GenomeNet

Database: Pfam
Entry: DUF2552
LinkDB: DUF2552
Original site: DUF2552 
#=GF ID   DUF2552
#=GF AC   PF10827.4
#=GF DE   Protein of unknown function (DUF2552) 
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   21.70 21.70;
#=GF TC   22.80 114.20;
#=GF NC   21.50 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020157;
#=GF CC   This bacterial family of proteins has no known function.
#=GF SQ   297
#=GS C2PJS5_BACCE/1-79      AC C2PJS5.1
#=GS A0A011WG34_BACTI/1-79  AC A0A011WG34.1
#=GS J8IWM5_BACCE/1-79      AC J8IWM5.1
#=GS W0CGF3_BACAN/1-79      AC W0CGF3.1
#=GS J8EIL3_BACCE/1-79      AC J8EIL3.1
#=GS A0A059NMD8_9BACI/1-79  AC A0A059NMD8.1
#=GS C2P3A5_BACCE/1-79      AC C2P3A5.1
#=GS C3CNM3_BACTU/1-79      AC C3CNM3.1
#=GS C3BPL4_9BACI/1-79      AC C3BPL4.1
#=GS C2VGD7_BACCE/1-79      AC C2VGD7.1
#=GS D8H9M9_BACAI/1-79      AC D8H9M9.1
#=GS A8FEU9_BACP2/1-79      AC A8FEU9.1
#=GS C2YW50_BACCE/1-79      AC C2YW50.1
#=GS W8QXI1_BACPU/1-79      AC W8QXI1.1
#=GS R8Q7T9_BACCE/1-79      AC R8Q7T9.1
#=GS J8SET4_BACCE/1-79      AC J8SET4.1
#=GS A7Z6B3_BACA2/1-79      AC A7Z6B3.1
#=GS B5V735_BACCE/1-79      AC B5V735.1
#=GS C9RZV3_GEOSY/1-79      AC C9RZV3.1
#=GS B7HNM4_BACC7/1-79      AC B7HNM4.1
#=GS L7ZTT2_9BACI/1-79      AC L7ZTT2.1
#=GS R8G2D8_BACCE/1-79      AC R8G2D8.1
#=GS J8KLW7_BACCE/1-79      AC J8KLW7.1
#=GS Q81MC0_BACAN/1-79      AC Q81MC0.1
#=GS M1PQ65_BACTU/1-79      AC M1PQ65.1
#=GS W4E0K2_9BACI/1-79      AC W4E0K2.1
#=GS M5R727_9BACI/1-79      AC M5R727.1
#=GS C3DPP3_BACTS/1-79      AC C3DPP3.1
#=GS R8LDB0_BACCE/1-79      AC R8LDB0.1
#=GS A0A016QGP0_BACAM/1-79  AC A0A016QGP0.1
#=GS B9IWX1_BACCQ/1-79      AC B9IWX1.1
#=GS C2ZTY3_BACCE/1-79      AC C2ZTY3.1
#=GS J8IDM1_BACCE/1-79      AC J8IDM1.1
#=GS J8RGP2_BACCE/1-79      AC J8RGP2.1
#=GS C2RSR2_BACCE/1-79      AC C2RSR2.1
#=GS A0A023DQB7_GEOTM/1-79  AC A0A023DQB7.1
#=GS R8MYE6_BACCE/1-79      AC R8MYE6.1
#=GS B3YVW3_BACCE/1-79      AC B3YVW3.1
#=GS H2AKC3_BACAM/1-79      AC H2AKC3.1
#=GS R8STM3_BACCE/1-79      AC R8STM3.1
#=GS E3DXC0_BACA1/1-79      AC E3DXC0.1
#=GS C3HN34_BACTU/1-79      AC C3HN34.1
#=GS J8KUI9_BACCE/1-79      AC J8KUI9.1
#=GS S6FSR3_BACAM/1-79      AC S6FSR3.1
#=GS W4R7Q9_9BACI/1-79      AC W4R7Q9.1
#=GS C2QGP4_BACCE/1-79      AC C2QGP4.1
#=GS J7VYS6_BACCE/1-79      AC J7VYS6.1
#=GS Q3ETS2_BACTI/1-79      AC Q3ETS2.1
#=GS R8TEV2_BACCE/1-79      AC R8TEV2.1
#=GS Q65HR9_BACLD/1-79      AC Q65HR9.1
#=GS J8H273_BACCE/1-79      AC J8H273.1
#=GS J8E383_BACCE/1-79      AC J8E383.1
#=GS B7GKF0_ANOFW/4-82      AC B7GKF0.1
#=GS R8IXC7_BACCE/1-79      AC R8IXC7.1
#=GS A0A015MFJ8_BACTU/1-79  AC A0A015MFJ8.1
#=GS J0DLI9_9BACI/1-79      AC J0DLI9.1
#=GS G9Q261_9BACI/1-79      AC G9Q261.1
#=GS W0CZ30_BACAN/1-79      AC W0CZ30.1
#=GS Q812U5_BACCR/1-79      AC Q812U5.1
#=GS I2C7C0_BACAM/1-79      AC I2C7C0.1
#=GS T5HET1_BACLI/1-79      AC T5HET1.1
#=GS R8GC02_BACCE/1-79      AC R8GC02.1
#=GS Q4MMV7_BACCE/1-79      AC Q4MMV7.1
#=GS J9CDE0_BACCE/1-79      AC J9CDE0.1
#=GS E3III0_GEOS0/1-79      AC E3III0.1
#=GS I0UHP9_BACLI/1-79      AC I0UHP9.1
#=GS M1U9Y8_BACIU/1-79      AC M1U9Y8.1
#=GS J8FHF7_BACCE/1-79      AC J8FHF7.1
#=GS G4NX30_BACPT/1-79      AC G4NX30.1
#=GS M4KZ38_BACIU/1-79      AC M4KZ38.1
#=GS C2WSD2_BACCE/1-79      AC C2WSD2.1
#=GS J8JMT2_BACCE/1-79      AC J8JMT2.1
#=GS A0A023DDS8_9BACI/1-79  AC A0A023DDS8.1
#=GS D5TWV2_BACT1/1-79      AC D5TWV2.1
#=GS C3INY3_BACTU/1-79      AC C3INY3.1
#=GS W7GZI6_BACAN/1-79      AC W7GZI6.1
#=GS A0RIA9_BACAH/1-79      AC A0RIA9.1
#=GS R8LS52_BACCE/1-79      AC R8LS52.1
#=GS R8Q5Z8_BACCE/1-79      AC R8Q5Z8.1
#=GS A0A023CLQ1_GEOSE/1-79  AC A0A023CLQ1.1
#=GS R8VA84_BACCE/1-79      AC R8VA84.1
#=GS C2V034_BACCE/1-79      AC C2V034.1
#=GS C3E849_BACTU/1-79      AC C3E849.1
#=GS R8PJR2_BACCE/1-79      AC R8PJR2.1
#=GS C5D419_GEOSW/1-79      AC C5D419.1
#=GS A4IQK0_GEOTN/1-79      AC A4IQK0.1
#=GS R8E1W2_BACCE/1-79      AC R8E1W2.1
#=GS A7GSD1_BACCN/1-79      AC A7GSD1.1
#=GS J8BAX7_BACCE/1-79      AC J8BAX7.1
#=GS J8PDX0_BACCE/1-79      AC J8PDX0.1
#=GS M4LAL0_BACTK/1-79      AC M4LAL0.1
#=GS U2Y079_GEOKU/1-79      AC U2Y079.1
#=GS J7Y3W3_BACCE/1-79      AC J7Y3W3.1
#=GS A9VG46_BACWK/1-79      AC A9VG46.1
#=GS J8GBI6_BACCE/1-79      AC J8GBI6.1
