GenomeNet

Database: Pfam
Entry: DUF276
LinkDB: DUF276
Original site: DUF276 
#=GF ID   DUF276
#=GF AC   PF03434.8
#=GF DE   DUF276 
#=GF AU   Finn RD
#=GF SE   Pfam-B_4450 (release 6.6)
#=GF GA   25.00 25.00;
#=GF TC   30.20 30.20;
#=GF NC   20.50 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR005096;
#=GF CC   This family is specific to Borrelia burgdorferi.  The protein is
#=GF CC   encoded on extra-chromosomal DNA.	     This domain has no
#=GF CC   known function.
#=GF SQ   157
#=GS B8DX85_BORAF/1-291  AC B8DX85.1
#=GS C1FC50_BORBG/1-291  AC C1FC50.1
#=GS C0RQM5_BORBG/1-291  AC C0RQM5.1
#=GS C0RSG0_BORBG/1-291  AC C0RSG0.1
#=GS Q5XYU7_BORGA/1-291  AC Q5XYU7.1
#=GS B9LXV6_BORBG/1-291  AC B9LXV6.1
#=GS Q9S088_BORBU/1-291  AC Q9S088.1
#=GS C0RDB1_BORBG/1-291  AC C0RDB1.1
#=GS B8EHF7_BORBG/1-291  AC B8EHF7.1
#=GS Q9S071_BORBU/1-291  AC Q9S071.1
#=GS B7J358_BORBZ/1-291  AC B7J358.1
#=GS E4QRU0_BORBG/1-291  AC E4QRU0.1
#=GS G0ISP3_BORAP/1-291  AC G0ISP3.1
#=GS C0SYN5_BORBG/1-265  AC C0SYN5.1
#=GS B8EGY4_BORBG/1-291  AC B8EGY4.1
#=GS B9LXI3_BORBG/1-290  AC B9LXI3.1
#=GS Q44793_BORBG/1-291  AC Q44793.1
#=GS Q0SLC5_BORAP/1-291  AC Q0SLC5.1
#=GS G0IT18_BORAP/1-291  AC G0IT18.1
#=GS G0ANF1_BORBD/1-291  AC G0ANF1.1
#=GS C0R8Z5_BORVA/1-105  AC C0R8Z5.1
#=GS B9X9C7_9SPIO/1-291  AC B9X9C7.1
#=GS B9X9A8_9SPIO/1-291  AC B9X9A8.1
#=GS C6C2Q4_BORBG/1-290  AC C6C2Q4.1
#=GS G0IST5_BORAP/1-291  AC G0IST5.1
#=GS B8DY77_BORAF/1-291  AC B8DY77.1
#=GS C0SYS6_BORBG/1-291  AC C0SYS6.1
#=GS B8F1B5_BORGR/1-47   AC B8F1B5.1
#=GS C0R6A2_BORBG/1-291  AC C0R6A2.1
#=GS B9LY83_BORBG/1-291  AC B9LY83.1
#=GS C0RR24_BORBG/1-291  AC C0RR24.1
#=GS C0RCH8_BORBG/1-290  AC C0RCH8.1
#=GS C0R6M0_BORBG/1-291  AC C0R6M0.1
#=GS E4QHL4_BORBN/1-291  AC E4QHL4.1
#=GS E4S3P3_BORBJ/1-291  AC E4S3P3.1
#=GS B7J2X7_BORBZ/1-291  AC B7J2X7.1
#=GS Q9L9N7_BORBG/1-291  AC Q9L9N7.1
#=GS C0RP12_BORBG/1-290  AC C0RP12.1
#=GS C6C2J4_BORBJ/1-290  AC C6C2J4.1
#=GS C0R734_BORBG/1-290  AC C0R734.1
#=GS E4QGV6_BORBN/1-291  AC E4QGV6.1
#=GS E4QEH6_BORBN/1-271  AC E4QEH6.1
#=GS C0R7I0_BORBG/1-107  AC C0R7I0.1
#=GS E4QQN5_BORBG/1-291  AC E4QQN5.1
#=GS B8F1I4_BORGR/1-290  AC B8F1I4.1
#=GS C6C2D0_BORBN/1-290  AC C6C2D0.1
#=GS C0RPU0_9SPIO/1-106  AC C0RPU0.1
#=GS B8F1B4_BORGR/1-38   AC B8F1B4.1
#=GS C1FCQ5_BORBG/1-290  AC C1FCQ5.1
#=GS C1FCM4_BORBG/1-291  AC C1FCM4.1
#=GS E4QRH0_BORBG/1-291  AC E4QRH0.1
#=GS C0RAN7_BORBG/1-291  AC C0RAN7.1
#=GS C0RS82_BORBG/1-290  AC C0RS82.1
#=GS C1FAL1_BORBG/1-291  AC C1FAL1.1
#=GS B8EGU1_BORBG/1-291  AC B8EGU1.1
#=GS C0RPU1_9SPIO/2-89   AC C0RPU1.1
#=GS C0RNL5_BORBG/1-291  AC C0RNL5.1
#=GS Q5XZ57_BORGA/1-291  AC Q5XZ57.1
#=GS G0ISL3_BORAP/1-271  AC G0ISL3.1
#=GS B7J089_BORBZ/1-291  AC B7J089.1
#=GS C1FAI5_BORBG/1-291  AC C1FAI5.1
#=GS B8EGH2_BORBG/1-291  AC B8EGH2.1
#=GS B9X963_9SPIO/1-50   AC B9X963.1
#=GS B5RNR4_BORDL/1-292  AC B5RNR4.1
#=GS C0R848_BORVA/1-290  AC C0R848.1
#=GS C0R7V2_BORBG/1-291  AC C0R7V2.1
#=GS I0FED0_9SPIO/1-286  AC I0FED0.1
#=GS B8DXZ6_BORAF/1-290  AC B8DXZ6.1
#=GS C0R9M0_BORBG/1-291  AC C0R9M0.1
#=GS C0RAH4_BORBG/1-291  AC C0RAH4.1
#=GS C0RQR8_BORBG/1-291  AC C0RQR8.1
#=GS Q6ASL7_BORGA/1-66   AC Q6ASL7.1
#=GS G0ANT1_BORBD/1-291  AC G0ANT1.1
#=GS C0RQ01_9SPIO/1-291  AC C0RQ01.1
#=GS B5RNU2_BORDL/1-292  AC B5RNU2.1
#=GS C0R6R3_BORBG/1-291  AC C0R6R3.1
#=GS C0R5X1_BORBG/1-291  AC C0R5X1.1
#=GS G0AN65_BORBD/1-291  AC G0AN65.1
#=GS B9LYI1_BORBG/1-291  AC B9LYI1.1
#=GS E4QHF1_BORBN/1-291  AC E4QHF1.1
