GenomeNet

Database: Pfam
Entry: DUF2748
LinkDB: DUF2748
Original site: DUF2748 
#=GF ID   DUF2748
#=GF AC   PF10871.3
#=GF DE   Protein of unknown function (DUF2748)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   791.70 791.50;
#=GF NC   18.90 18.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR020183;
#=GF CC   This is a bacterial family of proteins with unknown function.
#=GF SQ   44
#=GS D5AVV6_RICPP/1-440  AC D5AVV6.1
#=GS H8N7E8_RICPO/1-440  AC H8N7E8.1
#=GS H6QFZ7_RICRI/1-440  AC H6QFZ7.1
#=GS C3PM63_RICAE/1-440  AC C3PM63.1
#=GS H8KE26_RICPT/1-440  AC H8KE26.1
#=GS Y034_RICPR/1-440    AC Q9ZEB1.1
#=GS G0GWA8_RICH0/1-440  AC G0GWA8.1
#=GS H8KBC9_RICMS/1-436  AC H8KBC9.1
#=GS H8NJA2_RICTP/1-440  AC H8NJA2.1
#=GS A8GQI1_RICRS/1-440  AC A8GQI1.1
#=GS A8EXA1_RICCK/1-440  AC A8EXA1.1
#=GS H6PL47_RICRI/1-440  AC H6PL47.1
#=GS H6PJZ0_RICRI/1-440  AC H6PJZ0.1
#=GS H8N3X0_RICPO/1-440  AC H8N3X0.1
#=GS H8NH09_RICTP/1-440  AC H8NH09.1
#=GS B3CSL5_ORITI/1-447  AC B3CSL5.1
#=GS H8LN63_RICSL/1-440  AC H8LN63.1
#=GS H6PWS7_RICRI/1-440  AC H6PWS7.1
#=GS H6PQV0_RICRI/1-440  AC H6PQV0.1
#=GS C4YYR0_9RICK/1-440  AC C4YYR0.1
#=GS A8GY66_RICB8/1-440  AC A8GY66.1
#=GS H6Q1H6_RICRI/1-440  AC H6Q1H6.1
#=GS H8ND24_RICPO/1-440  AC H8ND24.1
#=GS H6QKJ3_RICMA/1-440  AC H6QKJ3.1
#=GS H8N616_RICPO/1-440  AC H8N616.1
#=GS G4KKY4_RICJY/1-440  AC G4KKY4.1
#=GS Q68XR0_RICTY/1-440  AC Q68XR0.1
#=GS C4K2E7_RICPU/1-440  AC C4K2E7.1
#=GS A8GLT1_RICAH/1-440  AC A8GLT1.1
#=GS H8K8Y9_RICAC/1-440  AC H8K8Y9.1
#=GS H6PVK3_RICP3/1-440  AC H6PVK3.1
#=GS H6PDG7_RICCA/1-440  AC H6PDG7.1
#=GS H8K3R8_RICAG/1-440  AC H8K3R8.1
#=GS G8L970_RICS1/1-440  AC G8L970.1
#=GS A5CFJ5_ORITB/1-447  AC A5CFJ5.1
#=GS H8KH87_RICR3/1-440  AC H8KH87.1
#=GS Q7PAF5_RICSI/1-422  AC Q7PAF5.1
#=GS B0BVW8_RICRO/1-440  AC B0BVW8.1
#=GS Q1RGR5_RICBR/1-440  AC Q1RGR5.1
#=GS Y048_RICCN/1-440    AC Q92JL9.1
#=GS Q4UN51_RICFE/1-440  AC Q4UN51.1
#=GS H8N9R9_RICPO/1-440  AC H8N9R9.1
#=GS H8NGB0_RICPO/1-440  AC H8NGB0.1
#=GS A8F0D9_RICM5/4-443  AC A8F0D9.1
D5AVV6_RICPP/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
H8N7E8_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
H6QFZ7_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
C3PM63_RICAE/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8KE26_RICPT/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKISGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
Y034_RICPR/1-440               MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
G0GWA8_RICH0/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8KBC9_RICMS/1-436             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMTDMVSWQRVGGNSGMQSTN----AIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8NJA2_RICTP/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNISLMVSNEELTRPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKQEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDIAIFVSCGGNP--FAENNKAHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSCTKATDKVRLARKSDIIHCNNLFNKLLKAGMKKQLEYETKLKFYNTNKISGLKVNAIKFMILIYKFRLLSYSSKNNLIFIRKFKTDKYMALMIETMFKDMQANLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKEIMHHLYKIYYNEVIPSLITSYNSFTGENYKRDFkknksSFFSKINIFNNKKL--ILK----PVREL.