#=GS E8SYP3_GEOS2/1-79      AC E8SYP3.1
#=GS B0Q318_BACAN/1-79      AC B0Q318.1
#=GS J8AEC7_BACCE/1-79      AC J8AEC7.1
#=GS V8Q7V1_BACTA/1-79      AC V8Q7V1.1
#=GS N0DHK2_BACIU/1-79      AC N0DHK2.1
#=GS Q6HE58_BACHK/1-79      AC Q6HE58.1
#=GS K2HNW2_BACAM/1-79      AC K2HNW2.1
#=GS D5N6E7_BACPN/1-79      AC D5N6E7.1
#=GS B7IWM1_BACC2/1-79      AC B7IWM1.1
#=GS V7Q993_9BACI/1-79      AC V7Q993.1
#=GS J5P2P2_BACAN/1-79      AC J5P2P2.1
#=GS C3LIX3_BACAC/1-79      AC C3LIX3.1
#=GS C3C7C7_BACTU/1-79      AC C3C7C7.1
#=GS J8ZFI4_BACCE/1-79      AC J8ZFI4.1
#=GS J8R018_BACCE/1-79      AC J8R018.1
#=GS G0IL98_BACAM/1-79      AC G0IL98.1
#=GS B5USQ7_BACCE/1-79      AC B5USQ7.1
#=GS S6FMD5_BACAM/1-79      AC S6FMD5.1
#=GS Q635H4_BACCZ/1-79      AC Q635H4.1
#=GS C3FPZ9_BACTB/1-79      AC C3FPZ9.1
#=GS J8RZC3_BACCE/1-79      AC J8RZC3.1
#=GS A0A024BFA9_BACAM/1-79  AC A0A024BFA9.1
#=GS K0FK69_BACTU/1-79      AC K0FK69.1
#=GS C2UIB8_BACCE/1-79      AC C2UIB8.1
#=GS N1LLX8_9BACI/1-79      AC N1LLX8.1
#=GS B4BLB4_9BACI/1-79      AC B4BLB4.1
#=GS R8JAP5_BACCE/1-79      AC R8JAP5.1
#=GS C2VYP9_BACCE/1-79      AC C2VYP9.1
#=GS M5P9B6_9BACI/1-79      AC M5P9B6.1
#=GS L0D343_BACIU/1-79      AC L0D343.1
#=GS U5ZRH3_9BACI/1-79      AC U5ZRH3.1
#=GS R8D562_BACCE/1-79      AC R8D562.1
#=GS R8DZU8_BACCE/1-79      AC R8DZU8.1
#=GS J8CK14_BACCE/1-79      AC J8CK14.1
#=GS J8PS59_BACCE/1-79      AC J8PS59.1
#=GS J7WQU5_BACCE/1-79      AC J7WQU5.1
#=GS C2Q0F9_BACCE/1-79      AC C2Q0F9.1
#=GS J8AXI5_BACCE/1-79      AC J8AXI5.1
#=GS M4XCY4_BACIU/1-79      AC M4XCY4.1
#=GS M1XDT9_BACAM/1-79      AC M1XDT9.1
#=GS C2T5L3_BACCE/1-79      AC C2T5L3.1
#=GS C3P7P3_BACAA/1-79      AC C3P7P3.1
#=GS B1US25_BACAN/1-79      AC B1US25.1
#=GS J7ZQP6_BACCE/1-79      AC J7ZQP6.1
#=GS J8QZA1_BACCE/1-79      AC J8QZA1.1
#=GS J8DTR4_BACCE/1-79      AC J8DTR4.1
#=GS F8CV81_GEOTC/1-79      AC F8CV81.1
#=GS W4DQZ5_9BACI/1-79      AC W4DQZ5.1
#=GS J8H9K4_BACCE/1-79      AC J8H9K4.1
#=GS G4EU65_BACIU/1-79      AC G4EU65.1
#=GS F2H4L3_BACTU/1-79      AC F2H4L3.1
#=GS R8GTP3_BACCE/1-79      AC R8GTP3.1
#=GS C2TL07_BACCE/1-79      AC C2TL07.1
#=GS R8LBS2_BACCE/1-79      AC R8LBS2.1
#=GS I4XKL5_BACAT/1-79      AC I4XKL5.1
#=GS J7W3C0_BACCE/1-79      AC J7W3C0.1
#=GS J9DE60_BACCE/1-79      AC J9DE60.1
#=GS H8XCG5_BACAM/1-79      AC H8XCG5.1
#=GS J9CJE2_BACCE/1-79      AC J9CJE2.1
#=GS J8ISK9_BACCE/1-79      AC J8ISK9.1
#=GS E0U2N6_BACPZ/1-79      AC E0U2N6.1
#=GS C3D6L8_BACTU/1-79      AC C3D6L8.1
#=GS R4F8V7_9BACI/4-82      AC R4F8V7.1
#=GS B0ASQ0_BACAN/1-79      AC B0ASQ0.1
#=GS J8BVB3_BACCE/1-79      AC J8BVB3.1
#=GS U1YSA8_9BACI/1-79      AC U1YSA8.1
#=GS R8K1S7_BACCE/1-79      AC R8K1S7.1
#=GS J8KMX9_BACCE/1-79      AC J8KMX9.1
#=GS W8YG04_BACTU/1-79      AC W8YG04.1
#=GS G8N0N5_GEOTH/1-79      AC G8N0N5.1
#=GS C2MQ94_BACCE/1-79      AC C2MQ94.1
#=GS F4E803_BACAM/1-79      AC F4E803.1
#=GS J9B3C5_BACCE/1-79      AC J9B3C5.1
#=GS U1UKD9_BACAM/1-79      AC U1UKD9.1
#=GS R0MRP9_BACAT/1-79      AC R0MRP9.1
#=GS Q731J0_BACC1/1-59      AC Q731J0.1
#=GS R8MNL2_BACCE/1-79      AC R8MNL2.1
#=GS C2RCP9_BACCE/1-79      AC C2RCP9.1
#=GS M2VK90_BACIU/1-79      AC M2VK90.1
#=GS K2N724_9BACI/1-79      AC K2N724.1
#=GS R9TXS4_BACLI/1-79      AC R9TXS4.1
#=GS U1W522_BACTU/1-79      AC U1W522.1
#=GS C3EQ21_BACTK/1-79      AC C3EQ21.1
#=GS J8HZR8_BACCE/1-79      AC J8HZR8.1
#=GS A0A023PAF6_9BACI/1-79  AC A0A023PAF6.1
#=GS E8VBQ8_BACST/1-79      AC E8VBQ8.1
#=GS W7RKU0_BACLI/1-79      AC W7RKU0.1
#=GS C3B7J9_BACMY/1-79      AC C3B7J9.1
#=GS C2NMG4_BACCE/1-79      AC C2NMG4.1
#=GS C3H5V2_BACTU/1-79      AC C3H5V2.1
#=GS V6VFM1_9BACI/1-79      AC V6VFM1.1
#=GS I2HSR4_9BACI/1-79      AC I2HSR4.1
#=GS R8ENB8_BACCE/1-79      AC R8ENB8.1
#=GS V8QDM6_BACTA/1-79      AC V8QDM6.1
#=GS B3ZVI5_BACCE/1-79      AC B3ZVI5.1
#=GS R8YRI8_BACCE/1-79      AC R8YRI8.1
#=GS C3F6D7_BACTU/1-79      AC C3F6D7.1
#=GS R8SDT9_BACCE/1-79      AC R8SDT9.1
#=GS C2S8J5_BACCE/1-79      AC C2S8J5.1
#=GS W7YAI3_BACAN/1-79      AC W7YAI3.1
#=GS R8KV50_BACCE/1-79      AC R8KV50.1
#=GS W9TS12_BACIU/1-79      AC W9TS12.1
#=GS J7YN59_BACCE/1-79      AC J7YN59.1
#=GS R8JQB5_BACCE/1-79      AC R8JQB5.1
#=GS R8P0N5_BACCE/1-79      AC R8P0N5.1
#=GS C3I5Q5_BACTU/1-79      AC C3I5Q5.1
