GenomeNet

Database: Pfam
Entry: DUF2543
LinkDB: DUF2543
Original site: DUF2543 
#=GF ID   DUF2543
#=GF AC   PF10820.5
#=GF DE   Protein of unknown function (DUF2543)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   145.70 145.50;
#=GF NC   19.70 17.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020251;
#=GF CC   This family of proteins with unknown function appear to be
#=GF CC   restricted to Enterobacteriaceae. The family has a highly
#=GF CC   conserved sequence.
#=GF SQ   19
#=GS G9Z6E5_9ENTR/1-81      AC G9Z6E5.1
#=GS D4GCV4_PANAM/1-81      AC D4GCV4.1
#=GS A0A089PSK6_PLUGE/1-81  AC A0A089PSK6.1
#=GS K8VY27_9ENTR/1-81      AC K8VY27.1
#=GS A0A089UK85_9ENTR/1-81  AC A0A089UK85.1
#=GS Q32FZ4_SHIDS/1-81      AC Q32FZ4.1
#=GS YMJA_ECOLI/1-81        AC P0ACV8.1
#=GS A0A0A1B3D4_9ENTR/1-81  AC A0A0A1B3D4.1
#=GS A0A0A0Z893_9ENTR/1-81  AC A0A0A0Z893.1
#=GS E1SBB5_PANVC/1-81      AC E1SBB5.1
#=GS J7UBN3_MORMO/1-81      AC J7UBN3.1
#=GS E6WK46_PANSA/1-81      AC E6WK46.1
#=GS E2XGW5_SHIDY/1-81      AC E2XGW5.1
#=GS D8MTS1_ERWBE/1-81      AC D8MTS1.1
#=GS A0A097R309_HAFAL/1-81  AC A0A097R309.1
#=GS Q6D6U9_PECAS/1-81      AC Q6D6U9.1
#=GS A4WC01_ENT38/1-81      AC A4WC01.1
#=GS A7MRM7_CROS8/1-81      AC A7MRM7.1
#=GS A6T9K3_KLEP7/1-81      AC A6T9K3.1
G9Z6E5_9ENTR/1-81                 MNNEIPLKYYDITEEYATEAAQPVSEAEHDSLAHYFQLLLTRLMNNEEISEEAQVEMAREAGIDAKRIDDIAEFLNRWGNE
D4GCV4_PANAM/1-81                 MNNEVSLKYYDIADEYSSETETPVSESERDALAHYFQLLIGRLMNNEEISEEAQKEMAVEAGINEQRIDEIATFLNQWGNE
A0A089PSK6_PLUGE/1-81             MNNETPLKFYDIVDEYQTEAAKPVAESERDALARYFQLLIERLTAGEEISEEAQAEMAVEAGIDPLRIDDIAEFLNRWGNE
K8VY27_9ENTR/1-81                 MNNEISLKYYDIVDEYEAETQISVDESERTPLAHYFQLLLTRLMNNEEISEEAQTEMAKEAKIDEKHIDEIATFLNQWGNE
A0A089UK85_9ENTR/1-81             MNNEIDLKYYDIADEYSTEAAKPVAEDERDAVAHYFQLLITRLMNNEEISEEAQGEMAVEAGLAEQRIDEIAEFLNQWGNE
Q32FZ4_SHIDS/1-81                 MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
YMJA_ECOLI/1-81                   MNHDIPLKYFDIADEYATECAEPVAEAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
A0A0A1B3D4_9ENTR/1-81             MNNEVPLKYYDIVDEYSTESAKAVGESEREPLARYFQLLITRLMNNEEIGEDAQQEMASEAGIDARRIDEIAEFLNQWGNE
A0A0A0Z893_9ENTR/1-81             MKHEIDLKYYDIADAYAEECEKPVSEAERDPLAHYFQLLITRLNNHQEISEEAQHEMAREAGIADARIDDVANFLNEWGNE
E1SBB5_PANVC/1-81                 MNNEISLKYYDVADEYATEAAKSVSEAERTPLAHYFQLLITRLMNNEEISEESQQDMAREAGIDEQRIDDIAEFLNRWGNE
J7UBN3_MORMO/1-81                 MENIVPDKYYDIADEYALESEEPVEEQEYDGLAHYFQLLITCLTNNEEISEEAQKKMAAEAGINKQRIDDIAEFLNRWGND
E6WK46_PANSA/1-81                 MNNDVPLKFYDIVDEYEAEAAKPVSESERDALARYFQLLITRLMNNEEISEQAQQEMASEAGIEALRIDEIATFLNQWGNE
E2XGW5_SHIDY/1-81                 MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGINPVRIDEIAEFLNQWGNE
D8MTS1_ERWBE/1-81                 MNNEIALKYYDIADDYVAESAKPVSEPQRDALAHYFQLLLTRLSDNQEISEDTQNEMAREAGIDEQQIDGIANYLNEWGNE
A0A097R309_HAFAL/1-81             MNHDVSLKYYDILDEYSTESAKPVGESERDSLAHYFQLLITRLMNNEEVSEDTQKEMADEAGIDEQRIDDIAEFLNRWGNE
Q6D6U9_PECAS/1-81                 MNNEVSLKYYDIVDEYSTESAEPVSESERESLARYFQLLITRLTNNEEISENAQKEMASEAGIDERRIDEIATFLNQWGNE
A4WC01_ENT38/1-81                 MTNEIPLKYFDIADEYSKETATPVSESEREPLAHYFQMLITRLMNNEEISESAQQEMANEAGIKNERIDEIATFLNQWGNE
A7MRM7_CROS8/1-81                 MSNDIPIKFYDIADEYATETELPVSDAERDRLAHYFQLLITRLMNNEEISEEAQHEMAREAGIPEGRIDEIANFLNQWGNE
A6T9K3_KLEP7/1-81                 MSNDIPLKFYDIVDEYETEAAAPVKDEERDALARYFQLLIARLTNNEEIDEEAQREMAREAAINENRIDDIANFLNQWGNE
#=GC seq_cons                     MNN-IsLKYYDIsDEYuTEsAcPVuEuER-sLAHYFQLLITRLMNNEEISEEAQpEMAsEAGIsppRID-IApFLNQWGNE
//
DBGET integrated database retrieval system