GenomeNet

Database: Pfam
Entry: DUF2551
LinkDB: DUF2551
Original site: DUF2551 
#=GF ID   DUF2551
#=GF AC   PF10826.4
#=GF DE   Protein of unknown function (DUF2551) 
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   23.10 23.10;
#=GF TC   25.10 68.20;
#=GF NC   22.60 23.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020501;
#=GF CC   This Archaeal family of proteins has no known function.
#=GF SQ   49
#=GS Q0W312_UNCMA/12-95   AC Q0W312.1
#=GS Q12ZR1_METBU/15-96   AC Q12ZR1.1
#=GS Y1218_ARCFU/9-89     AC O29050.1
#=GS D5EC40_METMS/13-94   AC D5EC40.1
#=GS Q2FUK9_METHJ/14-96   AC Q2FUK9.1
#=GS I7J9W8_METBM/15-97   AC I7J9W8.1
#=GS H8I8R9_METCZ/12-95   AC H8I8R9.1
#=GS A2SPP7_METLZ/15-97   AC A2SPP7.1
#=GS D7E8Q1_METEZ/15-96   AC D7E8Q1.1
#=GS J0S9E4_9EURY/15-97   AC J0S9E4.1
#=GS A3CW31_METMJ/15-97   AC A3CW31.1
#=GS M1QGC3_METMZ/1-82    AC M1QGC3.1
#=GS F4C0L5_METCG/12-93   AC F4C0L5.1
#=GS D7E633_METEZ/12-94   AC D7E633.1
#=GS D3S060_FERPA/9-89    AC D3S060.1
#=GS Q8TNA4_METAC/22-104  AC Q8TNA4.1
#=GS D5EBG2_METMS/12-94   AC D5EBG2.1
#=GS A7I9A0_METB6/15-96   AC A7I9A0.1
#=GS W9DZ90_METTI/19-100  AC W9DZ90.1
#=GS Q469S5_METBF/12-94   AC Q469S5.1
#=GS Q0W0E8_UNCMA/6-87    AC Q0W0E8.1
#=GS Q8PZ77_METMA/1-82    AC Q8PZ77.1
#=GS B8GGW4_METPE/15-97   AC B8GGW4.1
#=GS E1RHR3_METP4/15-97   AC E1RHR3.1
#=GS F7XMM5_METZD/13-94   AC F7XMM5.1
#=GS L0KZI5_METHD/12-94   AC L0KZI5.1
#=GS D7E910_METEZ/12-94   AC D7E910.1
#=GS M1QDG5_METMZ/12-94   AC M1QDG5.1
#=GS K4MCZ3_9EURY/19-100  AC K4MCZ3.1
#=GS Q8PSX3_METMA/12-94   AC Q8PSX3.1
#=GS Q8TJQ8_METAC/1-82    AC Q8TJQ8.1
#=GS W9E1I1_METTI/12-94   AC W9E1I1.1
#=GS D1YWB1_METPS/12-95   AC D1YWB1.1
#=GS N0BC27_9EURY/31-111  AC N0BC27.1
#=GS K4MJB7_9EURY/1-53    AC K4MJB7.1
#=GS D2RGY3_ARCPA/9-89    AC D2RGY3.1
#=GS L0L181_METHD/15-96   AC L0L181.1
#=GS F7XLC7_METZD/12-94   AC F7XLC7.1
#=GS D1YZL8_METPS/6-87    AC D1YZL8.1
#=GS A0B546_METTP/12-93   AC A0B546.1
#=GS G7WM51_METH6/12-94   AC G7WM51.1
#=GS H8I9L6_METCZ/18-99   AC H8I9L6.1
#=GS L0HH18_METFS/15-96   AC L0HH18.1
#=GS F4BU21_METCG/12-94   AC F4BU21.1
#=GS Q46FU4_METBF/1-82    AC Q46FU4.1
#=GS G7WQR4_METH6/16-97   AC G7WQR4.1
#=GS F2KN66_ARCVS/10-88   AC F2KN66.1
#=GS Q12YF4_METBU/12-94   AC Q12YF4.1
#=GS H1YXW4_9EURY/15-97   AC H1YXW4.1
Q0W312_UNCMA/12-95              .LDEYLKSDVSGIRRTVLHAFVKLKKLTADTLHRILIERnFAITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYAGIV.
Q12ZR1_METBU/15-96              .LIKYLGRDDTGIREVVLKMFLDGGTFTTSDVYKHLHEKeFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNLYLLKEDYKPVV.
Y1218_ARCFU/9-89                .LRKYLERDKNGLRRELLRVLLEGKKFTTSEIHDILSRRgYSISPRGVSAMVGLISARLGILKT---ELGEKNRYYLKSEYADLV.
D5EC40_METMS/13-94              .LIKYLGRDDTGIRKVVLKLFLDGGKYTTNDIYKFLHEKdFDISYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKNDYRDIV.
