GenomeNet

Database: Pfam
Entry: DUF3218
LinkDB: DUF3218
Original site: DUF3218 
#=GF ID   DUF3218
#=GF AC   PF11508.4
#=GF DE   Protein of unknown function (DUF3218)
#=GF AU   Pollington J
#=GF SE   pdb_2igs
#=GF GA   25.00 25.00;
#=GF TC   140.20 140.10;
#=GF NC   23.00 17.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021593;
#=GF CC   This family of proteins with unknown function appears to be
#=GF CC   restricted to Pseudomonas.
#=GF SQ   98
#=GS X7CT42_PSEAI/3-215       AC X7CT42.1
#=GS T2DYQ7_PSEAI/3-215       AC T2DYQ7.1
#=GS U9NUI0_PSEAI/12-223      AC U9NUI0.1
#=GS U9LHY0_PSEAI/3-215       AC U9LHY0.1
#=GS U9Q958_PSEAI/3-215       AC U9Q958.1
#=GS A0A031AZX9_PSEAI/10-220  AC A0A031AZX9.1
#=GS U8IKD4_PSEAI/3-215       AC U8IKD4.1
#=GS U8M7C8_PSEAI/10-220      AC U8M7C8.1
#=GS X5EAE0_PSEAI/10-221      AC X5EAE0.1
#=GS U8SK27_PSEAI/3-215       AC U8SK27.1
#=GS U9IUR8_PSEAI/12-223      AC U9IUR8.1
#=GS U8L8Q5_PSEAI/12-223      AC U8L8Q5.1
#=GS Q1W535_PSEAI/17-228      AC Q1W535.1
#=GS V5T463_PSEAI/11-222      AC V5T463.1
#=GS X6XGB3_PSEAI/3-215       AC X6XGB3.1
#=GS Z2DK82_PSEAI/3-215       AC Z2DK82.1
#=GS U8Z7K6_PSEAI/3-215       AC U8Z7K6.1
#=GS V4MMP9_PSEAI/1-150       AC V4MMP9.1
#=GS A0A031E359_PSEAI/10-220  AC A0A031E359.1
#=GS X6ZC60_PSEAI/10-220      AC X6ZC60.1
#=GS U9LQK2_PSEAI/3-215       AC U9LQK2.1
#=GS U8BVW2_PSEAI/3-215       AC U8BVW2.1
#=GS A0A030SZ13_PSEAI/12-223  AC A0A030SZ13.1
#=GS U8BAY2_PSEAI/3-215       AC U8BAY2.1
#=GS U9GR97_PSEAI/3-215       AC U9GR97.1
#=GS U8LJ62_PSEAI/3-215       AC U8LJ62.1
#=GS A0A037W990_PSEAI/3-73    AC A0A037W990.1
#=GS V8GNR8_PSEAI/3-215       AC V8GNR8.1
#=GS Q9I1P7_PSEAE/3-215       AC Q9I1P7.1
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS H; 4-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS C; 4-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS F; 3-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS G; 4-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS D; 4-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS A; 4-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS E; 3-215;
#=GS Q9I1P7_PSEAE/3-215       DR PDB; 2IGS B; 3-215;
#=GS X6XZK3_PSEAI/3-215       AC X6XZK3.1
#=GS U8MUI4_PSEAI/3-215       AC U8MUI4.1
#=GS A0A030WDH7_PSEAI/10-220  AC A0A030WDH7.1
#=GS U9AEP2_PSEAI/3-215       AC U9AEP2.1
#=GS U8JB02_PSEAI/10-220      AC U8JB02.1
#=GS U8AXA3_PSEAI/3-215       AC U8AXA3.1
#=GS A0A031ANI5_PSEAI/3-215   AC A0A031ANI5.1
#=GS A0A031D9Z8_PSEAI/10-220  AC A0A031D9Z8.1
#=GS U8JKQ8_PSEAI/12-223      AC U8JKQ8.1
#=GS W0WEM5_PSEAI/3-215       AC W0WEM5.1
#=GS U8NBH9_PSEAI/3-215       AC U8NBH9.1
#=GS A0A030VBQ6_PSEAI/10-220  AC A0A030VBQ6.1
#=GS U9A946_PSEAI/12-223      AC U9A946.1
#=GS U9I5V7_PSEAI/3-215       AC U9I5V7.1
#=GS A0A031B5Y5_PSEAI/10-220  AC A0A031B5Y5.1
#=GS U9IXP0_PSEAI/10-220      AC U9IXP0.1
#=GS U5R5Z6_PSEAE/3-215       AC U5R5Z6.1