#=GS B7JLW2_BACC0/1-79      AC B7JLW2.1
#=GS S3JM75_BACCE/1-79      AC S3JM75.1
#=GS B7H999_BACC4/1-79      AC B7H999.1
#=GS C2N5Y2_BACCE/1-79      AC C2N5Y2.1
#=GS B0QH20_BACAN/1-79      AC B0QH20.1
#=GS R8CED9_BACCE/1-79      AC R8CED9.1
#=GS L8AMS8_BACIU/1-79      AC L8AMS8.1
#=GS C2QXT4_BACCE/1-79      AC C2QXT4.1
#=GS S7U7M0_9BACI/1-79      AC S7U7M0.1
#=GS U4PSE2_BACAM/1-79      AC U4PSE2.1
#=GS M5JEB3_9BACI/1-79      AC M5JEB3.1
#=GS J7JPA1_BACIU/1-79      AC J7JPA1.1
#=GS C2XYS8_BACCE/1-79      AC C2XYS8.1
#=GS W8IGQ8_BACAM/1-79      AC W8IGQ8.1
#=GS J8KGH6_BACCE/1-79      AC J8KGH6.1
#=GS B1EWN0_BACAN/1-79      AC B1EWN0.1
#=GS J8MCU7_BACCE/1-79      AC J8MCU7.1
#=GS J4A1N7_BACTU/1-79      AC J4A1N7.1
#=GS J8FD87_BACCE/1-79      AC J8FD87.1
#=GS L8PVZ1_BACIU/1-79      AC L8PVZ1.1
#=GS F0PU21_BACT0/1-79      AC F0PU21.1
#=GS M8DS54_9BACI/1-79      AC M8DS54.1
#=GS J7XSI4_BACCE/1-79      AC J7XSI4.1
#=GS M4HEC2_BACCE/1-79      AC M4HEC2.1
#=GS W8HZB7_BACAN/1-79      AC W8HZB7.1
#=GS J7WSA5_BACCE/1-79      AC J7WSA5.1
#=GS B4ALC7_BACPU/1-79      AC B4ALC7.1
#=GS T0CIP7_9BACI/1-79      AC T0CIP7.1
#=GS R8LLF7_BACCE/1-79      AC R8LLF7.1
#=GS A0A011QGQ1_BACAN/1-79  AC A0A011QGQ1.1
#=GS V5MEP2_BACTU/1-79      AC V5MEP2.1
#=GS R8RQ72_BACCE/1-79      AC R8RQ72.1
#=GS R8FEC0_BACCE/1-79      AC R8FEC0.1
#=GS C2SPQ8_BACCE/1-79      AC C2SPQ8.1
#=GS R8NW06_BACCE/1-79      AC R8NW06.1
#=GS C2ZCF2_BACCE/1-79      AC C2ZCF2.1
#=GS F4EQP0_BACAM/1-79      AC F4EQP0.1
#=GS D4FYE3_BACNB/1-79      AC D4FYE3.1
#=GS E5W0M1_9BACI/1-79      AC E5W0M1.1
#=GS L0BQ60_BACAM/1-79      AC L0BQ60.1
#=GS J8N4Q1_BACCE/1-79      AC J8N4Q1.1
#=GS C2X2B1_BACCE/1-79      AC C2X2B1.1
#=GS M1KPV1_BACAM/1-79      AC M1KPV1.1
#=GS R8I403_BACCE/1-79      AC R8I403.1
#=GS W7GDY8_BACAN/1-79      AC W7GDY8.1
#=GS C1EQY1_BACC3/1-79      AC C1EQY1.1
#=GS J8M5S8_BACCE/1-79      AC J8M5S8.1
#=GS J3UK63_BACTU/1-79      AC J3UK63.1
#=GS R8RPL7_BACCE/1-79      AC R8RPL7.1
#=GS I0D7D4_BACAN/1-79      AC I0D7D4.1
#=GS U5X6B1_BACAM/1-79      AC U5X6B1.1
#=GS G8U3R8_BACCE/1-79      AC G8U3R8.1
#=GS B3Z6Z0_BACCE/1-79      AC B3Z6Z0.1
#=GS R8T5G8_BACCE/1-79      AC R8T5G8.1
#=GS A0A059NHI9_9BACI/1-79  AC A0A059NHI9.1
#=GS C3GNQ4_BACTU/1-79      AC C3GNQ4.1
#=GS T0PY59_9BACI/1-79      AC T0PY59.1
#=GS J8W5X6_BACCE/1-79      AC J8W5X6.1
#=GS I4VE85_9BACI/1-79      AC I4VE85.1
#=GS C2XGB9_BACCE/1-79      AC C2XGB9.1
#=GS J8KQM2_BACCE/1-79      AC J8KQM2.1
#=GS C3AAF2_BACMY/1-79      AC C3AAF2.1
#=GS C2YF06_BACCE/1-79      AC C2YF06.1
#=GS W7HAI2_BACAN/1-79      AC W7HAI2.1
#=GS Q5KXH6_GEOKA/1-79      AC Q5KXH6.1
#=GS S5Z708_9BACI/1-79      AC S5Z708.1
#=GS S3HXB9_BACCE/1-79      AC S3HXB9.1
#=GS G4P7M9_BACIU/1-79      AC G4P7M9.1
#=GS D7D471_GEOSC/1-79      AC D7D471.1
#=GS I0F609_9BACI/1-79      AC I0F609.1
#=GS R8CZQ2_BACCE/1-79      AC R8CZQ2.1
#=GS C3AQ67_BACMY/1-79      AC C3AQ67.1
#=GS R8HI76_BACCE/1-79      AC R8HI76.1
#=GS J7EDE9_BACAN/1-79      AC J7EDE9.1
#=GS J7XJ64_BACCE/1-79      AC J7XJ64.1
#=GS C2WBP4_BACCE/1-79      AC C2WBP4.1
#=GS J9ACP6_BACCE/1-79      AC J9ACP6.1
#=GS YQKC_BACSU/1-79        AC P54566.1
#=GS J8WXV7_BACCE/1-79      AC J8WXV7.1
#=GS E1UKB1_BACAS/1-79      AC E1UKB1.1
#=GS R8TQ80_BACCE/1-79      AC R8TQ80.1
#=GS J8GA17_BACCE/1-79      AC J8GA17.1
#=GS U2S314_BACAM/1-79      AC U2S314.1
#=GS V5MTR8_BACIU/1-79      AC V5MTR8.1
#=GS J9C4A6_BACCE/1-79      AC J9C4A6.1
#=GS A0A024DU97_BACTK/1-79  AC A0A024DU97.1
#=GS B1GIQ5_BACAN/1-79      AC B1GIQ5.1
#=GS H0NTW4_BACCE/1-79      AC H0NTW4.1
#=GS I0UAN2_GEOTM/1-79      AC I0UAN2.1
#=GS J7XQ76_BACCE/1-79      AC J7XQ76.1
#=GS J7ZCR7_BACCE/1-79      AC J7ZCR7.1
#=GS C2U267_BACCE/1-79      AC C2U267.1
#=GS J7WI03_BACCE/1-79      AC J7WI03.1
#=GS B3J300_BACAN/1-79      AC B3J300.1
#=GS C3G7S2_BACTU/1-79      AC C3G7S2.1
#=GS V9RJ14_BACAM/1-79      AC V9RJ14.1
C2PJS5_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISVNMEQVTDVL
A0A011WG34_BACTI/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8IWM5_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W0CGF3_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8EIL3_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0A059NMD8_9BACI/1-79             .MDQKLKVIQNTAQNKTWVSFLNNNHPYSLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVSWIKENMEHVTDVL
