GenomeNet

Database: Pfam
Entry: DUF2552
LinkDB: DUF2552
Original site: DUF2552 
#=GF ID   DUF2552
#=GF AC   PF10827.3
#=GF DE   Protein of unknown function (DUF2552) 
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   21.70 21.70;
#=GF TC   21.80 117.40;
#=GF NC   20.80 19.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020157;
#=GF CC   This bacterial family of proteins has no known function.
#=GF SQ   119
#=GS C2PJS5_BACCE/1-79  AC C2PJS5.1
#=GS H8XCG5_BACAM/1-79  AC H8XCG5.1
#=GS C2SPQ8_BACCE/1-79  AC C2SPQ8.1
#=GS C2P3A5_BACCE/1-79  AC C2P3A5.1
#=GS C3CNM3_BACTU/1-79  AC C3CNM3.1
#=GS C2V034_BACCE/1-79  AC C2V034.1
#=GS E0U2N6_BACPZ/1-79  AC E0U2N6.1
#=GS C3E849_BACTU/1-79  AC C3E849.1
#=GS C2ZCF2_BACCE/1-79  AC C2ZCF2.1
#=GS C5D419_GEOSW/1-79  AC C5D419.1
#=GS C3BPL4_9BACI/1-79  AC C3BPL4.1
#=GS C3D6L8_BACTU/1-79  AC C3D6L8.1
#=GS C2VGD7_BACCE/1-79  AC C2VGD7.1
#=GS F4EQP0_BACAM/1-79  AC F4EQP0.1
#=GS A4IQK0_GEOTN/1-79  AC A4IQK0.1
#=GS A7GSD1_BACCN/1-79  AC A7GSD1.1
#=GS D8H9M9_BACAI/1-79  AC D8H9M9.1
#=GS A8FEU9_BACP2/1-79  AC A8FEU9.1
#=GS B0ASQ0_BACAN/1-79  AC B0ASQ0.1
#=GS C2YW50_BACCE/1-79  AC C2YW50.1
#=GS D4FYE3_BACNA/1-79  AC D4FYE3.1
#=GS E5W0M1_9BACI/1-79  AC E5W0M1.1
#=GS G8N0N5_GEOTH/1-79  AC G8N0N5.1
#=GS C2MQ94_BACCE/1-79  AC C2MQ94.1
#=GS F4E803_BACAM/1-79  AC F4E803.1
#=GS Q731J0_BACC1/1-59  AC Q731J0.1
#=GS C2X2B1_BACCE/1-79  AC C2X2B1.1
#=GS A7Z6B3_BACA2/1-79  AC A7Z6B3.1
#=GS A9VG46_BACWK/1-79  AC A9VG46.1
#=GS B5V735_BACCE/1-79  AC B5V735.1
#=GS C9RZV3_GEOSY/1-79  AC C9RZV3.1
#=GS B7HNM4_BACC7/1-79  AC B7HNM4.1
#=GS C2RCP9_BACCE/1-79  AC C2RCP9.1
#=GS E8SYP3_GEOS2/1-79  AC E8SYP3.1
#=GS B0Q318_BACAN/1-79  AC B0Q318.1
#=GS C3EQ21_BACTK/1-79  AC C3EQ21.1
#=GS C1EQY1_BACC3/1-79  AC C1EQY1.1
#=GS Q81MC0_BACAN/1-79  AC Q81MC0.1
#=GS I0D7D4_BACAN/1-79  AC I0D7D4.1
#=GS E8VBQ8_BACST/1-79  AC E8VBQ8.1
#=GS C3DPP3_BACTS/1-79  AC C3DPP3.1
#=GS C3B7J9_BACMY/1-79  AC C3B7J9.1
#=GS C3H5V2_BACTU/1-79  AC C3H5V2.1
#=GS Q6HE58_BACHK/1-79  AC Q6HE58.1
#=GS C2NMG4_BACCE/1-79  AC C2NMG4.1
#=GS G8U3R8_BACCE/1-79  AC G8U3R8.1
#=GS B3Z6Z0_BACCE/1-79  AC B3Z6Z0.1
#=GS D5N6E7_BACPN/1-79  AC D5N6E7.1
#=GS C3GNQ4_BACTU/1-79  AC C3GNQ4.1
#=GS B7IWM1_BACC2/1-79  AC B7IWM1.1
#=GS C2XGB9_BACCE/1-79  AC C2XGB9.1
#=GS B3ZVI5_BACCE/1-79  AC B3ZVI5.1
#=GS B9IWX1_BACCQ/1-79  AC B9IWX1.1
#=GS C3F6D7_BACTU/1-79  AC C3F6D7.1
#=GS C3LIX3_BACAC/1-79  AC C3LIX3.1
#=GS C2S8J5_BACCE/1-79  AC C2S8J5.1
#=GS C2ZTY3_BACCE/1-79  AC C2ZTY3.1
#=GS C3AAF2_BACMY/1-79  AC C3AAF2.1
#=GS C3C7C7_BACTU/1-79  AC C3C7C7.1
#=GS C2YF06_BACCE/1-79  AC C2YF06.1
#=GS G0IL98_BACAM/1-79  AC G0IL98.1
#=GS C2RSR2_BACCE/1-79  AC C2RSR2.1
#=GS B5USQ7_BACCE/1-79  AC B5USQ7.1
#=GS Q635H4_BACCZ/1-79  AC Q635H4.1
#=GS C3FPZ9_BACTB/1-79  AC C3FPZ9.1
#=GS H2AKC3_BACAM/1-79  AC H2AKC3.1
#=GS B3YVW3_BACCE/1-79  AC B3YVW3.1
#=GS Q5KXH6_GEOKA/1-79  AC Q5KXH6.1
#=GS C3I5Q5_BACTU/1-79  AC C3I5Q5.1
#=GS E3DXC0_BACA1/1-79  AC E3DXC0.1
#=GS C2UIB8_BACCE/1-79  AC C2UIB8.1
#=GS C3HN34_BACTU/1-79  AC C3HN34.1
#=GS G4P7M9_BACIU/1-79  AC G4P7M9.1
#=GS B7JLW2_BACC0/1-79  AC B7JLW2.1
#=GS D7D471_GEOSC/1-79  AC D7D471.1
#=GS I0F609_9BACI/1-79  AC I0F609.1
#=GS B7H999_BACC4/1-79  AC B7H999.1
#=GS C3AQ67_BACMY/1-79  AC C3AQ67.1
#=GS B4BLB4_9BACI/1-79  AC B4BLB4.1
#=GS C2QGP4_BACCE/1-79  AC C2QGP4.1
#=GS C2VYP9_BACCE/1-79  AC C2VYP9.1
#=GS C2N5Y2_BACCE/1-79  AC C2N5Y2.1
#=GS B0QH20_BACAN/1-79  AC B0QH20.1
#=GS Q3ETS2_BACTI/1-79  AC Q3ETS2.1
#=GS Q65HR9_BACLD/1-79  AC Q65HR9.1
#=GS C2WBP4_BACCE/1-79  AC C2WBP4.1
#=GS YQKC_BACSU/1-79    AC P54566.1
#=GS E1UKB1_BACAS/1-79  AC E1UKB1.1
#=GS C2QXT4_BACCE/1-79  AC C2QXT4.1
#=GS C2Q0F9_BACCE/1-79  AC C2Q0F9.1
#=GS B7GKF0_ANOFW/4-82  AC B7GKF0.1
#=GS C2T5L3_BACCE/1-79  AC C2T5L3.1
#=GS C3P7P3_BACAA/1-79  AC C3P7P3.1
#=GS G9Q261_9BACI/1-79  AC G9Q261.1
#=GS Q812U5_BACCR/1-79  AC Q812U5.1
#=GS B1US25_BACAN/1-79  AC B1US25.1
#=GS C2XYS8_BACCE/1-79  AC C2XYS8.1
#=GS Q4MMV7_BACCE/1-79  AC Q4MMV7.1
#=GS B1GIQ5_BACAN/1-79  AC B1GIQ5.1
#=GS B1EWN0_BACAN/1-79  AC B1EWN0.1
#=GS E3III0_GEOS0/1-79  AC E3III0.1
#=GS I0UHP9_BACLI/1-79  AC I0UHP9.1
#=GS H0NTW4_BACCE/1-79  AC H0NTW4.1
#=GS I0UAN2_BACTR/1-79  AC I0UAN2.1
#=GS G4NX30_BACPN/1-79  AC G4NX30.1
#=GS F8CV81_BACTR/1-79  AC F8CV81.1
#=GS F0PU21_BACT0/1-79  AC F0PU21.1
#=GS C2U267_BACCE/1-79  AC C2U267.1
#=GS C2WSD2_BACCE/1-79  AC C2WSD2.1
#=GS G4EU65_BACIU/1-79  AC G4EU65.1
#=GS F2H4L3_BACTU/1-79  AC F2H4L3.1
#=GS H0FLH1_BACAM/1-79  AC H0FLH1.1