#=GS A0A030RT49_PSEAI/10-220  AC A0A030RT49.1
#=GS K1DCF7_PSEAI/3-215       AC K1DCF7.1
#=GS U9GMT9_PSEAI/3-215       AC U9GMT9.1
#=GS T2EK44_PSEAI/3-215       AC T2EK44.1
#=GS U8VGY8_PSEAI/10-220      AC U8VGY8.1
#=GS U9RQ52_PSEAI/3-215       AC U9RQ52.1
#=GS H3SY54_PSEAE/3-215       AC H3SY54.1
#=GS Q7WY05_PSEAI/10-221      AC Q7WY05.1
#=GS U9GQ16_PSEAI/12-223      AC U9GQ16.1
#=GS U8H8N6_PSEAI/3-215       AC U8H8N6.1
#=GS K1CIS2_PSEAI/10-221      AC K1CIS2.1
#=GS U8MJH0_PSEAI/10-220      AC U8MJH0.1
#=GS A0A030XV28_PSEAI/3-215   AC A0A030XV28.1
#=GS U9Q8Q3_PSEAI/12-223      AC U9Q8Q3.1
#=GS V4MJU9_PSEAI/3-73        AC V4MJU9.1
#=GS A0A030VGI4_PSEAI/10-220  AC A0A030VGI4.1
#=GS U9FPA0_PSEAI/3-215       AC U9FPA0.1
#=GS A0A037WFL9_PSEAI/3-215   AC A0A037WFL9.1
#=GS Q02GI4_PSEAB/10-221      AC Q02GI4.1
#=GS X6YAM9_PSEAI/3-215       AC X6YAM9.1
#=GS U8XIT8_PSEAI/3-215       AC U8XIT8.1
#=GS N2D7E2_PSEAI/3-215       AC N2D7E2.1
#=GS X7BCH7_PSEAI/10-220      AC X7BCH7.1
#=GS U8EP79_PSEAI/3-215       AC U8EP79.1
#=GS A0A031DF48_PSEAI/3-215   AC A0A031DF48.1
#=GS K1CSZ3_PSEAI/3-215       AC K1CSZ3.1
#=GS U8XXB9_PSEAI/3-215       AC U8XXB9.1
#=GS X7ADV3_PSEAI/3-215       AC X7ADV3.1
#=GS U8ALJ2_PSEAI/10-220      AC U8ALJ2.1
#=GS U8TRA0_PSEAI/10-220      AC U8TRA0.1
#=GS K0YLT3_PSEAI/3-215       AC K0YLT3.1
#=GS U5RIU9_PSEAE/3-215       AC U5RIU9.1
#=GS U8JF78_PSEAI/12-223      AC U8JF78.1
#=GS U9KMB8_PSEAI/3-215       AC U9KMB8.1
#=GS U8GXH6_PSEAI/12-223      AC U8GXH6.1
#=GS U8YJA0_PSEAI/3-215       AC U8YJA0.1
#=GS X7B0K4_PSEAI/3-215       AC X7B0K4.1
#=GS K1CFE2_PSEAI/3-215       AC K1CFE2.1
#=GS J6MCA8_PSEAI/3-215       AC J6MCA8.1
#=GS U9ERX2_PSEAI/3-215       AC U9ERX2.1
#=GS W0Z129_PSEAI/3-215       AC W0Z129.1
#=GS A0A031EET6_PSEAI/3-215   AC A0A031EET6.1
#=GS U8MVS0_PSEAI/12-223      AC U8MVS0.1
#=GS A0A031DTF7_PSEAI/3-215   AC A0A031DTF7.1
#=GS H3TNK3_PSEAE/3-215       AC H3TNK3.1
#=GS A0A030QXD0_PSEAI/3-215   AC A0A030QXD0.1
#=GS V4WSD3_PSEAI/3-215       AC V4WSD3.1
#=GS U8Z0X2_PSEAI/12-223      AC U8Z0X2.1
#=GS A0A030ZEY2_PSEAI/3-215   AC A0A030ZEY2.1
#=GS A0A037WCS5_PSEAI/1-135   AC A0A037WCS5.1
#=GS U9AAY0_PSEAI/12-223      AC U9AAY0.1
#=GS K1DX60_PSEAI/3-215       AC K1DX60.1
X7CT42_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
T2DYQ7_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
U9NUI0_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U9LHY0_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9Q958_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031AZX9_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U8IKD4_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8M7C8_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
X5EAE0_PSEAI/10-221                 .q-INIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVAALISSISSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGVAITLAYWAT-v.......