A8GQI1_RICRS/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
A8EXA1_RICCK/1-440             MTSIYHILEHVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTDPALNISLMVSKEELTNPHLIPETTKLFQSLYRNSLSD----QKIKSIFENLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGNMMDMVNWQRVGANSGMQSTNGKNVAIFVSCGGNP--FAENNKDHPTYGNGFAAVARLQIIAAQELGHFADIKRDDRGKQITRHSANFSGTKAKDKVRIARRNDIIHCHNLLYKLLKAGMKKQLEYEMKLKFYNANKISGLKVYAIKFMIFIYKFRLLNYSSRHNLIFVKKFKTDKYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMQDLYKIYYNDVIPSLITSYNAVTGEDYKRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H6PL47_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPTADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H6PJZ0_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8N3X0_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
H8NH09_RICTP/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNISLMVSNEELTRPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKQEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDIAIFVSCGGNP--FAENNKAHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSCTKATDKVRLARKSDIIHCNNLFNKLLKAGMKKQLEYETKLKFYNTNKISGLKVNAIKFMILIYKFRLLSYSSKNNLIFIRKFKTDKYMALMIETMFKDMQANLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKEIMHHLYKIYYNEVIPSLITSYNSFTGENYKRDFkknksSFFSKINIFNNKKL--ILK----PVREL.
B3CSL5_ORITI/1-447             MSNLYHILHKLPAIEHEDMMVEYENLAQSLVQSGKLRVDAEPKINFVRLSEPSLNVNIAISNEELNDPKLQHHTKAMLINIYKKIIEKDKVIHKVNQIVSVLQKKMAMQLAVEQDLLLKLARLFVQSAHPIVIHWLLLERVEVFISYSNQIGDVMDIATWKYAGQNSGMQSINGNNIAIYVSCGGNPFFFTQRYQEQSIYGDGWPAIARLQIIAAQELGHYADIYRDINANIVGRHSVNSSFTKAKPNVLHARRSDLSRCYKILQDLEYIGLNSLITYEKSVKFYRKNKVKGIKLLWARLLSFFYKQKLYFMIKQEDFIFVKVYKNEQYSGLMLKAMILDMISNLEPKAEVYKRDDPDAEEAIACVEALARVPQQVIKWGHITTMSIMQDLYYIYYKQVIPSLIDRYQYITGKTYMRNL.....NYVSQTLKYRIKKLWPFFKKTSLPSREV.
H8LN63_RICSL/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H6PWS7_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H6PQV0_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
C4YYR0_9RICK/1-440             MTSIYHILDRIPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSKEELTSPHLVPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQLVKKEVIEMLARLFVQSAHPIVIRWLLFNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDRGRQITRHSANFSGTKAADKVRIARKNDIIHCHNLLAKLLKAGMKKQLDYETKLKFYNVNKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVKKFKTDKYMALMIEAMFKDMQANLSPNAYVYKNKNPEIEEAVACIEALARVPQQAVKWGCLTTKETMHDLYKIYYNKVIPSLITSYNAVTGENYKRDFkkpksNFFSKINIFSNKKL--ILK----PVREL.
A8GY66_RICB8/1-440             MSTIYHILDHVPAIYKEDMEIEYENLAMQIIKSGKLRIDTDDCCNFARFSDPAFNISMMVSKEELTDPHLIPETTKLFQNLYRNSATD----QKIKSVFDNLKKQIHKLQPVKKEVMEMLARIFVQSAHPIVIRWLLLDKTEIFITYSHNIGDMMDMVNWQKVGGNSGMQSTNGKDVAIFVSCGGNP--FAENSKDHPIYGGGFAAVARLQIIAAQELGHFADIKRDNKGRQITRHSANFSGTKATDNARIARKKDIEHCRNLLHKLLIAGMKKQLDYETKLKFYHANKVSGLKILAINFMIFIYKFKLLRYSNKHGLVFVRKFKSDKYMALMIDAMFKDMQANLSPSADVYKNKNPEIEEAVACIEALARVPQQVMKWGYLTTKETMHELYKIYYNEVIPSLITSYDAVTGENYKRSLkkskvSLLAKINIFNKKKL--VLK----PVREL.
