GenomeNet

Database: Pfam
Entry: DUF3218
LinkDB: DUF3218
Original site: DUF3218 
#=GF ID   DUF3218
#=GF AC   PF11508.6
#=GF DE   Protein of unknown function (DUF3218)
#=GF AU   Pollington J
#=GF SE   pdb_2igs
#=GF GA   25.00 25.00;
#=GF TC   503.10 502.90;
#=GF NC   23.00 17.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021593;
#=GF CC   This family of proteins with unknown function appears to be
#=GF CC   restricted to Pseudomonas.
#=GF SQ   1
#=GS Q9I1P7_PSEAE/3-215  AC Q9I1P7.1
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS H; 4-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS C; 4-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS F; 3-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS G; 4-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS D; 4-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS A; 4-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS E; 3-215;
#=GS Q9I1P7_PSEAE/3-215  DR PDB; 2IGS B; 3-215;
Q9I1P7_PSEAE/3-215             EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI
#=GR Q9I1P7_PSEAE/3-215  SS    ---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT
#=GC SS_cons                   ---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT
#=GC seq_cons                  EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI
//
DBGET integrated database retrieval system