#=GS G0AN23_BORBD/1-291  AC G0AN23.1
#=GS Q9S0C3_BORBU/1-291  AC Q9S0C3.1
#=GS C0RCU4_BORBG/1-291  AC C0RCU4.1
#=GS C1FBN2_BORBG/1-291  AC C1FBN2.1
#=GS C1FBR2_BORBG/1-74   AC C1FBR2.1
#=GS C0RAD2_BORBG/1-291  AC C0RAD2.1
#=GS Q6ASL8_BORGA/2-62   AC Q6ASL8.1
#=GS B9LXR4_BORBG/1-291  AC B9LXR4.1
#=GS E4S0C6_BORBJ/1-291  AC E4S0C6.1
#=GS E4QHR6_BORBN/1-291  AC E4QHR6.1
#=GS C0R6E5_BORBG/1-291  AC C0R6E5.1
#=GS B5RS07_BORRA/1-286  AC B5RS07.1
#=GS C0R8Z6_BORVA/1-46   AC C0R8Z6.1
#=GS C1FCY3_BORBG/1-291  AC C1FCY3.1
#=GS C0SZ10_BORBG/1-291  AC C0SZ10.1
#=GS B8F2H4_BORGR/1-174  AC B8F2H4.1
#=GS C0R9W4_BORBG/1-290  AC C0R9W4.1
#=GS C0R661_BORBG/1-291  AC C0R661.1
#=GS B7J051_BORBZ/1-291  AC B7J051.1
#=GS C0R9Q7_BORBG/1-291  AC C0R9Q7.1
#=GS G8W6V5_BORGR/1-93   AC G8W6V5.1
#=GS G0AMX7_BORBD/1-291  AC G0AMX7.1
#=GS B5RNY5_BORDL/1-292  AC B5RNY5.1
#=GS Q9R331_BORBU/1-291  AC Q9R331.1
#=GS Q9RZZ5_BORBU/1-291  AC Q9RZZ5.1
#=GS C1FAY6_BORBG/1-291  AC C1FAY6.1
#=GS C0RD70_BORBG/1-291  AC C0RD70.1
#=GS C0RRN9_BORBG/1-291  AC C0RRN9.1
#=GS C0RNY1_BORBG/1-291  AC C0RNY1.1
#=GS B8EHJ9_BORBG/1-291  AC B8EHJ9.1
#=GS B5RNI0_BORDL/1-286  AC B5RNI0.1
#=GS I0FEF2_9SPIO/1-292  AC I0FEF2.1
#=GS B8EG77_BORBG/1-290  AC B8EG77.1
#=GS B8F2T6_BORGR/1-49   AC B8F2T6.1
#=GS C0RNT6_BORBG/1-291  AC C0RNT6.1
#=GS B9LXZ4_BORBG/1-291  AC B9LXZ4.1
#=GS C0R8H5_BORVA/1-291  AC C0R8H5.1
#=GS B8DWX9_BORAF/1-291  AC B8DWX9.1
#=GS C0RQG5_9SPIO/1-275  AC C0RQG5.1
#=GS B8EH46_BORBG/1-291  AC B8EH46.1
#=GS B8F2T8_BORGR/1-72   AC B8F2T8.1
#=GS G0APD2_BORBD/1-290  AC G0APD2.1
#=GS Q5XYY9_BORGA/1-67   AC Q5XYY9.1
#=GS E4S3K6_BORBJ/1-291  AC E4S3K6.1
#=GS B8F1B3_BORGR/1-49   AC B8F1B3.1
#=GS Q9S0F2_BORBU/1-291  AC Q9S0F2.1
#=GS Q5XYX2_BORGA/1-291  AC Q5XYX2.1
#=GS C0RD27_BORBG/1-291  AC C0RD27.1
#=GS G0ANA8_BORBD/1-291  AC G0ANA8.1
#=GS C0RQ95_9SPIO/1-290  AC C0RQ95.1
#=GS E4QRY1_BORBG/1-291  AC E4QRY1.1
#=GS B8F2T7_BORGR/1-134  AC B8F2T7.1
#=GS O50903_BORBU/1-290  AC O50903.1
#=GS B9X968_9SPIO/1-148  AC B9X968.1
#=GS Q9S046_BORBU/1-291  AC Q9S046.1
#=GS C0RN35_BORBG/1-291  AC C0RN35.1
#=GS B8DXI6_BORAF/1-291  AC B8DXI6.1
#=GS C1FBB8_BORBG/1-290  AC C1FBB8.1
#=GS B7J004_BORBZ/1-291  AC B7J004.1
#=GS B7IZT7_BORBZ/1-290  AC B7IZT7.1
#=GS B8F0V7_BORGR/1-291  AC B8F0V7.1
#=GS E4QRD3_BORBG/1-291  AC E4QRD3.1
#=GS C0RC18_9SPIO/1-290  AC C0RC18.1
#=GS B8F2H5_BORGR/1-72   AC B8F2H5.1
#=GS C1FBR1_BORBG/1-54   AC C1FBR1.1
#=GS C0RRI3_BORBG/1-291  AC C0RRI3.1
#=GS C0API5_9SPIO/1-291  AC C0API5.1
#=GS E4S001_BORBJ/1-291  AC E4S001.1
#=GS C0RQW0_BORBG/1-291  AC C0RQW0.1
#=GS I0FDW0_9SPIO/1-171  AC I0FDW0.1
#=GS C1FBV5_BORBG/1-291  AC C1FBV5.1
#=GS Q5XYZ0_BORGA/1-143  AC Q5XYZ0.1
#=GS E4S057_BORBJ/1-291  AC E4S057.1
#=GS Q0SLZ6_BORAP/1-290  AC Q0SLZ6.1
#=GS C0RN77_BORBG/1-291  AC C0RN77.1
#=GS C0R7R1_BORBG/1-291  AC C0R7R1.1
#=GS G0ISX6_BORAP/1-291  AC G0ISX6.1
B8DX85_BORAF/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSEFQTNQDIAINDDTMLLFN.TTDRLLIDID...............
C1FC50_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDDSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RQM5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RSG0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDITITDDTMLLFN.TTDRLLIVID...............
Q5XYU7_BORGA/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMTPGGTYWSAIEEHISS.KSTTYSAVRSALLNLNGVEHANIKSSAGKANIYLILKEDLLDTGKTNINNPEFKAKLWETLYLTTPSGTLLEGNIEIDGLNSTGQLKSYKISLGKRKYVYIKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTNTESILKINDSDFKKNEDITINDDTMLLFN.TTDRLIIDID...............