H6Q1H6_RICRI/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWKRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8ND24_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAVKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
H6QKJ3_RICMA/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMQKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIYAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8N616_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
G4KKY4_RICJY/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNTNKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
Q68XR0_RICTY/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNISLMVSNEELTRPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKQEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDIAIFVSCGGNP--FAENNKAHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSCTKATDKVRLARKSDIIHCNNLFNKLLKAGMKKQLEYETKLKFYNTNKISGLKVNAIKFMILIYKFRLLSYSSKNNLIFIRKFKTDKYMALMIETMFKDMQANLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKEIMHHLYKIYYNEVIPSLITSYNSFTGENYKRDFkknksSFFSKINIFNNKKL--ILK----PVREL.
C4K2E7_RICPU/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
A8GLT1_RICAH/1-440             MTSIYHILDRVPAIYKQDIEIEYENLAMQLIKSGKLRIDTDDCCNFARFIEPALNISLMVSKEELTSPNLIHETTKLFQNVYRNAASD----QKIKSIFDNLKNQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHQTYGNGWPAIARLQIIAAQELGHFADIKRDDKGRQITRHSANFSCTKATDKVRIARKSDIINCHNLLSKLLKAGMKKQLDYETKLKFYNANKVGGLKVYTIKFMIFIYKFRLLNYSRRNNLIFVRKFKTDKYMALMIDAMFKDMQANLSPNAEVYKNKNPEIQEAVACIEALARVPQQVVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYKRYFkkpksSFFSKINIFSNKKL--ILK----PVREL.
H8K8Y9_RICAC/1-440             MASIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFAKFTEPALNISLMVSKEELTSPNLIPETTKLFQNLYRNTASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAEHNKEHPTYGNGWPAIARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKSDIINCHNLLSKLLKAGMKQQIDYETKLKFYNANKVNGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDKYMALMIDAMFKDMQANLSPNAEVYKNKNPEIEEAVACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYKRDFkkpksSFFSKINIFSNKKL--ILK----PVRK-l
H6PVK3_RICP3/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H6PDG7_RICCA/1-440             MTSIYHILEHVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTDPALNISLMVSKEELTNPHLIPETTKLFQSLYRNSLSD----QKIKSIFENLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGNMMDMVNWQRVGANSGMQSTNGKNVAIFVSCGGNP--FAENNKDHPTYGNGFAAVARLQIIAAQELGHFADIKRDDRGKQITRHSANFSGTKAKDKVRIARRNDIIHCHNLLYKLLKAGMKKQLEYEMKLKFYNANKISGLKVYAIKFMIFIYKFRLLNYSSRHNLIFVKKFKTDKYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMQDLYKIYYNDVIPSLITSYNAVTGEDYKRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
H8K3R8_RICAG/1-440             MTSIYNILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
G8L970_RICS1/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
A5CFJ5_ORITB/1-447             MSNLYHILHKLPAIEHEDMMVEYENLAQSLVQSGKLRVDAEPKINFVRLSEPSLNVNIAISNEELNDPKLQHHTKAMLVNIYKKIIEKDKVIHKVNQIVSVLQKKMAMQLAVEQDLLLKLARLFVQSAHPIVIHWLLLERVEVFISYSNQIGDVMDIATWKYAGQNSGMQSINGNNIAIYVSCGGNPFFFTQRYQEQSIYGDGWPAIARLQIIAAQELGHYADIYRDINANIVGRHSVNSSFTKAKPNVLHARRSDLSRCYKILQNLECVGLNSLITYEKSVKFYRKNKVKGIKLLWARLLSFFYKQKLYFMIKQEDFIFVKVYKNEQYSGLMLKAMILDMISNLEPKAEVYKRDDPDAEEAIACVEALARVPQQVIKWGHITTMSIMQDLYYIYYKQVIPSLIDRYQYITGKPYMRNL.....NYVSQTLKYRIKKLWPFFKKTSLPSREV.
