GenomeNet

Database: Pfam
Entry: DUF2888
LinkDB: DUF2888
Original site: DUF2888 
#=GF ID   DUF2888
#=GF AC   PF11135.7
#=GF DE   Protein of unknown function (DUF2888)
#=GF AU   Pollington J, Finn RD
#=GF SE   PRODOM
#=GF GA   21.50 21.50;
#=GF TC   21.70 341.80;
#=GF NC   20.40 19.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR022600;
#=GF CC   Some members in this family of proteins with unknown function
#=GF CC   are annotated as immediate early protein ICP-18 however this
#=GF CC   cannot be confirmed.
#=GF SQ   1
#=GS ICP18_FRG3G/14-157  AC P03298.1
ICP18_FRG3G/14-157             GEPYTCKGDLCEIPFNRNFTIDLVNLSVSTEFQVKITMTPHHDLGTFVVEPKNVFSIKRAVKGDAAFKVERAAGWLPDTPQVLTLFVYERLNPVEWHSECMYENLETDGGTVIVPGEATGQRFGTATEVPTMFLFKRMFVVKGV
#=GC seq_cons                  GEPYTCKGDLCEIPFNRNFTIDLVNLSVSTEFQVKITMTPHHDLGTFVVEPKNVFSIKRAVKGDAAFKVERAAGWLPDTPQVLTLFVYERLNPVEWHSECMYENLETDGGTVIVPGEATGQRFGTATEVPTMFLFKRMFVVKGV
//
DBGET integrated database retrieval system