C2P3A5_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3CNM3_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3BPL4_9BACI/1-79                 .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
C2VGD7_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
D8H9M9_BACAI/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A8FEU9_BACP2/1-79                 .MDQKLKVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL
C2YW50_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W8QXI1_BACPU/1-79                 .MDQKLIVIQNTAQNKTWVSFLNNNHPYSLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVSWIKENMEHVTDVL
R8Q7T9_BACCE/1-79                 .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
J8SET4_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
A7Z6B3_BACA2/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
B5V735_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C9RZV3_GEOSY/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
B7HNM4_BACC7/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
L7ZTT2_9BACI/1-79                 .MNGKLEQLAKTAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLESAIAWLGEHMPHITEVL
R8G2D8_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8KLW7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENLEQVTDVL
Q81MC0_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
M1PQ65_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W4E0K2_9BACI/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENLEQVTDVL
M5R727_9BACI/1-79                 .MNDQVNRLRKIVKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
C3DPP3_BACTS/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8LDB0_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0A016QGP0_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
B9IWX1_BACCQ/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2ZTY3_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
J8IDM1_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8RGP2_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
C2RSR2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0A023DQB7_GEOTM/1-79             .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
R8MYE6_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
B3YVW3_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
H2AKC3_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
R8STM3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E3DXC0_BACA1/1-79                 .MDQKLKSIKQTAQHKTWVSFLNKNHPYSLLHWSIGGAESIQKDVWLLQDEMTFDTQEFTTIDLAINWIGENMDGITDVL
C3HN34_BACTU/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8KUI9_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
S6FSR3_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFMTIDLAIDWIGENMDGITDVL
W4R7Q9_9BACI/1-79                 .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C2QGP4_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMDQVTDVL
J7VYS6_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q3ETS2_BACTI/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8TEV2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q65HR9_BACLD/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
J8H273_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8E383_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
B7GKF0_ANOFW/4-82                 v-NDQVNRLRKIAKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
R8IXC7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0A015MFJ8_BACTU/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J0DLI9_9BACI/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
G9Q261_9BACI/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W0CZ30_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q812U5_BACCR/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
I2C7C0_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
T5HET1_BACLI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
R8GC02_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q4MMV7_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J9CDE0_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E3III0_GEOS0/1-79                 .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