U8SK27_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9IUR8_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EITALISSVSSNLNTIKSRHGANYLNLLKRSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQLQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U8L8Q5_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
Q1W535_PSEAI/17-228                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDFGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
V5T463_PSEAI/11-222                 .q-INLYQNPGQSISGLYKGLANQCSPGLPFPEVQLVEAWDIPLVLHPEFVPDGDVSKVDKEYGTILAAESAQIILLQLQMAQDRVKACG-EITALISSVSSNLNIIKSRHGANYLNLLKKSPNRYPTSVGVEVKSDGSPNQDSGIEVSYGASLARLTQSQVQSMNLPASLKQLLSQGVGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
X6XGB3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
Z2DK82_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8Z7K6_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
V4MMP9_PSEAI/1-150                  ..---------------------------------------------------------------MLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031E359_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLKLHPDFVPGGDINAVNQQYVTALAQETSNILLLGFQMSQNKDVVCD-DLVPLIQSTRANLVSVKAKYGAGLLGVLGKSTNILPNSVSIVPGTGGGATDSSGLLVGYGVNLGSLTAAQLSAMNLPQSIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
X6ZC60_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9LQK2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVTYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8BVW2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A030SZ13_PSEAI/12-223             .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U8BAY2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9GR97_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8LJ62_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A037W990_PSEAI/3-73               ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSG------------------------------------------------------------------------------------------------------------------------------------------------------acrdkgei
V8GNR8_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
Q9I1P7_PSEAE/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
#=GR Q9I1P7_PSEAE/3-215       SS    ..---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT........
X6XZK3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGYISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVTYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8MUI4_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A030WDH7_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9AEP2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGSGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8JB02_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U8AXA3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031ANI5_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031D9Z8_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U8JKQ8_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
W0WEM5_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8NBH9_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A030VBQ6_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9A946_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U9I5V7_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031B5Y5_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9IXP0_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U5R5Z6_PSEAE/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
A0A030RT49_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
K1DCF7_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9GMT9_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGAWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
T2EK44_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
U8VGY8_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9RQ52_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
H3SY54_PSEAE/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
Q7WY05_PSEAI/10-221                 .q-INIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVTALISSVSSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQAMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIATGIRYTTGVAITLAYWAT-v.......
U9GQ16_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U8H8N6_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
K1CIS2_PSEAI/10-221                 .q-INIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVTALISSVSSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQAMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIATGIRYTTGVAITLAYWAT-v.......
U8MJH0_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLKLHPDFVPGGDINAVNQQYVTALAQETSNILLLGFQMSQNKDVVCD-DLVPLIQSTRANLVSVKAKYGAGLLGVLGKSTNILPNSVSIVPGTGGGATDSSGLLVGYGVNLGSLTAAQLSAMNLPQSIKLLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
A0A030XV28_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
U9Q8Q3_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
V4MJU9_PSEAI/3-73                   ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSG------------------------------------------------------------------------------------------------------------------------------------------------------acrdkgei
A0A030VGI4_PSEAI/10-220             dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U9FPA0_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A037WFL9_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
Q02GI4_PSEAB/10-221                 .q-INIYQNPGQSISGLYKGLANQCSPGQPFPEVQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EVTALISSVSSNLNTIKSRHGANYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGASLGRLTQSQLQAMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIATGIRYTTGVAITLAYWAT-v.......
