GenomeNet

Database: Pfam
Entry: DUF2551
LinkDB: DUF2551
Original site: DUF2551 
#=GF ID   DUF2551
#=GF AC   PF10826.5
#=GF DE   Protein of unknown function (DUF2551) 
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   23.10 23.10;
#=GF TC   68.30 68.20;
#=GF NC   22.60 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020501;
#=GF CC   This Archaeal family of proteins has no known function.
#=GF SQ   43
#=GS Q0W312_METAR/12-95      AC Q0W312.1
#=GS Q12ZR1_METBU/15-96      AC Q12ZR1.1
#=GS Y1218_ARCFU/9-89        AC O29050.1
#=GS D5EC40_METMS/13-94      AC D5EC40.1
#=GS Q2FUK9_METHJ/14-96      AC Q2FUK9.1
#=GS A2SPP7_METLZ/15-97      AC A2SPP7.1
#=GS D7E8Q1_METEZ/15-96      AC D7E8Q1.1
#=GS J0S9E4_9EURY/15-97      AC J0S9E4.1
#=GS A3CW31_METMJ/15-97      AC A3CW31.1
#=GS F4C0L5_METCG/12-93      AC F4C0L5.1
#=GS D7E633_METEZ/12-94      AC D7E633.1
#=GS D3S060_FERPA/9-89       AC D3S060.1
#=GS Q8TNA4_METAC/22-104     AC Q8TNA4.1
#=GS D5EBG2_METMS/12-94      AC D5EBG2.1
#=GS A7I9A0_METB6/15-96      AC A7I9A0.1
#=GS Q469S5_METBF/12-94      AC Q469S5.1
#=GS Q0W0E8_METAR/6-87       AC Q0W0E8.1
#=GS Q8PZ77_METMA/1-82       AC Q8PZ77.1
#=GS B8GGW4_METPE/15-97      AC B8GGW4.1
#=GS E1RHR3_METP4/15-97      AC E1RHR3.1
#=GS F7XMM5_METZD/13-94      AC F7XMM5.1
#=GS L0KZI5_METHD/12-94      AC L0KZI5.1
#=GS D7E910_METEZ/12-94      AC D7E910.1
#=GS K4MCZ3_9EURY/19-100     AC K4MCZ3.1
#=GS Q8PSX3_METMA/12-94      AC Q8PSX3.1
#=GS Q8TJQ8_METAC/1-82       AC Q8TJQ8.1
#=GS D1YWB1_METPS/12-95      AC D1YWB1.1
#=GS N0BC27_9EURY/31-111     AC N0BC27.1
#=GS A0A0A7GBC2_9EURY/10-90  AC A0A0A7GBC2.1
#=GS K4MJB7_9EURY/1-53       AC K4MJB7.1
#=GS D2RGY3_ARCPA/9-89       AC D2RGY3.1
#=GS L0L181_METHD/15-96      AC L0L181.1
#=GS F7XLC7_METZD/12-94      AC F7XLC7.1
#=GS D1YZL8_METPS/6-87       AC D1YZL8.1
#=GS A0B546_METTP/12-93      AC A0B546.1
#=GS G7WM51_METH6/12-94      AC G7WM51.1
#=GS L0HH18_METFS/15-96      AC L0HH18.1
#=GS F4BU21_METCG/12-94      AC F4BU21.1
#=GS Q46FU4_METBF/1-82       AC Q46FU4.1
#=GS G7WQR4_METH6/16-97      AC G7WQR4.1
#=GS Q12YF4_METBU/12-94      AC Q12YF4.1
#=GS F2KN66_ARCVS/10-88      AC F2KN66.1
#=GS H1YXW4_9EURY/15-97      AC H1YXW4.1
Q0W312_METAR/12-95                 .LDEYLKSDVSGIRRTVLHAFVKLKKLTADTLHRILIERnFAITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYAGIV.
Q12ZR1_METBU/15-96                 .LIKYLGRDDTGIREVVLKMFLDGGTFTTSDVYKHLHEKeFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNLYLLKEDYKPVV.
Y1218_ARCFU/9-89                   .LRKYLERDKNGLRRELLRVLLEGKKFTTSEIHDILSRRgYSISPRGVSAMVGLISARLGILKT---ELGEKNRYYLKSEYADLV.
D5EC40_METMS/13-94                 .LIKYLGRDDTGIRKVVLKLFLDGGKYTTNDIYKFLHEKdFDISYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKNDYRDIV.