I0UHP9_BACLI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
M1U9Y8_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
J8FHF7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G4NX30_BACPT/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
M4KZ38_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C2WSD2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8JMT2_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
A0A023DDS8_9BACI/1-79             .MNDKLKQLKDVAKQKTWVSFLHGSDPYSLLHWSIAGPYHEPKDVWLLQNEMTFETKEFATLDEAVSWIDEHMPHITEIL
D5TWV2_BACT1/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3INY3_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W7GZI6_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0RIA9_BACAH/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8LS52_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
R8Q5Z8_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
A0A023CLQ1_GEOSE/1-79             .MKDKLKQIANVAKQKTWVSFLHENDPYSLLHWSIAGPYHEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPHITEIL
R8VA84_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C2V034_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C3E849_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENLEQVTDVL
R8PJR2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C5D419_GEOSW/1-79                 .MKDKLKQIANVAKQKTWVSFLHENDPYSLLHWSIAGVYHEPKDVWLLQNEMTFETKEFATLDEAIAWMDEHMPNITEIL
A4IQK0_GEOTN/1-79                 .MNGKLRQLAETAKQKTWVSFTHENDPYSLLHWSVAGPYHDKKDVWLLQNEMTFETKEFATLDDAIAWLGEHMPHITEVL
R8E1W2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A7GSD1_BACCN/1-79                 .MNKQLRTLQNVANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFATLDEAMKWISENMEQITDVL
J8BAX7_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8PDX0_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
M4LAL0_BACTK/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
U2Y079_GEOKU/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEAAIAWLGEHMPHITEVL
J7Y3W3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A9VG46_BACWK/1-79                 .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8GBI6_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
E8SYP3_GEOS2/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
B0Q318_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8AEC7_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
V8Q7V1_BACTA/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
N0DHK2_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
Q6HE58_BACHK/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
K2HNW2_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
D5N6E7_BACPN/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
B7IWM1_BACC2/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
V7Q993_9BACI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
J5P2P2_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3LIX3_BACAC/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3C7C7_BACTU/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8ZFI4_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
J8R018_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G0IL98_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
B5USQ7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
S6FMD5_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
Q635H4_BACCZ/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3FPZ9_BACTB/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8RZC3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
A0A024BFA9_BACAM/1-79             .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
K0FK69_BACTU/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C2UIB8_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
N1LLX8_9BACI/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B4BLB4_9BACI/1-79                 .MNGKLRQLAETAKQKTWVSFTHENDPYSLLHWSVAGPYHDKKDVWLLQNEMTFETKEFATLDDAIAWLGEHMPHITEVL
R8JAP5_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
C2VYP9_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
M5P9B6_9BACI/1-79                 .MNQKVKSLKQTAQNKTWVSFLHQNHPYSLLHWSIGGTESVQKDVWLLQDEMTFETKEFDKLESAIVWISENMNDITDVL
L0D343_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
U5ZRH3_9BACI/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