B9LXV6_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVKSKKEYLRNNYGINIDDNNGSIYNIIASSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKANIYLIVKEDLLDRGKTNINDSIFKTKIWEILYLTIPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDVYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSMEIKTCIKDTNTENISSIADSDFKKNEDITINDDTMLIFN.TIDRLLIDID...............
Q9S088_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
C0RDB1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKIGDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
B8EHF7_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
Q9S071_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B7J358_BORBZ/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDEVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIILNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
E4QRU0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
G0ISP3_BORAP/1-291             ....MSIVFDSDFGILKRTIRDIVQTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYFDMGISFEYQDFFAPVNEVKGIKFMEIKICVKDTDTESISKISDSDFQTNQDISINDDTMLLFN.TTERLLIDID...............
C0SYN5_BORBG/1-265             ....--------------------------MRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDDSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFNKNQDITITDDTMLLFN.TTDRLLIDMD...............
B8EGY4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
B9LXI3_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
Q44793_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLGTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.ITDRLLIDMD...............
Q0SLC5_BORAP/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGSYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKFWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYFDMGISFEYQDFFAPVNEVKGIKFMEIKICVKDTDTESISKISDSDFQTNQDISINDDTMLLFN.TTERLLIDID...............
G0IT18_BORAP/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGGIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSEFQTNQDISINDDTMLLFN.TTDRLLIDID...............
G0ANF1_BORBD/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYLKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESISKITDSDFQTNKDITINDDTMLLFN.TTDRLLIDID...............
C0R8Z5_BORVA/1-105             ....------------------------------------------------------------------------------------.----------------------------------------------------------------------------------------------------MKAKYKLDLKNYPYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISTCVKDT--DSISKISNSDFQKNQDIAIDDDTMLIFN.TTERLIIGID...............
B9X9C7_9SPIO/1-291             ....MSIVFDSDFGVLKRTIKDIVRSKREYLRVTYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYGAVRTALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLDGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFVPVNEVKGIKFMEIKVCVKDTDTESISKISDGDFQTNQDFSINDDTILLFN.TTERLLIDID...............
B9X9A8_9SPIO/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRSALLNLNGVEHANIKSSAGKANIYLILKEDLLDTGKTNINNPEFKAKLWETLYLTTPSGTLLEGNIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEIKGIRFMEIQACVKDTDSESISKISDSDFKKNEDISINDDTMLLFN.TTDRLIIDID...............
C6C2Q4_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKENEIIIFN.TNKRLLINRE...............
G0IST5_BORAP/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSEFQTNQDISINDDTMLLFN.TTDRLLIDID...............