X6YAM9_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8XIT8_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
N2D7E2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
X7BCH7_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLKLHPDFVPGGDINAVNQQYVTALAQETSNILLLGFQMSQNKDVVCD-DLVPLIQSTRANLVSVKAKYGAGLLGVLGKSTNILPNSVSIVPGTGGGATDSSGLLVGYGVNLGSLTAAQLSAMNLPQSIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U8EP79_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVTYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031DF48_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGAWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
K1CSZ3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8XXB9_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
X7ADV3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8ALJ2_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFAPSGDVNAVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGTLTAAQLSAMNLPQNIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
U8TRA0_PSEAI/10-220                 dq--NIYVAPGASLTTLYKGLYNICTPGAVFPEAETTEAWDIPLRLHPDFVPDGDVNSVNQQYVTALAQETSNILLLGFQMSQNKDVVCG-DLVPLIQSTRANLVSVKAKYGAGLLGVLGQTTNILPNSVSITPGTGGGATDSSGLLVGYGVNLGSLTAAQLLAMNLPQSIKSLITPGVGLHLGAVNFSAVFNQIRDGMRYVTGMALTLAYHA--l.......
K0YLT3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
U5RIU9_PSEAE/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
U8JF78_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAQLVEAWDIPLVLHPEFVPNGDVSKIDKEYGTILAAESAQVILLQLQMAQDKAKACG-EITALISSVSSNLNTIKSRHGANYLNLLKRSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQLQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U9KMB8_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8GXH6_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
U8YJA0_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
X7B0K4_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
K1CFE2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
J6MCA8_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9ERX2_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
W0Z129_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A031EET6_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8MVS0_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
A0A031DTF7_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVSFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
H3TNK3_PSEAE/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI........
A0A030QXD0_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
V4WSD3_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U8Z0X2_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
A0A030ZEY2_PSEAI/3-215              ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLKLHPEFVPGGDISKADQQYSTLLAQELANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSLNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGAWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
A0A037WCS5_PSEAI/1-135              ..------------------------------------------------------------------------------MVNEKERVCNGEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGLSPDASGGISQESGLLVSYGVNLRTLAPGTWQAMTLPEDIKTLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
U9AAY0_PSEAI/12-223                 .q-INLYQNPGQSISGLYKGLANQCSPGQPFPEAELVEAWDIPLVLHPEFVPNGDASQLDKEYGTILAAESAQIILLQLQMAQDRAKACG-EITALISSISSNLNTVKSRHGASYLNLLKQSPNRYPTSVGVEIMSGGSPNQDSGIEVSYGANLARLTQSQLQSMNLPASLKQLLTQGIGVKLSQPEYWPAYNNIAAGIRYTTGMAITLAYWAT-v.......
K1DX60_PSEAI/3-215                  ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRMVNEKERVCNVEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTWQAMTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
#=GC SS_cons                        ..---TTT-HHHHHHHHHHHHHHHH-TTS---HHHHHHHHHHHHHH-GGGSGGG-GGG--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHTTHHHHHHHHHHHHHHHHHHHGTTGGGGGTSSS-SSTT-EEE---TTSS-STT-BEEETTTEETTT--HHHHHHS---HHHHHHHGGGTT-BTTSTTHHHHHHHHHHH--HHHHHHHHHHHHHHT........
#=GC seq_cons                       ..EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPL+LHPEFVPGGDISKADQQYSTlLAQElANGVTIGFRMVNEKERVCNsEILPLLTSMAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGlSsDASGGISQESGLLVSYGVNLRTLsPGsWQAMTLPEDIKsLVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVALLLAYFAAI........
//
DBGET integrated database retrieval system