R8D562_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
R8DZU8_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8CK14_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8PS59_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J7WQU5_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2Q0F9_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8AXI5_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
M4XCY4_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
M1XDT9_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
C2T5L3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3P7P3_BACAA/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B1US25_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J7ZQP6_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8QZA1_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
J8DTR4_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
F8CV81_GEOTC/1-79                 .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
W4DQZ5_9BACI/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J8H9K4_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
G4EU65_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
F2H4L3_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8GTP3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDNAMQWISENMEQVTDVL
C2TL07_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8LBS2_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
I4XKL5_BACAT/1-79                 .MDQKLKSIKQTAQHKTWVSFLNKNHPYSLLHWSIGGAESIQKDVWLLQDEMTFDTQEFTTIDLAINWIGENMDGITDVL
J7W3C0_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
J9DE60_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
H8XCG5_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
J9CJE2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8ISK9_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E0U2N6_BACPZ/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C3D6L8_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R4F8V7_9BACI/4-82                 v-NDQVNRLRKIVKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
B0ASQ0_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8BVB3_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISVNMEQVTDVL
U1YSA8_9BACI/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
R8K1S7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8KMX9_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
W8YG04_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
G8N0N5_GEOTH/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
C2MQ94_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
F4E803_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
J9B3C5_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
U1UKD9_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
R0MRP9_BACAT/1-79                 .MDQKLKSIKQTAQHKTWVSFLNKNHPYSLLHWSIGGAESIQKDVWLLQDEMTFDTQEFTTIDLAINWIGENMDGITDVL
Q731J0_BACC1/1-59                 .--------------------MNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
R8MNL2_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C2RCP9_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
M2VK90_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
K2N724_9BACI/1-79                 .MDQKLKVIQNTAQNKTWVSFLNNNHPYSLLHWSIGGMDSVKKDVWLLQDEVTFKTEEFPTLELAVNWIKENMDQVTDVL
R9TXS4_BACLI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
U1W522_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3EQ21_BACTK/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8HZR8_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
A0A023PAF6_9BACI/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E8VBQ8_BACST/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
W7RKU0_BACLI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
C3B7J9_BACMY/1-79                 .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
C2NMG4_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3H5V2_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
V6VFM1_9BACI/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
I2HSR4_9BACI/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
R8ENB8_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