B8DY77_BORAF/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIISELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSDFQTNQDIAINDDTMLLFN.TTERLLIDID...............
C0SYS6_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVKSKKEYLRNNYGINIDDNNGSIYNIIASSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKAYIYLIVKEDLLDRGKTNINDFIFKTKIWEILYLTIPSGTLLEGDIEIDGFNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSMEIKTCIKDTNTENISSITDSDFKKNEDITINDDTMLIFN.TIDRLLIDID...............
B8F1B5_BORGR/1-47              ....------------------------------------------------------------------------------------.-------------------------------------------------------------------------------------------------------------------------------------------------------------MKIKNYVKDTDTQRISSITDSDFQTNKDIAIT--------.----------llmlqccfsiqlinc
C0R6A2_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
B9LY83_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYNLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RR24_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RCH8_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFGLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKENEIIIFD.TNKRLLINRE...............
C0R6M0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
E4QHL4_BORBN/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGAYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
E4S3P3_BORBJ/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGDTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B7J2X7_BORBZ/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYGAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
Q9L9N7_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKETDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
C0RP12_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
C6C2J4_BORBJ/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKENEIIIFN.TNKRLLINRE...............
C0R734_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
E4QGV6_BORBN/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDITINDDTMLLFN.TTDRLLIDI-g..............
E4QEH6_BORBN/1-271             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKPWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISACIKDTDTESIAKITDSDFKKI--------------.----------kifl...........
C0R7I0_BORBG/1-107             ....------------------------------------------------------------------------------------.----------------------------------------------------------------------------------------------------MKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDIAINDDTMLLFN.TTDRLLIDID...............
E4QQN5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B8F1I4_BORGR/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILKTKYGINIKDN--SIYDIINFPSSSIDKEISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLSVDGVKHINILSGPGTISLYLILKDDCFIDKEKNQIKIETKQNIWQAIYYTAPSGTVFKGNIEIEFLNKHNQKKTYKFSLGEKKYAYLKAIYKTEAKDAIYKEIDTQIRDIYNKILTEKYIEMGTSLRYQDFLAPVSIIRGIKELRIGTCIKSDDTKKITELSEGDFTFNKDENTKENEIIIFD.TKKRLLINRE...............
C6C2D0_BORBN/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
C0RPU0_9SPIO/1-106             ....MSIVFDSDFGILKRRIKNMAKSKRDYLHVNYAINIDNNNSPIYNIITSSLALIEEEVINKLNLFFSKMRPGGAYWTAIEEHISS.KNTTYSAVKSQL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------nlpylilvgl.....
B8F1B4_BORGR/1-38              ....------------------------------------------------------------------------------------.----------------------------------------------------------------------------------------------------MKVKYKLDLKNYVYLNIDSQIRDIYSRIIANNYFDIG------------------------------------------------------------.----------n..............
C1FCQ5_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
C1FCM4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLSLIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDEVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIILNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
E4QRH0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLGTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.ITDRLLIDMD...............
C0RAN7_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISACIKDTDTESIAKITDSDFKKNQDISIDDDTILLFN.TTDRLLIDMD...............
C0RS82_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
C1FAL1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIGGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDI-g..............
B8EGU1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
C0RPU1_9SPIO/2-89              .snn------------------------------------------------------------------------------------.-----------------------------------------------------------------SCGTLLEGNVEIDGLNSTRQHKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVN-----------------------------------------------.----------...............
C0RNL5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSADGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
Q5XZ57_BORGA/1-291             ....MSIVFDSDFGILKRTIKDIVKSKREYLRVSYGINIDDNHSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEYANIKSSAGKANIYLILKEDLLETNKTNINNPEFKAKLWETLYLTTPSGTLLDGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSDFQTNKDIAINADTMLLFN.TTERLLIDID...............
G0ISL3_BORAP/1-271             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKIFLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSEFSN---------------.----------ksryc..........
B7J089_BORBZ/1-291             ....MSIVFDSDFGILKRTIKDIVKSKKEYLRNNYGINIDDNNGSIYNIIASSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKAYIYLIVKEDLLDRGKTNINDFIFKTKIWEILYLTIPSGTLLEGDIEIDGFNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSMEIKTCIKDTNTENISSITDSDFKKNEDITINDDTMLIFN.TIDRLLIDID...............
C1FAI5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVKSKKEYLRNNYGINIDDNNGSIYNIIASSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKANIYLIVKEDLLDRGKTNINDSIFKTKIWEILYLTIPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSMEIKTCIKDTNTENISSIADSDFKKNEDITINDDTMLIFN.TIDRLLIDID...............
B8EGH2_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLGTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
B9X963_9SPIO/1-50              ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNNSSIYNIIASSL----------------------------------.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------...............
B5RNR4_BORDL/1-292             ....MSILFDSDVGVLKKNIEQIVNVKRQYLRDNYKILINDDPASIYNIIATSLAFKECELIDEVNKLFESIKPDSEYWQAIEKHISV.KSTTYEAIKNSLLSINGITHSNIKSTAGTASIYVIVEDEFLNSDKTQIEDTNLKANIWNILYLTCPIGTTFEGDIIIDGINNNNQRIEYKVSLGKKKYVYLKSKYKVNVKNHLYLNVDAKIRDIYTRIVNNNYGDMGISFEYQDFFAPVNEIKGVHCIDISVALKENLNTKINEINDSEFTNNENIQVEENEILDFDfTSDRLLINI-s..............
