GenomeNet

Database: Pfam
Entry: DUF2685
LinkDB: DUF2685
Original site: DUF2685 
#=GF ID   DUF2685
#=GF AC   PF10886.6
#=GF DE   Protein of unknown function (DUF2685)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   31.70 118.40;
#=GF NC   24.30 16.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024362;
#=GF CC   Members in this family of proteins are annotated as uvdY.-2
#=GF CC   which is an open reading frame within uvsY. However currently
#=GF CC   there is no known function.
#=GF SQ   2
#=GS Y11A_BPT4/3-55     AC Q00778.1
#=GS Q6WHC6_BPKVM/1-55  AC Q6WHC6.1
Y11A_BPT4/3-55                DKICVVCKTPIDSALV-VETDKGPVHPGPCYNYIKELPVSES-SEEQLNETQLLL
Q6WHC6_BPKVM/1-55             MAHCVVCKQPIKEGDVTIDTPQGTVHAGQCQQHLAEMAISESGGDQQLVETQLLN
#=GC seq_cons                 .thCVVCKpPIcpu.V.l-TspGsVHsG.C.paltEhslSES.u-pQLsETQLL.
//
DBGET integrated database retrieval system