#=GS C2TL07_BACCE/1-79  AC C2TL07.1
#=GS B4ALC7_BACPU/1-79  AC B4ALC7.1
#=GS B3J300_BACAN/1-79  AC B3J300.1
#=GS C3G7S2_BACTU/1-79  AC C3G7S2.1
#=GS D5TWV2_BACT1/1-79  AC D5TWV2.1
#=GS C3INY3_BACTU/1-79  AC C3INY3.1
#=GS A0RIA9_BACAH/1-79  AC A0RIA9.1
C2PJS5_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISVNMEQVTDVL
H8XCG5_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
C2SPQ8_BACCE/1-79             .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C2P3A5_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3CNM3_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2V034_BACCE/1-79             .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
E0U2N6_BACPZ/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C3E849_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENLEQVTDVL
C2ZCF2_BACCE/1-79             .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
C5D419_GEOSW/1-79             .MKDKLKQIANVAKQKTWVSFLHENDPYSLLHWSIAGVYHEPKDVWLLQNEMTFETKEFATLDEAIAWMDEHMPNITEIL
C3BPL4_9BACI/1-79             .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
C3D6L8_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2VGD7_BACCE/1-79             .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
F4EQP0_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
A4IQK0_GEOTN/1-79             .MNGKLRQLAETAKQKTWVSFTHENDPYSLLHWSVAGPYHDKKDVWLLQNEMTFETKEFATLDDAIAWLGEHMPHITEVL
A7GSD1_BACCN/1-79             .MNKQLRTLQNVANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFATLDEAMKWISENMEQITDVL
D8H9M9_BACAI/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A8FEU9_BACP2/1-79             .MDQKLKVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL
B0ASQ0_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2YW50_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
D4FYE3_BACNA/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
E5W0M1_9BACI/1-79             .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
G8N0N5_GEOTH/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
C2MQ94_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
F4E803_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
Q731J0_BACC1/1-59             .--------------------MNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2X2B1_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
A7Z6B3_BACA2/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
A9VG46_BACWK/1-79             .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
B5V735_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C9RZV3_GEOSY/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
B7HNM4_BACC7/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2RCP9_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E8SYP3_GEOS2/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
B0Q318_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3EQ21_BACTK/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C1EQY1_BACC3/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q81MC0_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
I0D7D4_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E8VBQ8_BACST/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C3DPP3_BACTS/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3B7J9_BACMY/1-79             .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
C3H5V2_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q6HE58_BACHK/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2NMG4_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G8U3R8_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B3Z6Z0_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
D5N6E7_BACPN/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C3GNQ4_BACTU/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B7IWM1_BACC2/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2XGB9_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B3ZVI5_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B9IWX1_BACCQ/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C3F6D7_BACTU/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3LIX3_BACAC/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2S8J5_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2ZTY3_BACCE/1-79             .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
C3AAF2_BACMY/1-79             .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C3C7C7_BACTU/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2YF06_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G0IL98_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