C0R848_BORVA/1-290             ....MSIIFDKNLGILEKTIEEIQTEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVDGVKHLNILSGPGTINLYLILQDDCFADKEKNQIKIETKQNIWQAIYYTAPSGTVFKGNVGIEFLNKHNQKKTYKFSLGEKKYAYLKAIYKTETKDAIYKEIDTQIRDIYNKILNEKYTEMGTSLRYQDFLAPVSIIKGIKELRIGTCIKKDFTKKITDLNDGDFTFNKDENTKENEIIIFD.TNKRLLINRE...............
C0R7V2_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFLEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
I0FED0_9SPIO/1-286             ....MRIVFDKETGIITKSIEEIQNTKKEILKREYNILIKDN--SIFDIINYPSSAIDMEIIQALNELFETLKEGGKYFKKLQHSLSIhKSSTYEAIKQALLAIPQIEYANIISSAGTIQIHIIFTKEYR---TLSAITQDIKIQIWKAIYNTAPCGTAFRGKIKLEFLNKNGQQKTYKFSLGIIKYAYLKVLYKTET-ESIHKEIDENIREIYKKIFQNKYKDMGISFCYQDLLGPVSLLQGIRKMKIGIHTKENLNTKITEIKESEFQFNNDIEIKANELISFD.ENSRLIIERE...............
B8DXZ6_BORAF/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLRELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLGVEKVKHINIVSGPGTIALYLILQDDCFQDKEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGEKKYAYLKAIYKTEAKDAIYKEIDTQIRDIYNKILTEKYTEMGTSLRYQDFLAPVSIIRGIKELRIGTCIKSDDTKKITELSESDFTFNKDENIKENEIIIFD.TNKRLLINRE...............
C0R9M0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSNSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
C0RAH4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
C0RQR8_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
Q6ASL7_BORGA/1-66              ....------------------------------------------------------------------------------------.---------------------------------------------------------------------------------------------------------------------------------------MGTSLRYQDFLALVSIIRGIKELRIGTCIKSDDIKKSQNLVRMILHSTKTKTLKRMK-----.----------llfliqkkt......
G0ANT1_BORBD/1-291             ....MSIIFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISF.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNSEFKAKLWETLYLTTPSGTSLEGDIEIDGLNSTGQRKSYKISLGKRNYVYRKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFTPVNEVKGIKFMEISTCIKDTDTESISKITDSDFNKNQDIAINDDTMLLFN.TTDRLLIDID...............
C0RQ01_9SPIO/1-291             ....MSIVFDSDFGILKRTIKDIVKSKREYLRANYAINIDDNNSSIYNIIASSLALIEEEIINELNLFFSKMRPGGTYWTTIEEHISS.KSTTYSAVKSALLNLDGVEYTNIKSSAGKANIYLILKEDLLDTSKTNISNSEFKAKLWETLYLTTPSGTLLEGNIEIDGFNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSIEIKTCVKDTDTNSISSITESDFKKNEDITIDDDTLLLFN.IADRLLIDID...............
B5RNU2_BORDL/1-292             ....MSILFDSDVGVLKKNIEQIVNAKRQYLRDNYKILINDDPASIYNIIATSLAFIECELIDEVNKLFQSIKPDSEYWQAIEKHISV.KSTTYEAIKNSLLSINGITHANIKSTAGTASIYVIVDEEFMNSDKTQIEDTNLKANIWNILYLTCPIGTTFEGDIIIDGINNNNQRIEYKVSLGKKKYVYLKSKYKVNVKNHLYLNVDAKIRDIYTRIANNNYGDMGISFEYQDFFAPVNEIKGVHCIDVSVALKENLNTKINEINDSEFTNNENIQVEENEILDFDfTSDRLLINI-s..............
C0R6R3_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDDSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0R5X1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISTCIKDTDTESITKIGDSDFKKNQDITINDDTMLLFN.TTDRLLIDI-g..............
G0AN65_BORBD/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYLKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESISKITDSDFNKNQDIAINDDTMLLFN.TTDRLLIDID...............
B9LYI1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
E4QHF1_BORBN/1-291             ....MSIVFDPDFGILKRTIKDIVKTKKEYLRNNYGINIDDNNGSIYNIIAYSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKANIYLIVKEDLLDSSKTNIKDFIFKTNIWTILYLTIPSGTLLEGDIEIDGFNPTGQKKSYKISLGKRKYVYMKVKYKIDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSIEIKTCIKDTNTENISSITDSDFKKNEDIAINDDTMLIFN.TIDRLLIDID...............
G0AN23_BORBD/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESISKITDSDFQTNKDIAINDDTMLLFN.TTDRLLIDID...............
Q9S0C3_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDDSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RCU4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYSIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGIEYTNIKSTAGKANIYLILKETLLDSSKSNINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKIGDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
C1FBN2_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFNKNQDITITDDTMLLFN.TTDRLLIDMD...............
C1FBR2_BORBG/1-74              ....MSVVFDSNFGILKYKIKDIVKSKIEYLSVNYGINIDNNNSSTYNIIAFSLALIEEEVIDKLNLFFSKMKSGGTY----------.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------...............
C0RAD2_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDIAINDDTILLFN.TTDRLLIDMD...............