Q2FUK9_METHJ/14-96              .LKAWLSGDPNGVRRAALSLFLQYGDLTIEDVYERLAPV.YPVSYHGVGGMIGLISSRIGILQGIRDDKRRCRSYRLREKDRAS-v
I7J9W8_METBM/15-97              .LEGYLSRDRDGIRHELLSLFVKIRSLTIPQIYEKLQEQ.FSISYHSVASMVGIIASRIGILHVRRNAEGTNTIYELKDQYVDVV.
H8I8R9_METCZ/12-95              .LYEYLATDVHGIRRVVLQAFVKMKSLTADTLHRMLRERgFCITLKQVTAMLGVIHSKLGILHAHKNSYDSRYEYSLKEKYEGIV.
A2SPP7_METLZ/15-97              .LRSYLSRDKSGIRKALLRLLIRAKSMTVPQIHEALSTK.FDVTYHSVASMVGIVASKLGILSTHKMKDGALGVYELKAQYADLV.
D7E8Q1_METEZ/15-96              .LTKYLSRDSTGIRKAVLKLFLEDDAYTTSDVYEYLRNHnFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNVYMLKEDYRQIV.
J0S9E4_9EURY/15-97              .LKKYLSRDSTGIRHEVLAFFVRIKSATIPELYTRLSET.FAISYHSVASMVGIIASRMGILHVKRDMDGANAVYQIKEDYVCMV.
A3CW31_METMJ/15-97              .LKGYLSRDRDGIRHELLNLFVKVKSFTIPQIYEKLQKQ.FSISYHSIASMVGIIASRIGILHVRRNAEGTNSIYELKDQYVDVV.
M1QGC3_METMZ/1-82               m-IKYLGRDENGIRKVVLNLFLTGDKFTTGEVYDYLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKETYKNIV.
F4C0L5_METCG/12-93              .LRNYLKRDGVGIRKAVLKLFLSDGAYTTEDVFTYLAKEgFDVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKGDHKGVV.
D7E633_METEZ/12-94              .LQKFIEKDEDGVRSNILCVFLNKNKLTIDDLYSIITTK.YNISRNSVASMVGYIQSKLGIIQSYKKDYKSPTVYYLKDKYAFII.
D3S060_FERPA/9-89               .LRKYLERDRSGIRRALLKIVLSGEKLTTEEIQKRLAEMgYNLNIRGVSAMVGLMSARLGILKL---EIGEKNKYYLKKEYESVV.
Q8TNA4_METAC/22-104             .LEKFLEVDSNGYRRAILCIFIKVKKTTIDELHEMLSSR.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDLI.
D5EBG2_METMS/12-94              .LKKFVELDVSGLRTHILSILLNVKQFTVDDLHEKINKQ.FDVSRSVVASMVGYIHSKLGILRSHKESYKTPTTYSLKEEYVDLI.
A7I9A0_METB6/15-96              .LKSYLHRDKTGIRREVLRLFLRFRQTTIADILEDLKGQ.FSVSFHTIASMVGIIASRIGILKVSRNSGGVTT-YELREKYAAMV.
W9DZ90_METTI/19-100             .LIKYLSRDDTGIRKVVLKLFLNGDKFTTGDVYEHLHDTdFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKEDYRDIV.
Q469S5_METBF/12-94              .LEKFLEVDSSGYRRAILCIFIKVKKATIDELHEMLTSK.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDL-l
Q0W0E8_UNCMA/6-87               .IKDYLSRDKDGRRRAVLEMFLENGPYETKDIDDRLREKnFDVKNKGTPAMVGLMGSKTGILSV--DVTGDHNVYSIKEKYKHLV.
Q8PZ77_METMA/1-82               m-IKYLGRDENGIRKVVLNLFLTGDKFTTGEVYDYLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKETYKNIV.
B8GGW4_METPE/15-97              .LRGYLSRDHTGIRRELLNLFVRIKSLTVPLIFEEMQQH.YAITYHSIASMVGTIASRIGILHVRKPIEGNNCVYELKEKYLDLV.
E1RHR3_METP4/15-97              .LRNYLSRDKNGIRRELLKIFVRAKSLTVAETHKKLMEK.FSVTVQSVASMVGTIASRIGIFHIIKEKDNDQTRYELKEQYADLV.
F7XMM5_METZD/13-94              .LIKYLGRDDTGIRKEVLKLFLEGGSFTTNDVYEQLQKRgYNVSYRGVSAMVGLMNTRLGILSI--NVTGDHNIYSLKEDYREIV.
L0KZI5_METHD/12-94              .LQTFIELDVNGLRTHILSVFLQVQKTTVDELHQSINSK.FEISRSAVASMVGYIYSKLGILRSYKESYKTPIVYSLKEEYADL-l
D7E910_METEZ/12-94              .LQKFVELDTSGLRSSVLSFFLKEKNVTVDDLYEAIKTK.FNISRSSVASMVGYIHSKLGILRAYKESYKTHMVYTLKDEYVDLI.
M1QDG5_METMZ/12-94              .LEKFLEVDSNGYRRAILCIFIKVKKATIDELHEMLSSK.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDLI.