V8QDM6_BACTA/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B3ZVI5_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8YRI8_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3F6D7_BACTU/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8SDT9_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2S8J5_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
W7YAI3_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8KV50_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
W9TS12_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
J7YN59_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
R8JQB5_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
R8P0N5_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
C3I5Q5_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B7JLW2_BACC0/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
S3JM75_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B7H999_BACC4/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2N5Y2_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B0QH20_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8CED9_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
L8AMS8_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C2QXT4_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
S7U7M0_9BACI/1-79                 .MNGKLEQLAKTAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLESAIAWLGEHMPHITEVL
U4PSE2_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
M5JEB3_9BACI/1-79                 .MNDQVNRLRKIVKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPSITDIL
J7JPA1_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
C2XYS8_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
W8IGQ8_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
J8KGH6_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
B1EWN0_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8MCU7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J4A1N7_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8FD87_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
L8PVZ1_BACIU/1-79                 .MEQKLKSMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
F0PU21_BACT0/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
M8DS54_9BACI/1-79                 .MNDQVNRLRKIVKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPNITDIL
J7XSI4_BACCE/1-79                 .MDKKLQTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
M4HEC2_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
W8HZB7_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J7WSA5_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
B4ALC7_BACPU/1-79                 .MDQKLRVIQNTAQNKTWVSFLNNNHPYTLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVNWIKENMEQVTDVL
T0CIP7_9BACI/1-79                 .MNDQVNRLRKIVKEKTWVSFLYNNHPYSLLHWSVAGFSNDERDVWLLQDEMTFETQSFVQLDEALAWIEQHMPHITDIL
R8LLF7_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
A0A011QGQ1_BACAN/1-79             .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
V5MEP2_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8RQ72_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8FEC0_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2SPQ8_BACCE/1-79                 .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
R8NW06_BACCE/1-79                 .MNKQLRTLQIIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
C2ZCF2_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
F4EQP0_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
D4FYE3_BACNB/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
E5W0M1_9BACI/1-79                 .MNQKVKSLKQTAQNKTWASFLHQNHPYTLLHWSIGGTESVKKDVWLLQDEMTFETKEFDTIETAISWIGDHMSDITDIL
L0BQ60_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
J8N4Q1_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEVKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2X2B1_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
M1KPV1_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
R8I403_BACCE/1-79                 .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
W7GDY8_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C1EQY1_BACC3/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8M5S8_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J3UK63_BACTU/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8RPL7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