Q6ASL8_BORGA/2-62              eail----------------------------------------------------------------------------ALKEDLSTpKSSTYEAIRKALLSVDGVKQINILSGPGTISLYLILKDDCFIDKKK-------------------------------------------------------------------------------------------------------------------------------------------------------.----------ln.............
B9LXR4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDITITDDTMLLFN.TTDRLLIVID...............
E4S0C6_BORBJ/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLSLIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLEKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
E4QHR6_BORBN/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDNNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTMLLFN.TTDRLLIDI-g..............
C0R6E5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVLNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B5RS07_BORRA/1-286             ....MRIVFDKETGIITKSIEEIQNIKKEILKREYNILIKDN--SIFDIINYPSSAIDMEIIQALNELFETLKEGGKYFKKLQHSLSIyKSSTYKAVKQTLLAIPQIEYANIISSAGTIQIYIIFTKEYR---TLSAITQDIKIQIWKAIYNTAPCGTAFRGKIKLEFFNKNGQQKTYKFSLGIIKYAYLKVLYKTET-ESIHKEIDENIREIYKKIFQNKYKDMGISFCYQDLLGPVSLLQGIRKMKIGIHTKENLNTKITEIKESEFQFNNDIEIKANELISFD.ENSRLIIERE...............
C0R8Z6_BORVA/1-46              ....------------------------------------------------------------------------------------.------------------------------------------------------------MYLTTPSDTLLEGDIEIDELNPTGQLKSYKRSLKKKKICL-------------------------------------------------------------------------------------------------.----------yeskiq.........
C1FCY3_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVSSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKIGDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
C0SZ10_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYGAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B8F2H4_BORGR/1-174             ....MSIIFDKNLGILEKTIEEIQNEKKHILKTKYGINIKDN--SIYDIINFPSSSIDKEISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLSVDGVKHINILSGPGTISLYLILKDDCFIDKEKNQIKIETKQNIWQAIYYTAPSGTVFKGNIEIEFLNKHNQKKH-------------------------------------------------------------------------------------------------------------.----------tns............
C0R9W4_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKENEIIIFN.TNKRLLINRE...............
C0R661_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKIGDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
B7J051_BORBZ/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRTISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKIGDSDFKKNQDITITDDTMLLFN.TTDRLLIDID...............
C0R9Q7_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
G8W6V5_BORGR/1-93              ....MSIIFDKNLGILEKTIEEIQNEKKHILKTKYGINIKDN--SIYDIINLPSSSIDKEISEVLKELFSKIEENGSYFNALKEDLSTpK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------klnlrsnkk......
G0AMX7_BORBD/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDVSKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYLKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKSMEISACIKDTDTESISKITDSDFQTNKDIAINDDTMLLFN.TTDRLLIDID...............
B5RNY5_BORDL/1-292             ....MSILFDSDVGVLKKNIEQIVNAKRQYLRDNYKILINDDPASIYNIIATSLAFKECELIDEVNKLFQSIKPDSEYWQAIEKHISV.KSTTYEAIKNSLLSINGITHANIKSTAGTASIYVIVDEEFMNSDKTQIEDTNLKANIWNILYLTCPIGTTFEGDIIIDGINNNNQRIEYKVSLGKKKYVYLKSKYKVNVKNHLYLNVDAKIRDIYTRIVNNNYGDMGISFEYQDFFAPVNEIKGVHCIDISVALKENLNTKINEINDSEFTNNENIQVEENEILDFDfTSDRLLINI-s..............
Q9R331_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
Q9RZZ5_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINKLNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDDSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C1FAY6_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIGACIKDTDTESIAKITDSDFNKNQDITITDDTMLLFN.TTDRLLIDMD...............
C0RD70_BORBG/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESISKITDSDFQTNKDIAINDDTMLLFN.TTDRLLIDID...............
C0RRN9_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYNLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RNY1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYNNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B8EHJ9_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLATPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
B5RNI0_BORDL/1-286             ....MRIVFDKETGIITKSIEEIQNIKKEILKREYNILIKDN--SIFDIINYPSSAIDMEIIQALNELFETLKEGGKYFKKLQHSLSIhKSSTYEAVKQTLLAIPQIEYANIISSAGTIQIYIIFTKEYR---TLSAITQDIKIQIWKAIYNTAPCGTAFRGKIKLEFFNKNGQQKTYKFSLGIIKYAYLKVLYKTET-ESIHKEIDENIREIYKKIFQNKYKDMGISFCYQDLLGPVSLLQGIRKMKIGIHTKENLNTKITEIKESEFQFNNDIEIKANELISFD.ENSRLIIERE...............
I0FEF2_9SPIO/1-292             ....MSIAFDSDFGIQKQDIKQLVNAKREYLRNKYNIVINDDPSTIYNIIATSLAIKECELIAEVNKLFDALKPDSTYWQAIKKHITI.QSTTYEAVKSALLSLSGVRHANIKSSAGKVNIYLILEDEMMNNDKTEITSTALKAKIWDTLYLTCPVGTVFDGDILIDGLNDNNQKIDYKISFGKRKYAFLKIKYKVDLKNYMYLNVDSHIRNIYFRIKKNNYGDMGLSFEYQDFFAPVNEIKGVHCLNVSIAVKDDLNTKITAIESSEFKENQNVAIKDNEILDLEfTAERLIIDI-s..............
