GenomeNet

Database: Pfam
Entry: DUF2543
LinkDB: DUF2543
Original site: DUF2543 
#=GF ID   DUF2543
#=GF AC   PF10820.6
#=GF DE   Protein of unknown function (DUF2543)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   144.60 144.50;
#=GF NC   20.40 17.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020251;
#=GF CC   This family of proteins with unknown function appear to be
#=GF CC   restricted to Enterobacteriaceae. The family has a highly
#=GF CC   conserved sequence.
#=GF SQ   27
#=GS D4GCV4_PANAM/1-81         AC D4GCV4.1
#=GS A0A089PSK6_PLUGE/1-81     AC A0A089PSK6.1
#=GS K8VY27_9ENTR/1-81         AC K8VY27.1
#=GS A0A089UK85_9ENTR/1-81     AC A0A089UK85.1
#=GS A0A0A2WDU6_BEABA/872-952  AC A0A0A2WDU6.1
#=GS I6H296_SHIFL/1-81         AC I6H296.1
#=GS C0AU24_9ENTR/1-81         AC C0AU24.1
#=GS Q32FZ4_SHIDS/1-81         AC Q32FZ4.1
#=GS YMJA_ECOLI/1-81           AC P0ACV8.1
#=GS A0A0G3Q7R5_KLUIN/1-81     AC A0A0G3Q7R5.1
#=GS A0A0A1B3D4_9ENTR/1-81     AC A0A0A1B3D4.1
#=GS J7UBN3_MORMO/1-81         AC J7UBN3.1
#=GS A0A0A0Z893_9ENTR/1-81     AC A0A0A0Z893.1
#=GS E1SBB5_PANVC/1-81         AC E1SBB5.1
#=GS E6WK46_PANSA/1-81         AC E6WK46.1
#=GS D8MTS1_ERWBE/1-81         AC D8MTS1.1
#=GS A0A097R309_HAFAL/1-81     AC A0A097R309.1
#=GS K8B4F9_9ENTR/1-81         AC K8B4F9.1
#=GS A0A0L0GIK4_9ENTR/1-81     AC A0A0L0GIK4.1
#=GS Q6D6U9_PECAS/1-81         AC Q6D6U9.1
#=GS V5AVN4_ENTCL/1-81         AC V5AVN4.1
#=GS L0M7P6_ENTBF/1-81         AC L0M7P6.1
#=GS I6H5F5_SHIFL/1-81         AC I6H5F5.1
#=GS A4WC01_ENT38/1-81         AC A4WC01.1
#=GS A6T9K3_KLEP7/1-81         AC A6T9K3.1
#=GS A7MRM7_CROS8/1-81         AC A7MRM7.1
#=GS A0A090U2L8_9ENTR/1-81     AC A0A090U2L8.1
D4GCV4_PANAM/1-81                    MNNEVSLKYYDIADEYSSETETPVSESERDALAHYFQLLIGRLMNNEEISEEAQKEMAVEAGINEQRIDEIATFLNQWGNE
A0A089PSK6_PLUGE/1-81                MNNETPLKFYDIVDEYQTEAAKPVAESERDALARYFQLLIERLTAGEEISEEAQAEMAVEAGIDPLRIDDIAEFLNRWGNE
K8VY27_9ENTR/1-81                    MNNEISLKYYDIVDEYEAETQISVDESERTPLAHYFQLLLTRLMNNEEISEEAQTEMAKEAKIDEKHIDEIATFLNQWGNE
A0A089UK85_9ENTR/1-81                MNNEIDLKYYDIADEYSTEAAKPVAEDERDAVAHYFQLLITRLMNNEEISEEAQGEMAVEAGLAEQRIDEIAEFLNQWGNE
A0A0A2WDU6_BEABA/872-952             MNNEIDLKYYDIADEYSTESAKPVSDEERDAVARYFQLLITRLMNNEEISEEAQGEMAVEAGLAEQRIDEIAEFLNQWGNE
I6H296_SHIFL/1-81                    MNNDIPLKYYDIADEYATEAAKPVSDAERDALAHYFQQLITRLMNNEEISEDAQQEMATVAGVDAQRIDDIAEFLNRWGNE
C0AU24_9ENTR/1-81                    MNNDIHFKYYDMVEEYAMESAKPVAQAEEDALALYFQLLLTRLTNNEEISESAQQEMAKEAGIDKKRIDDIAEFLNRWGNE
