GenomeNet

Database: Pfam
Entry: DUF3785
LinkDB: DUF3785
Original site: DUF3785 
#=GF ID   DUF3785
#=GF AC   PF12653.5
#=GF DE   Protein of unknown function (DUF3785)
#=GF AU   Bateman A
#=GF SE   Jackhmmer:Q181X2
#=GF GA   27.00 27.00;
#=GF TC   158.30 158.10;
#=GF NC   22.40 20.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024210;
#=GF CC   This family of proteins is functionally uncharacterised.This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 140 amino acids in length. These proteins
#=GF CC   share two CXXC motifs suggesting these are zinc binding
#=GF CC   proteins. This protein is found in clostridia in an operon with
#=GF CC   three signalling proteins, suggesting this protein may be a
#=GF CC   DNA-binding transcription regulator downstream of an as yet
#=GF CC   unknown signalling pathway (Bateman A pers obs).
#=GF SQ   14
#=GS Q8XK35_CLOPE/2-134      AC Q8XK35.1
#=GS G7MAR6_9CLOT/3-136      AC G7MAR6.1
#=GS Q181X2_PEPD6/4-139      AC Q181X2.1
#=GS K6TT62_9CLOT/3-136      AC K6TT62.1
#=GS U5MXI4_CLOSA/3-136      AC U5MXI4.1
#=GS R5XF76_9CLOT/2-137      AC R5XF76.1
#=GS A0A0M3DLQ3_9CLOT/4-139  AC A0A0M3DLQ3.1
#=GS M1MN48_9CLOT/3-136      AC M1MN48.1
#=GS R6FZ21_9CLOT/3-138      AC R6FZ21.1
#=GS A0A0A7FUK8_9CLOT/3-138  AC A0A0A7FUK8.1
#=GS A0A0A1S3S7_CLOSO/4-139  AC A0A0A1S3S7.1
#=GS C4ICU6_CLOBU/3-136      AC C4ICU6.1
#=GS A6M318_CLOB8/3-136      AC A6M318.1
#=GS B2TR01_CLOBB/3-139      AC B2TR01.1
Q8XK35_CLOPE/2-134                 .FSFTFDEKEYTLSEDKLLYFFNED--...-VEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
G7MAR6_9CLOT/3-136                 .YKFSHNGKEYVLTKENCDGIFFDDEA...TVSGLSMDIILDALNEGEEVNFSNEYYMGKC-SC-NSQEEVNKSYRYLEYHFFIYTKNNQYVINTIGNEYKHTSFNQLFGFGKVDDSYIVSVTVCPNCGEYSISVEQCTV.
Q181X2_PEPD6/4-139                 .YKFIYDDKEYLLKEENCSALINDEEN...PVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
K6TT62_9CLOT/3-136                 .YKFTHDNKEYILTKENCDGIFFEDEN...EVTGLSIDMILDALNEGDEVSFSNEYYADKC-SC-NTQEQINKSYRYFEYHFYSYTKNNEYIINTISNEYKNTSFNKLFGLGKIDDSYIVSVTVCPNCGIYSVYVDQCTV.
U5MXI4_CLOSA/3-136                 .YTFIHENKEYVLSNDNCEGLFFEDEN...EITGLSFDIILEALNNSNDVNFSNEYYVGKC-QC-GEQEKINKSYRYLEYHFYIYTKNNTYVINTISKEYENTSFNKLFNLGKVDDSYIINVTVCPICGLYAIEVSQCTV.
R5XF76_9CLOT/2-137                 l-KFVYDEKEYVLEKDKNVCFLNDEEK...PVEGISLDDILNMIDNLEEIDFDTQYYKEACVECLDGVKEKQKFFAFLEYHFYIYTKDQKFIISDIQKEYEGQSFNKLLRANKVDDSYIVSLIICKNCGDTLIQIENCVV.
A0A0M3DLQ3_9CLOT/4-139             .YKFKFREKEYELNENSCSGLINDEEK...PVSNIDLDKVLRLLNQDENIDFDLEYYQEACPECLAGVKEKQKFFGFLEYHFYVFSKDGKYVISDIDKEYEGLSFNKLSRAGKVDDSYIVSIIICEHCGDYIVQIENCIV.
M1MN48_9CLOT/3-136                 .YKFAYDNKDYLLTNENCEGLFFEDDN...EIVGLSLDLILNALNEGEDVAFSNEYYSGKC-SC-NTQDEVNKSYRYLEYHFYIYTKNKEYVINTIENEYKATSFNKLFNAGKIDDSYIVIVTACPNCGVYSISVEQCTV.
R6FZ21_9CLOT/3-138                 .YKFTFEGREYKLNEENLDYFVNDEEN...PIKNINLDKVLEIMANSDEVDFAKEYFDMPCGECKEGVSEKKKFFAFLGYNFYIYTKNGEFVISSIDKEYEGLSFNRLQKAGKVDNSYIVLVNVCKHCGSYSVEIEEFE-i
A0A0A7FUK8_9CLOT/3-138             .YIFKYEDKEIKLSKDNLIEVINDEEM...PIEDINIETIIKLLNEGEDVKFEKAYYSTPCEKCDSNFKEKRNISEYLEYYFYVYTKDNKFVISDISKEYENLTYNRLELEGKVDNSYIVTVIVCANCNEYLVQIEEIEV.
A0A0A1S3S7_CLOSO/4-139             .YKFKFKDKEYELNKSNCSGVINDEDK...PVTNIDLDEVLRLLNETQDVDFDLEYYQEACPECLSGVKEKQKFFGFLEYHFYLFTKNGEYVISDISKDYEGLSFNKLSRAGKVDDSYIVSIIMCESCSDYIVQIENCIV.
C4ICU6_CLOBU/3-136                 .YKFTYNSKEYTLSSKNCEGIFFENYE...EIKGLSLETILEALNSNEEVSFSKEYYAGKC-TC-DLQEKIEKYYCYLEYHFYIYTKEQEYVINTICKEYEDTSFNKLFRAGKIDKSHIVNITVCPECGTYSIEIEDCEV.
A6M318_CLOB8/3-136                 .YKFVYENKEYVLTENNCDGIFFEGEN...EITGLSLDIILNALNEGEEISFSTEYYGDKC-TC-NTQEQINKSYRYLEYHFYIYTKDNEYVINTICNEYKNTSFNKLFGLGKIDDSYIVSVTVCPNCGIYSIYIDQCTV.
B2TR01_CLOBB/3-139                 .YKFVYDDKEYLLSKENCDGIFLDSDNeseEIEGLSLDIVLNALSEGEVINFSKEFYGDKC-YC-DSQEKINKSYAYLEYHFYIYTKENKYVINTLCKEYENTSYNKLARAGKIDNSYIVSVVVCPCCGNYTIEIEQCTV.
#=GC seq_cons                      .YKFsa-sKEYhLoc-NCsGlh.--Ep....lpGlSlDhILchLNpuE-VsFupEYYsstC.pC.ss.cEhpK.ataLEYHFYIYTKsscYVIssIsKEYEshSFNKLhpsGKVDcSYIVoVsVC.sCGsYslpIEpCpV.
//
DBGET integrated database retrieval system