B8EG77_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLNDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
B8F2T6_BORGR/1-49              ....MSIVFDSDFDILKSTIKDIVKSKGDCLRVNYGINIDDNHSSIYNI---------------------------------------.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------klhl...........
C0RNT6_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSNSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISTCIKDTDTESITKIGDRDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B9LXZ4_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0R8H5_BORVA/1-291             ....MSIVFDSDFGILKRTIKDIVKSKKEYLRNNYGINIDDNNGSIYNIIASSLALIEEEVINELNLFFSKMKPGGTYWSEIEKQISS.KSTTPSAVKSALLNLDGVEYANIKSSAGKAYIYLIVKEDLLDRGKTNINDFIFKTKIWEILYLTIPSGTLLEGDIEIDGFNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSMEIKTCIKDTNTENISSITDSDFKKNEDITINDDTMLIFN.TIDRLLIDID...............
B8DWX9_BORAF/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSDFQTNQDIAINDDTMLLFN.TTDRLLIDID...............
C0RQG5_9SPIO/1-275             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANKYLILKETLLDTSKSNINSPEFKAKLWKTLYLTTPSGTLLEGDTEIDGLNSTGQRKSYKISLGKRKYVYMKVKCKLYLKNYLYLNTDSQIRDIYSRIISNNYSDMGISFEYQNFFAPVNEVKGIKFMEISTCIKDTDTESITKIGDSDFKKI--------------.----------kilplmvt.......
B8EH46_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
B8F2T8_BORGR/1-72              ....------------------------------------------------------------------------------------.---------------------------------------------------------------------------------------------------------------------------------------MGINFEYQDFFAPVNEVKGIKFMEIKVCVKDADTESISKISDSDFQTNKDIAINDDTMLLFN.TADRLLIDID...............
G0APD2_BORBD/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHMLRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQEDCFKDQEKKQIKIETKENIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKAVYKTEAKDAIYKDIDAQIRDIYNKILTNKYIEMGTSLRYQDFLAPVSIIRGIKELKIGVCIKNDKTTKITQLSDSDFTFNKDENTKEDEIIIFD.TNKRLLINRE...............
Q5XYY9_BORGA/1-67              ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFLK-----------------.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------...............
E4S3K6_BORBJ/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWTAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKEALLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
B8F1B3_BORGR/1-49              ....MSIVFDSDFGILKSTIKDIVKFKKDYWRVNYGINIDDNHSSIYNI---------------------------------------.-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------klhl...........
Q9S0F2_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDDSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
Q5XYX2_BORGA/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYGAVRTALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEINGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0RD27_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISTCIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
G0ANA8_BORBD/1-291             ....MSIVFDSDFGILKRTIKDILRAKREYLRINYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGVEHTNIKSSAGKANIYLILKEDLLDASKANINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYLKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISTCIKDTDTESISKITDSDFNKNQDIAINDDTMLLFN.TTDRLLIDID...............
C0RQ95_9SPIO/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHMLRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTISLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKAVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITELSDSDFTFNKDENTKENEIIIFD.TNKRLLINRE...............
E4QRY1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGIEYANIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISITDDTILLFN.TTDRLLIDMD...............
B8F2T7_BORGR/1-134             ...m----------------------------------------------------IEEEIINGLNLFFSKTKPGGTYWAAIKEHISS.KSTTYSAVRTALLNPNGLQHANIKSSAGKANIYLILKEDLLDTTKTNINNPEFKAKLWETLYLTTPSGTLLDGDIEIDGLNSTEQLKSYKIYRSAK-----------------------------------------------------------------------------------------------------.----------enmfi..........
O50903_BORBU/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
B9X968_9SPIO/1-148             ....------------------------------------------------------------------------------------.-----------------------------------------------------------TLYLTTPSGTLLEGNIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEIKGIKFMEIQACVKDTDSESISKISDSDFKKNEDISINDDTMLLFN.TTDRLIIDID...............
Q9S046_BORBU/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDEVEYTNIKSAAGKANIYLILKETLLDTSKSNINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIILNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
C0RN35_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLEGVEYTNIKSAAGKANIYLILKETLLDASKSTINSSEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B8DXI6_BORAF/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSDFQTNQDIAINDDTMLLFN.TTERLLIDID...............
C1FBB8_BORBG/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
B7J004_BORBZ/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDDSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
B7IZT7_BORBZ/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLNVEGVKHINILSGPGTINLYLILQDDCFQDQEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGKKKYAYLKVVYKTEAKDAIYKEIDTQIRDIYNKILTDKYIEMGTSLRYQDFLAPVSIIRGIKELKIGICIKNDETKKITQLSDSDFTFNKDENTKEDEIIIFN.TNKRLLINRE...............
B8F0V7_BORGR/1-291             ....MSIVFDSDFGILKRTIKDIVKSKREYLRVSYGINIDDNHSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANMKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLDGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSDFQTNKDIAINDDTMLLFN.TTERLLIDID...............
E4QRD3_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKETDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
C0RC18_9SPIO/1-290             ....MSIIFDKNLGILEKTIEEIQSEKKHILKTKYGINIKDN--SIYDIINFPSSSIDKQISEILKELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLSINSVKHINILSGPGTINLYLILEDDCFKDKEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGEKKYAYLKAIYKTETKDAIYKEIDTQIRDIYNKILTKKYAEMGTSLRYQDFLAPVSIIRGIKELRIGTCIKNDDTKKISELSEGDFTFNKDENIKENEIIIFD.TNKRLLINRE...............