I0D7D4_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
U5X6B1_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
G8U3R8_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B3Z6Z0_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
R8T5G8_BACCE/1-79                 .MNKQLRTLQIIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
A0A059NHI9_9BACI/1-79             .MDQKLKAIQNTAKNKTWVSFLNNNHPYSLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLDLAVNWIKENMDQVTDVL
C3GNQ4_BACTU/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
T0PY59_9BACI/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEAAIAWLGEHMPHITEVL
J8W5X6_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
I4VE85_9BACI/1-79                 .MDQKLKVIQNTAQNKTWVSFLNNNHPYSLLHWSIGGMDSVKKDVWLLQDEVTFETEEFPTLELAVSWIKENMEHVTDVL
C2XGB9_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J8KQM2_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLYWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
C3AAF2_BACMY/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C2YF06_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
W7HAI2_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
Q5KXH6_GEOKA/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFEMKEFPTLEEAIAWLGEHMPHITEVL
S5Z708_9BACI/1-79                 .MNGKLRQLAETARQKTWVSFTHENDPYSLLHWSVAGPYHDKKDVWLLQNEMTFETKEFATLNDAIAWLGEHMPHITEVL
S3HXB9_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
G4P7M9_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
D7D471_GEOSC/1-79                 .MNGKLEQLAKAAKQKTWVSFTHENDPYSLLHWSVAGPYHEAKDVWLLQNEMTFETKEFPTLEAAIAWLGEHMPHITEVL
I0F609_9BACI/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESVKKDVWLLQDEMTFETQEFTTIDLAIEWIREHMDDITDVL
R8CZQ2_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C3AQ67_BACMY/1-79                 .MNKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
R8HI76_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
J7EDE9_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
J7XJ64_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C2WBP4_BACCE/1-79                 .MNKQLRTLQSVANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFQTLDEAVKWISENMEQVTDVL
J9ACP6_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
YQKC_BACSU/1-79                   .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
J8WXV7_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
E1UKB1_BACAS/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
R8TQ80_BACCE/1-79                 .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
J8GA17_BACCE/1-79                 .MDKQLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
U2S314_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
V5MTR8_BACIU/1-79                 .MEQKLKAMKNTAQNKTWVSFLNQNHPYTLLHWSIGGAESIKKDVWLLQDEMTFETQEFTTIDLAIEWIRENMDGITDVL
J9C4A6_BACCE/1-79                 .MDKKLHTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
A0A024DU97_BACTK/1-79             .MDKQLHTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
B1GIQ5_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
H0NTW4_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
I0UAN2_GEOTM/1-79                 .MNDKLKQIANIAKQKTWVSFLHENDPYSLLHWSIAGIYQEPKDVWLLQNEMTFETKEFATLDEAVAWMDEHMPNITEVL
J7XQ76_BACCE/1-79                 .MDKKLRTLQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAIKWISENMEQVTDVL
J7ZCR7_BACCE/1-79                 .MDKKLHALQNIANERTWASFLNDNHPYSLLHWSIAGVGQEPKDVWLLQDEVTFQTTEFPTLDEAVKWISENMEQVTDVL
C2U267_BACCE/1-79                 .MDKQLLTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQEAKDVWLLQDEVTFQTTEFPTLDEAVQWISENMEQVTDVL
J7WI03_BACCE/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
B3J300_BACAN/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAMQWISENMEQVTDVL
C3G7S2_BACTU/1-79                 .MDKQLRTLRNIANERTWASFLNDNHPYSLLHWSIAGVGQESKDVWLLQDEVTFQTTEFPTLDDAIKWISENMEQVTDVL
V9RJ14_BACAM/1-79                 .MNQKLKAIKQTAQHKTWVSFLNNNHPYSLLHWSIGGAESVQKDVWLLQDEMTFKAQEFTTIDLAIDWIGENMDGITDVL
#=GC seq_cons                     .MDKpL+TL+NIANERTWASFLNDNHPYSLLHWSIAGVGQEsKDVWLLQDEVTFQTTEFPTLD-AhpWISENMEQVTDVL
//
DBGET integrated database retrieval system