GenomeNet

Database: Pfam
Entry: DUF2552
LinkDB: DUF2552
Original site: DUF2552 
#=GF ID   DUF2552
#=GF AC   PF10827.5
#=GF DE   Protein of unknown function (DUF2552) 
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   21.70 21.70;
#=GF TC   22.80 149.30;
#=GF NC   21.50 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020157;
#=GF CC   This bacterial family of proteins has no known function.
#=GF SQ   10
#=GS Q812U5_BACCR/1-79  AC Q812U5.1
#=GS Q5KXH6_GEOKA/1-79  AC Q5KXH6.1
#=GS Q81MC0_BACAN/1-79  AC Q81MC0.1
#=GS Q65HR9_BACLD/1-79  AC Q65HR9.1
#=GS C2X2B1_BACCE/1-79  AC C2X2B1.1
#=GS C5D419_GEOSW/1-79  AC C5D419.1
#=GS YQKC_BACSU/1-79    AC P54566.1
#=GS B7GKF0_ANOFW/4-82  AC B7GKF0.1
#=GS A7GSD1_BACCN/1-79  AC A7GSD1.1
#=GS A8FEU9_BACP2/1-79  AC A8FEU9.1
Q812U5_BACCR/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q5KXH6_GEOKA/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
Q81MC0_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q65HR9_BACLD/1-79             .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
C2X2B1_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C5D419_GEOSW/1-79             .MKDKLKQIANVAKQKTWVSFLHENDPYSLLHWSIAGVYHEPKDVWLLQNEMTFETKEFATLDEAIAWMDEHMPNITEIL
YQKC_BACSU/1-79               .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
B7GKF0_ANOFW/4-82             v-NDQVNRLRKIAKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
A7GSD1_BACCN/1-79             .MNKQLRTLQNVANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFATLDEAMKWISENMEQITDVL
A8FEU9_BACP2/1-79             .MDQKLKVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL
#=GC seq_cons                 .MccpL+sL+NlAppKTWsSFLN-NHPYSLLHWSIAGsspEsKDVWLLQDEhTFETpEFsTLD-AlpWIuENM-pITDVL
//
DBGET integrated database retrieval system