B8F2H5_BORGR/1-72              ....------------------------------------------------------------------------------------.---------------------------------------------------------------------------------------------------------------------------------------MGTSLRYQDFLAPVSIIRGIKELRIGTCIKSDDTKKITELSEGDFTFNKDENTKENEIIIFD.TKKRLLINRE...............
C1FBR1_BORBG/1-54              ....------------------------------------------------------------------------------------.----------------------------------------------------------------------------------------------------MKVKYKLDLKNYLCLKIDSQIRNIYFIIISNDYSDMEISFEYQDFFALINE----------------------------------------------.----------gkr............
C0RRI3_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRTKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSNSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISTCIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.MTDRLLIDI-g..............
C0API5_9SPIO/1-291             ....MSIVFDSDFGILKRTIKDIVKSKREYLRANYGINIDDNNSSIYNIIASSLALIEEEIINELNLFFSKMRPGGTYWTTIEEHISS.KSTTYSAVKSALLNLDGVEYTNIKSSAGKANIYLILKEDLLDTSKTNISNSEFKAKLWETLYLTTPSGTLLEGNIEIDGFNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIRSIEIKTCVKDTDTNSISSITESDFKKNEDITIDDDTLLLFN.IADRLLIDID...............
E4S001_BORBJ/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
C0RQW0_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSDTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
I0FDW0_9SPIO/1-171             ....MSILFDSDVGVLKKNIEQIVNAKRQYLRDNYKILINDDPASIYNIIATSLAFKECELIDEVNKLFKSIKPDSEYWQAIEKHISV.KSTTYEAIKNSLLSINGITHANIKSTAGTASIYLIIDDEFLNSDKTQIEDTNLKANIWNILYLTCPIGTTFEGDIIIDGINNNNQR---------------------------------------------------------------------------------------------------------------.----------i..............
C1FBV5_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIIDELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEYTNIKSAAGKANIYLILKETLLDTSKSNINSPKFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFIEISACIKDTDTESITKIGDSDFKKNQDITINDDTMLLFN.TTDRLLIDI-g..............
Q5XYZ0_BORGA/1-143             ....-------------------------------------------------------------------MKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLNGIQHANIKSSAGKANIYLILKEDLLDTTKTNINNPEFKAKLWETLYLTTPSGTLLGGDIEVDGLNSTGQLKSYKISLGKRKYAYIKVKYKLDLKNYLYFHY--------------------------------------------------------------------------------.----------fdqennlny......
E4S057_BORBJ/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGIGFEYQDFFAPVNEVKGIKFMEISACIKDTDTESIAKITDSDFKKNQDISIADDTILLFN.TTDRLLIDMD...............
Q0SLZ6_BORAP/1-290             ....MSIIFDKNLGILEKTIEEIQNEKKHILRTKYGINIKDN--SIYDIINFPSSSIDKQISEVLRELFSKIKENGSYFNALKEDLSTpKSSTYEAIRKALLGVEKVKHINIVSGPGTIALYLILQDDCFQDKEKKQIKIETKQNIWQAIYYTAPSGTVFKGDIEIEFLNKHNQKKTYKFSLGEKKYAYLKAIYKTEAKDAIYKEIDTQIRDIYNKILTEKYTEMGTSLRYQDFLAPVSIIRGIKELRIGTCIKSDDTKKITELSESDFTFNKDENIKENEIIIFD.TNKRLLINRE...............
C0RN77_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRAKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLDGIEYTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDIAINDDTMLLFN.TTDRLLIDI-g..............
C0R7R1_BORBG/1-291             ....MSIVFDSDFGILKRTIKDIVRSKREYLRVNYGINIDDNQSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRTALLNLDGVEHTNIKSAAGKANIYLILKETLLDTSKSNINSPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQRKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEISACIKDTDTESITKIGDSDFKKNQDITINDDTMLLFN.TTDRLLIDI-g..............
G0ISX6_BORAP/1-291             ....MSIVFDSDFGILKRTIRDIVRTKREYLRVNYGINIDDSNSSIYNIIASSLALIEEEIINELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRNALLNLNGIEHANIKSSAGKANIYLILKEDLLDTNKTNINNPEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQLKSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRNIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIKVCVKDTDTESISKISDSEFQTNQDISINDDTMLLFN.TTERLLIDID...............
#=GC seq_cons                  ....MSIVFDSDFGILKRTIKDIVRsKREYLRVNYGINIDDNpSSIYNIIASSLALIEEEIIsELNLFFSKMKPGGTYWAAIEEHISS.KSTTYSAVRsALLNL-GlEasNIKSuAGKANIYLILKEsLLDssKoNINssEFKAKLWETLYLTTPSGTLLEGDIEIDGLNSTGQ+KSYKISLGKRKYVYMKVKYKLDLKNYLYLNIDSQIRDIYSRIISNNYSDMGISFEYQDFFAPVNEVKGIKFMEIusCIKDTDTESIoKIsDSDFppNpDIsIsDDThLLFN.TTDRLLIDh................
//
DBGET integrated database retrieval system