Q2FUK9_METHJ/14-96                 .LKAWLSGDPNGVRRAALSLFLQYGDLTIEDVYERLAPV.YPVSYHGVGGMIGLISSRIGILQGIRDDKRRCRSYRLREKDRAS-v
A2SPP7_METLZ/15-97                 .LRSYLSRDKSGIRKALLRLLIRAKSMTVPQIHEALSTK.FDVTYHSVASMVGIVASKLGILSTHKMKDGALGVYELKAQYADLV.
D7E8Q1_METEZ/15-96                 .LTKYLSRDSTGIRKAVLKLFLEDDAYTTSDVYEYLRNHnFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNVYMLKEDYRQIV.
J0S9E4_9EURY/15-97                 .LKKYLSRDSTGIRHEVLAFFVRIKSATIPELYTRLSET.FAISYHSVASMVGIIASRMGILHVKRDMDGANAVYQIKEDYVCMV.
A3CW31_METMJ/15-97                 .LKGYLSRDRDGIRHELLNLFVKVKSFTIPQIYEKLQKQ.FSISYHSIASMVGIIASRIGILHVRRNAEGTNSIYELKDQYVDVV.
F4C0L5_METCG/12-93                 .LRNYLKRDGVGIRKAVLKLFLSDGAYTTEDVFTYLAKEgFDVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKGDHKGVV.
D7E633_METEZ/12-94                 .LQKFIEKDEDGVRSNILCVFLNKNKLTIDDLYSIITTK.YNISRNSVASMVGYIQSKLGIIQSYKKDYKSPTVYYLKDKYAFII.
D3S060_FERPA/9-89                  .LRKYLERDRSGIRRALLKIVLSGEKLTTEEIQKRLAEMgYNLNIRGVSAMVGLMSARLGILKL---EIGEKNKYYLKKEYESVV.
Q8TNA4_METAC/22-104                .LEKFLEVDSNGYRRAILCIFIKVKKTTIDELHEMLSSR.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDLI.
D5EBG2_METMS/12-94                 .LKKFVELDVSGLRTHILSILLNVKQFTVDDLHEKINKQ.FDVSRSVVASMVGYIHSKLGILRSHKESYKTPTTYSLKEEYVDLI.
A7I9A0_METB6/15-96                 .LKSYLHRDKTGIRREVLRLFLRFRQTTIADILEDLKGQ.FSVSFHTIASMVGIIASRIGILKVSRNSGGVTT-YELREKYAAMV.
Q469S5_METBF/12-94                 .LEKFLEVDSSGYRRAILCIFIKVKKATIDELHEMLTSK.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDL-l
Q0W0E8_METAR/6-87                  .IKDYLSRDKDGRRRAVLEMFLENGPYETKDIDDRLREKnFDVKNKGTPAMVGLMGSKTGILSV--DVTGDHNVYSIKEKYKHLV.
Q8PZ77_METMA/1-82                  m-IKYLGRDENGIRKVVLNLFLTGDKFTTGEVYDYLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKETYKNIV.
B8GGW4_METPE/15-97                 .LRGYLSRDHTGIRRELLNLFVRIKSLTVPLIFEEMQQH.YAITYHSIASMVGTIASRIGILHVRKPIEGNNCVYELKEKYLDLV.
E1RHR3_METP4/15-97                 .LRNYLSRDKNGIRRELLKIFVRAKSLTVAETHKKLMEK.FSVTVQSVASMVGTIASRIGIFHIIKEKDNDQTRYELKEQYADLV.
F7XMM5_METZD/13-94                 .LIKYLGRDDTGIRKEVLKLFLEGGSFTTNDVYEQLQKRgYNVSYRGVSAMVGLMNTRLGILSI--NVTGDHNIYSLKEDYREIV.
L0KZI5_METHD/12-94                 .LQTFIELDVNGLRTHILSVFLQVQKTTVDELHQSINSK.FEISRSAVASMVGYIYSKLGILRSYKESYKTPIVYSLKEEYADL-l
D7E910_METEZ/12-94                 .LQKFVELDTSGLRSSVLSFFLKEKNVTVDDLYEAIKTK.FNISRSSVASMVGYIHSKLGILRAYKESYKTHMVYTLKDEYVDLI.