Q32FZ4_SHIDS/1-81                    MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
YMJA_ECOLI/1-81                      MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
A0A0G3Q7R5_KLUIN/1-81                MNNEIPLKFYDIVDEYSTESEKPVSESERDPLAHYFQLLITRLMANEEISEEAQQEMAREAGINEKRIDDVANFLNQWGNE
A0A0A1B3D4_9ENTR/1-81                MNNEVPLKYYDIVDEYSTESAKAVGESEREPLARYFQLLITRLMNNEEIGEDAQQEMASEAGIDARRIDEIAEFLNQWGNE
J7UBN3_MORMO/1-81                    MENIVPDKYYDIADEYALESEEPVEEQEYDGLAHYFQLLITCLTNNEEISEEAQKKMAAEAGINKQRIDDIAEFLNRWGND
A0A0A0Z893_9ENTR/1-81                MKHEIDLKYYDIADAYAEECEKPVSEAERDPLAHYFQLLITRLNNHQEISEEAQHEMAREAGIADARIDDVANFLNEWGNE
E1SBB5_PANVC/1-81                    MNNEISLKYYDVADEYATEAAKSVSEAERTPLAHYFQLLITRLMNNEEISEESQQDMAREAGIDEQRIDDIAEFLNRWGNE
E6WK46_PANSA/1-81                    MNNDVPLKFYDIVDEYEAEAAKPVSESERDALARYFQLLITRLMNNEEISEQAQQEMASEAGIEALRIDEIATFLNQWGNE
D8MTS1_ERWBE/1-81                    MNNEIALKYYDIADDYVAESAKPVSEPQRDALAHYFQLLLTRLSDNQEISEDTQNEMAREAGIDEQQIDGIANYLNEWGNE
A0A097R309_HAFAL/1-81                MNHDVSLKYYDILDEYSTESAKPVGESERDSLAHYFQLLITRLMNNEEVSEDTQKEMADEAGIDEQRIDDIAEFLNRWGNE
K8B4F9_9ENTR/1-81                    MSKEIPIKFYDIADEYATEAEKPVDDAERDRLAHYFELLITRLMNNEEISEDAQQEMAREAGIDETRIDEIANFLNQWGNE
A0A0L0GIK4_9ENTR/1-81                MTNEIPLKFYDIVDEYSTESAMPVSESERDSLAHYFQLLITRLTNNEEISEEAQKEMAGVAGINTLRIDEIATFLNEWGNE
Q6D6U9_PECAS/1-81                    MNNEVSLKYYDIVDEYSTESAEPVSESERESLARYFQLLITRLTNNEEISENAQKEMASEAGIDERRIDEIATFLNQWGNE
V5AVN4_ENTCL/1-81                    MNHDIPLKFYDIADEYSTESATPVSESERDAVAHYFQLLLTRLSNNEEISEEAQQEMAREAGLKESRIDEIANFLNEWGNE
L0M7P6_ENTBF/1-81                    MNNDIPLKYYDIADEYATECAEPVAESERTPLAHYFQLLLTRLMNNEEISEEAQKEMADEAGINAARIDEIAEFLNQWGNE
I6H5F5_SHIFL/1-81                    MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
A4WC01_ENT38/1-81                    MTNEIPLKYFDIADEYSKETATPVSESEREPLAHYFQMLITRLMNNEEISESAQQEMANEAGIKNERIDEIATFLNQWGNE
A6T9K3_KLEP7/1-81                    MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
A7MRM7_CROS8/1-81                    MSNDIPIKFYDIADEYATETELPVSDAERDRLAHYFQLLITRLMNNEEISEEAQHEMAREAGIPEGRIDEIANFLNQWGNE
A0A090U2L8_9ENTR/1-81                MNNDIPLKYYDIADEYATEAAKPVSDAERDALAHYFQQLITRLMNNEEISEEAQQEMATVAGVDAQRIDDIAEFLNRWGNE
#=GC seq_cons                        MNN-IPLKYYDIADEYuTEuAcPVuEuERDsLAHYFQLLITRLMNNEEISEEAQpEMAsEAGIsppRID-IApFLNpWGNE
//
DBGET integrated database retrieval system