C2RSR2_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B5USQ7_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q635H4_BACCZ/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3FPZ9_BACTB/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
H2AKC3_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
B3YVW3_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q5KXH6_GEOKA/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
C3I5Q5_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E3DXC0_BACA1/1-79             .MDQKLKSIKQTAQHKTWVSFLNKNHPYSLLHWSIGGAESIQKDVWLLQDEMTFDTQEFTTIDLAINWIGENMDGITDVL
C2UIB8_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3HN34_BACTU/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G4P7M9_BACIU/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
B7JLW2_BACC0/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
D7D471_GEOSC/1-79             .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
I0F609_9BACI/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIREHMDDITDVL
B7H999_BACC4/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3AQ67_BACMY/1-79             .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
B4BLB4_9BACI/1-79             .MNGKLRQLAETAKQKTWVSFTHENDPYSLLHWSVAGPYHDKKDVWLLQNEMTFETKEFATLDDAIAWLGEHMPHITEVL
C2QGP4_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMDQVTDVL
C2VYP9_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2N5Y2_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B0QH20_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q3ETS2_BACTI/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q65HR9_BACLD/1-79             .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
C2WBP4_BACCE/1-79             .MNKQLRTLQSVANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
YQKC_BACSU/1-79               .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
E1UKB1_BACAS/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
C2QXT4_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2Q0F9_BACCE/1-79             .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
B7GKF0_ANOFW/4-82             v-NDQVNRLRKIAKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
C2T5L3_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3P7P3_BACAA/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G9Q261_9BACI/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q812U5_BACCR/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B1US25_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2XYS8_BACCE/1-79             .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
Q4MMV7_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B1GIQ5_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B1EWN0_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E3III0_GEOS0/1-79             .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
I0UHP9_BACLI/1-79             .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
H0NTW4_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
I0UAN2_BACTR/1-79             .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
G4NX30_BACPN/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
F8CV81_BACTR/1-79             .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
F0PU21_BACT0/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2U267_BACCE/1-79             .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C2WSD2_BACCE/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G4EU65_BACIU/1-79             .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
F2H4L3_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
H0FLH1_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
C2TL07_BACCE/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B4ALC7_BACPU/1-79             .MDQKLRVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL
B3J300_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3G7S2_BACTU/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
D5TWV2_BACT1/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3INY3_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0RIA9_BACAH/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
#=GC seq_cons                 .MDKQL+TLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEuKDVWLLQDEVTFQTTEFPTLD-AhpWISENMEQVTDVL
//
DBGET integrated database retrieval system