GenomeNet

Database: Pfam
Entry: DUF3218
LinkDB: DUF3218
Original site: DUF3218 
#=GF ID   DUF3218
#=GF AC   PF11508.3
#=GF DE   Protein of unknown function (DUF3218)
#=GF AU   Pollington J
#=GF SE   pdb_2igs
#=GF GA   25.00 25.00;
#=GF TC   30.30 134.00;
#=GF NC   21.50 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021593;
#=GF CC   This family of proteins with unknown function appears to be
#=GF CC   restricted to Pseudomonas.
#=GF SQ   9
#=GS Q02GI4_PSEAB/10-221  AC Q02GI4.1
#=GS H3SY54_PSEAE/3-215   AC H3SY54.1
#=GS Q7WY05_PSEAI/10-221  AC Q7WY05.1
#=GS F5KEP5_PSEAI/10-220  AC F5KEP5.1
#=GS F5KRY3_PSEAI/3-72    AC F5KRY3.1
#=GS Q1W535_PSEAI/17-228  AC Q1W535.1
#=GS Q9I1P7_PSEAE/3-215   AC Q9I1P7.1
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS H; 4-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS C; 4-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS F; 3-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS G; 4-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS D; 4-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS A; 4-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS E; 3-215;
#=GS Q9I1P7_PSEAE/3-215   DR PDB; 2IGS B; 3-215;
#=GS H3TNK3_PSEAE/3-215   AC H3TNK3.1
#=GS F5KRX1_PSEAI/1-135   AC F5KRX1.1
Q02GI4_PSEAB/10-221             ..QINIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVTALISSVSSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQAMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIATGIRYTTGVAITLAYWATV.......
H3SY54_PSEAE/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI.......
Q7WY05_PSEAI/10-221             ..QINIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVTALISSVSSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQAMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIATGIRYTTGVAITLAYWATV.......
F5KEP5_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICSPGAVFPEAETTEAWDIPLRLHPDFVPGGDVNAVNQQYATALAQETSNILLLGFQMSQNKDVVCG-DLIPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQSIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l......
F5KRY3_PSEAI/3-72               ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSG------------------------------------------------------------------------------------------------------------------------------------------------------acrdkge
Q1W535_PSEAI/17-228             ..QINLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDFGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWATV.......
Q9I1P7_PSEAE/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI.......
#=GR Q9I1P7_PSEAE/3-215   SS    ..---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT.......
H3TNK3_PSEAE/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI.......
F5KRX1_PSEAI/1-135              ..------------------------------------------------------------------------------MVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI.......
#=GC SS_cons                    ..---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT.......
#=GC seq_cons                   ..pINIYQNPGQSluslYKGhApQCsPG.sFPEAQhlEAWDIPLhLHPEFlPsGDlSKhDppYuTlLAtE.AphlhlthpMsp-Kt+sCs.ElhsLloShupNLspIKuRaGuuYLshhKtSPNhYPTsVGhph.uuGu.sQ-SGl.VSYGsNLtpLT.uphQAMsLPtslKtLls.GlGl+LstPpa.ssaNsItoGlRYTTuVslhLAYaAsl.......
//
DBGET integrated database retrieval system