K4MCZ3_9EURY/19-100                .LIKYLSRDDTGIRKVVLKLFLSGGKFTTGDVYEHLNNAdFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKEDYKNIV.
Q8PSX3_METMA/12-94                 .LEKFLEVDSNGYRRAILCIFIKVKKATIDELHEMLSSK.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDLI.
Q8TJQ8_METAC/1-82                  m-IKYLGRDDNGIRKVVLNLFLTGDKFTTGEVYDFLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKESYKNIV.
D1YWB1_METPS/12-95                 .LHDYLATDVQGIRRIVLQAFVKMKSLTADTLHRILMERgFSITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYEGIV.
N0BC27_9EURY/31-111                .LRKYLDRDKKKVRSALLRILLSGKKYTTDEIYEELKASgVDIKMRGVSAMVGLISARLGIVKM---ELGNKNRYYLKKEYYDLV.
A0A0A7GBC2_9EURY/10-90             .LRKYLERDRTGVRKSLIKLLIGGRKYTTGEIHEMLKNQgFELNPRGVSAMVGLMSARLGILKV---EMGEKNRYCLKSEYLDLV.
K4MJB7_9EURY/1-53                  m-------------------------------HAAITEK.YAVSRSAVASMVGYIYSKIGILRSHKESYKTPIIYSLKEEYVDLI.
D2RGY3_ARCPA/9-89                  .LVNYLKRDKKGIRREVLSIMIDGRKYTTSEIYEILKAKgYDVNLRGVSAMLGLMNTRLGIVRT---ETGEKNRYYIKPEYIELV.
L0L181_METHD/15-96                 .LIKYLSRDDTGIRKVVLQLFLEGDKFTTGDVYGYLNKTdFNVSYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKEDYRDVV.
F7XLC7_METZD/12-94                 .LQKFIELDVSGLRSYILSIFLNNKKVTVDDLHQAITKK.YDTSRSAVASMVGYIHSKLGILSAHKESYKTPIVYTLKEDYIDLI.
D1YZL8_METPS/6-87                  .IKDYLSRDKDGRRRAVLRIFLDGGPYETKDIDEKLREQnFDVKNKGTPAMVGLMGSKTGILSV--DVTGDHNMYSIKEKYKRLV.
A0B546_METTP/12-93                 .LRNYLKRDGIGIRKAVLKLFLSDSSFTTEDIFTHLEKEgFNVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKNDHKMIV.
G7WM51_METH6/12-94                 .LVQFLDLDTDGRRRFVLGVILEAGEITVSSLYKAVKEQ.FETSRKVVASLLGYICSKLGILSAHKKSYRLPTVYVLKEEYADLV.
L0HH18_METFS/15-96                 .LRSYLSRDRTGIRREVLRLFVKSKAITIAELVAILQKQ.FTVTFHAIASMVGIIASRIGILRATRNSDGVNS-YELKEKYVDIV.
F4BU21_METCG/12-94                 m-MNFLDLDSDGLRRVVLESMVQSQEFTVLSLHEEVSKE.VNVSRKVVASMTGYIGSRLGILHMNKKSYRTPRTYALKDEYADI-a
Q46FU4_METBF/1-82                  .MVKYLGRDENGIRKVVLNLFLTGDKFTTGEVYDYLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKESYKNIV.
G7WQR4_METH6/16-97                 .LKNYLKRDGMGIRKAVLKLFLHDRSFTTEEVYTYLDQEgFEVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKPDHKVIV.
Q12YF4_METBU/12-94                 .LNKFIELDVNGFRSYVLSVFLSVKKSTIDELHQAIAKK.YDVSRSAVASMVGYIHSKLGILRSHKESYKTPIVYSLKEEYADL-l
F2KN66_ARCVS/10-88                 .LRKYLERDRSGIRKELLRILLEGGKYTTDEIFERLSTR.-AINQRGVSAMVGLMCARLGIIKT---ELGEKNRYYIKPEYADLV.
H1YXW4_9EURY/15-97                 .LKNYLSRDKDGIRRELLNIFVKVKSVTVEDTHNKLKER.FAISYQSVASMIGIIASKMGILHIIKARDNDQTQYVLKDQYADLV.
#=GC seq_cons                      .LpcYLpRDpsGlR+tlLplFLcscphTss-lachLpcc.FsVSh+uVuuMVGlhsoRLGILps..pshGspslYpLKE-YtclV.
//
DBGET integrated database retrieval system