H8KH87_RICR3/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIRKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGSNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDNKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMQKQLDYETKLKFYNANKVSSLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIYAMFKDMQANLSPAADVYKNKNPEIEEATACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
Q7PAF5_RICSI/1-422             ------------------MEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
B0BVW8_RICRO/1-440             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIKWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDNPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
Q1RGR5_RICBR/1-440             MSTIYHILDHVPAIYKEDMEIEYENLAMQIIKSGKLRIDTDDCCNFARFSDPAFNISMMVSKEELTDPHLIPETTKLFQNLYRNSATD----QKIKSVFDNLKKQIHKLQPVKKEVMEMLARIFVQSAHPIVIRWLLLDKTEIFITYSHNIGDMMDMVNWQKVGGNSGMQSTNGKDVAIFVSCGGNP--FAENSKDHPIYGGGFAAVARLQIIAAQELGHFADIKRDNKGRQITRHSANFSGTKATDNARIARKKDIEHCRNLLHKLLIAGMKKQLDYETKLKFYHANKVSGLKILAINFMIFIYKFKLLRYSNKHGLVFVRKFKSDKYMALMIDAMFKDMQANLSPSADVYKNKNPEIEEAVACIEALARVPQQVMKWGYLTTKETMHELYKIYYNEVIPSLITSYDAVTGENYKRSLkkakvSLLAKINIFNKKKL--VLK----PVREL.
Y048_RICCN/1-440               MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYKNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFQLLNYSSRNNLIFVRKFKTDEYMALMIDAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQTVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAITGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
Q4UN51_RICFE/1-440             MTSIYHILDNVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDNCCNFARFTEPALNISLMVSKEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFNNLKQQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDYPMYGNGWPAVARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVKKFKTDKYMALMIEAMFKDMQANLSPNAEVYKNKNPEIEEAVACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYKRDFkkpknGLFSRINIFRNKKL--VLK----PVREL.
H8N9R9_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAIKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
H8NGB0_RICPO/1-440             MTSIYHILDRIPAIYKQDMEIEYEYLAMQLIKSGKLRIDTNDCCNFARFTDPALNINLMISKEELTKPHLIPETTKLFQSLYKNSASD----QKINSIFDNLKKQIQKLQPVKKEVTEMLARLFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDIVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKEHPSYGDGFAAVARLQIIAAQELGHFADIKRDDKGRQLTRHAANFSGTKATDKVRIARKSDIIHCNNLFNKLLNAGMKKQLEYETKLKFYNTNKINGVKVNAVKCMILIYKFRLLNYSSKNNLIFIRKFKTYKYMALMLEAMFKDMQDNLSPNAEVYKNKNPEIEEAIACIEALARVPQQTIKWGYLTTKETMHHLYKIYYNEVIPSLITSYNSFTGENYKRNLkkpksSFFSKINIFSNKKL--ILK----PVREL.
A8F0D9_RICM5/4-443             MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSQEELTSPHLIPETTKLFQNLYRNSASD----QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP--FAENNKDHPTYGNGFAAAARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLSKLLKAGMQKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDEYMALMIYAMFKDMQANLSPAADVYKNKNPEIEEAIACIEALARVPQQAVKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAVTGENYQRDFkkpksNFFSKINIFSNKKL--VLK----PVREL.
#=GC seq_cons                  MTSIYHILDRVPAIYKQDMEIEYEHLAMQLIKSGKLRIDTDDCCNFARFTEPALNISLMVSpEELTSPHLIPETTKLFQNLYRNSASD....QKIKSIFDNLKKQIQKLQPVKKEVTEMLARIFVQSAHPIVIRWLLLNKTEVFLTYSHNIGDMMDMVSWQRVGGNSGMQSTNGKDVAIFVSCGGNP..FAENNKDHPTYGNGFAAsARLQIIAAQELGHFADIKRDDKGRQITRHSANFSGTKATDKVRIARKNDIIHCHNLLuKLLKAGMKKQLDYETKLKFYNANKVSGLKVYAIKFMIFIYKFRLLNYSSRNNLIFVRKFKTDcYMALMI-AMFKDMQANLSPsADVYKNKNPEIEEAIACIEALARVPQQTlKWGYLTTKETMHDLYKIYYNEVIPSLITSYNAlTGENYpRDFKKPKSNFFSKINIFSNKKL..VLK....PVREL.
//
DBGET integrated database retrieval system