K4MCZ3_9EURY/19-100             .LIKYLSRDDTGIRKVVLKLFLSGGKFTTGDVYEHLNNAdFDVSYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKEDYKNIV.
Q8PSX3_METMA/12-94              .LEKFLEVDSNGYRRAILCIFIKVKKATIDELHEMLSSK.YNVSRNTVASMVGYIHSKLGILRAHKESYKTPMVYLLREEYIDLI.
Q8TJQ8_METAC/1-82               m-IKYLGRDDNGIRKVVLNLFLTGDKFTTGEVYDFLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKESYKNIV.
W9E1I1_METTI/12-94              .LQKFIELDVNGLRSHILSIFLSVKETTVDELHANITEK.YDISRSAVASMVGYIYSKLGVLRSHKESYKTPIVYSLKEEYEDMI.
D1YWB1_METPS/12-95              .LHDYLATDVQGIRRIVLQAFVKMKSLTADTLHRILMERgFSITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYEGIV.
N0BC27_9EURY/31-111             .LRKYLDRDKKKVRSALLRILLSGKKYTTDEIYEELKASgVDIKMRGVSAMVGLISARLGIVKM---ELGNKNRYYLKKEYYDLV.
K4MJB7_9EURY/1-53               m-------------------------------HAAITEK.YAVSRSAVASMVGYIYSKIGILRSHKESYKTPIIYSLKEEYVDLI.
D2RGY3_ARCPA/9-89               .LVNYLKRDKKGIRREVLSIMIDGRKYTTSEIYEILKAKgYDVNLRGVSAMLGLMNTRLGIVRT---ETGEKNRYYIKPEYIELV.
L0L181_METHD/15-96              .LIKYLSRDDTGIRKVVLQLFLEGDKFTTGDVYGYLNKTdFNVSYRGVSAMVGLMNTRLGILSI--DVTGDHNIYLLKEDYRDVV.
F7XLC7_METZD/12-94              .LQKFIELDVSGLRSYILSIFLNNKKVTVDDLHQAITKK.YDTSRSAVASMVGYIHSKLGILSAHKESYKTPIVYTLKEDYIDLI.
D1YZL8_METPS/6-87               .IKDYLSRDKDGRRRAVLRIFLDGGPYETKDIDEKLREQnFDVKNKGTPAMVGLMGSKTGILSV--DVTGDHNMYSIKEKYKRLV.
A0B546_METTP/12-93              .LRNYLKRDGIGIRKAVLKLFLSDSSFTTEDIFTHLEKEgFNVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKNDHKMIV.
G7WM51_METH6/12-94              .LVQFLDLDTDGRRRFVLGVILEAGEITVSSLYKAVKEQ.FETSRKVVASLLGYICSKLGILSAHKKSYRLPTVYVLKEEYADLV.
H8I9L6_METCZ/18-99              .IKDYLSRDKDGRRRAVLKIFLEGGPYETKDIDDKLREQhFDVKNKGTPAMVGLMGSKTGILSV--DVTGDHNMYSIKEKYKRLV.
L0HH18_METFS/15-96              .LRSYLSRDRTGIRREVLRLFVKSKAITIAELVAILQKQ.FTVTFHAIASMVGIIASRIGILRATRNSDGVNS-YELKEKYVDIV.
F4BU21_METCG/12-94              m-MNFLDLDSDGLRRVVLESMVQSQEFTVLSLHEEVSKE.VNVSRKVVASMTGYIGSRLGILHMNKKSYRTPRTYALKDEYADI-a
Q46FU4_METBF/1-82               .MVKYLGRDENGIRKVVLNLFLTGDKFTTGEVYDYLDKGnFEVSYRGVSAMVGLMNTRLGILSI--NVTGDHNVYSLKESYKNIV.
G7WQR4_METH6/16-97              .LKNYLKRDGMGIRKAVLKLFLHDRSFTTEEVYTYLDQEgFEVSYRGVSAMVGLMNTRLGILSI--DVSGDHNVYSLKPDHKVIV.
F2KN66_ARCVS/10-88              .LRKYLERDRSGIRKELLRILLEGGKYTTDEIFERLSTR.-AINQRGVSAMVGLMCARLGIIKT---ELGEKNRYYIKPEYADLV.
Q12YF4_METBU/12-94              .LNKFIELDVNGFRSYVLSVFLSVKKSTIDELHQAIAKK.YDVSRSAVASMVGYIHSKLGILRSHKESYKTPIVYSLKEEYADL-l
H1YXW4_9EURY/15-97              .LKNYLSRDKDGIRRELLNIFVKVKSVTVEDTHNKLKER.FAISYQSVASMIGIIASKMGILHIIKARDNDQTQYVLKDQYADLV.
#=GC seq_cons                   .LpcYLpRDpsGlR+tlLplFLcscphTss-lachLpcc.FsVSh+uVuuMVGlhsS+LGILps..pshsspslYpLKEcYtclV.
//
DBGET integrated database retrieval system