGNE
A0A0U5E9A0_9GAMM/1-81                MNHEVPIKYFDIADEYSTEAATPLSDAEREPVAHYFELLLTRLSNNEEIDEAAQQEMAVDAGIDPQRIDEIANFLNQWGNE
H5V4W3_ESCHE/1-81                    MNNEIPLKFYDIVDEYSTETETPVSETERDALAHYFQLLITRLMNNEEISEEAQQEMAVEAGINALRIDEIATFLNQWGNE
A0A090UYR4_ESCVU/1-81                MSSETPLKYYDIADEYATEAAKPVDEAERDALARYFELLITRLMNNEEISEEAQREMALESSIDAERIDEIAEFLNRWGNE
A7MRM7_CROS8/1-81                    MSNDIPIKFYDIADEYATETELPVSDAERDRLAHYFQLLITRLMNNEEISEEAQHEMAREAGIPEGRIDEIANFLNQWGNE
A0A0J5L7Z6_PLUGE/1-81                MNNETPLKFYDIVDEYQTEAAKPVAESERDALARYFQLLIERLTAGEEISEEAQGEAAVEAGIDPLRIDDIAEFLNRWGNE
D4GCV4_PANAM/1-81                    MNNEVSLKYYDIADEYSSETETPVSESERDALAHYFQLLIGRLMNNEEISEEAQKEMAVEAGINEQRIDEIATFLNQWGNE
K8VY27_9GAMM/1-81                    MNNEISLKYYDIVDEYEAETQISVDESERTPLAHYFQLLLTRLMNNEEISEEAQTEMAKEAKIDEKHIDEIATFLNQWGNE
A0A0A2WDU6_BEABA/872-952             MNNEIDLKYYDIADEYSTESAKPVSDEERDAVARYFQLLITRLMNNEEISEEAQGEMAVEAGLAEQRIDEIAEFLNQWGNE
W1H1J5_KLEPN/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
W1DQK6_KLEPN/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
A0A085IKS2_9ENTR/1-81                MNNDIPLKYYDIAEEYASESAKPVGESELDSLAHYFQLLLTRLMNNEEISEEAQQEMATEAGISAQRIDEIANFLNEWGNE
YMJA_ECOLI/1-81                      MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
W1I0H7_KLEPN/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
D8MTS1_ERWBE/1-81                    MNNEIALKYYDIADDYVAESAKPVSEPQRDALAHYFQLLLTRLSDNQEISEDTQNEMAREAGIDEQQIDGIANYLNEWGNE
Q6D6U9_PECAS/1-81                    MNNEVSLKYYDIVDEYSTESAEPVSESERESLARYFQLLITRLTNNEEISENAQKEMASEAGIDERRIDEIATFLNQWGNE
V5AVN4_ENTCL/1-81                    MNHDIPLKFYDIADEYSTESATPVSESERDAVAHYFQLLLTRLSNNEEISEEAQQEMAREAGLKESRIDEIANFLNEWGNE
W1DV62_KLEPN/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINEDRIDDIANFLNQWGNE
A0A085JFD1_9GAMM/1-81                MNNDVSLKYYDIVDEYATETEKAVAETERDALAHYFQLLISRLNDNQEISEQAQQEMAGEAGIAAERIDDIADFLNRWGNE
A0A0J8YPQ8_9BACT/1-81                MHNDVPLKYYDIADEYATECAKPVSEAERDSLALYFQLLLTRLMNNEEISEEGQKEMAVEANIDPQRIDDIANFLNQWGNE
A4WC01_ENT38/1-81                    MTNEIPLKYFDIADEYSKETATPVSESEREPLAHYFQMLITRLMNNEEISESAQQEMANEAGIKNERIDEIATFLNQWGNE
A6T9K3_KLEP7/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
J2X8U8_KLEPN/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINEDRIDDIANFLNQWGNE
#=GC seq_cons                        MNN-IPLKYYDIsDEYuTEuApPVuEuERDuLAHYFQLLITRLhNNEEISEEAQpEMApEAGIsppRID-IAsFLNQWGNE
//
DBGET integrated database retrieval system