GenomeNet

Database: Pfam
Entry: DUF3785
LinkDB: DUF3785
Original site: DUF3785 
#=GF ID   DUF3785
#=GF AC   PF12653.2
#=GF DE   Protein of unknown function (DUF3785)
#=GF AU   Bateman A
#=GF SE   Jackhmmer:Q181X2
#=GF GA   27.00 27.00;
#=GF TC   186.90 186.80;
#=GF NC   20.60 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024210;
#=GF CC   This family of proteins is functionally uncharacterised.This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 140 amino acids in length. These proteins
#=GF CC   share two CXXC motifs suggesting these are zinc binding
#=GF CC   proteins. This protein is found in clostridia in an operon with
#=GF CC   three signalling proteins, suggesting this protein may be a
#=GF CC   DNA-binding transcription regulator downstream of an as yet
#=GF CC   unknown signalling pathway (Bateman A pers obs).
#=GF SQ   29
#=GS B1R0D7_CLOBU/1-136  AC B1R0D7.1
#=GS C1I8P7_9CLOT/1-138  AC C1I8P7.1
#=GS Q181X2_CLOD6/1-139  AC Q181X2.1
#=GS Q0TQ36_CLOP1/1-134  AC Q0TQ36.1
#=GS B2TR01_CLOBB/1-139  AC B2TR01.1
#=GS B0ADE0_9FIRM/1-137  AC B0ADE0.1
#=GS G6BK24_CLODI/1-139  AC G6BK24.1
#=GS H7CWU9_CLOPF/1-134  AC H7CWU9.1
#=GS B1RS31_CLOPF/1-134  AC B1RS31.1
#=GS Q0SSQ0_CLOPS/1-134  AC Q0SSQ0.1
#=GS B1BGD7_CLOPF/1-134  AC B1BGD7.1
#=GS C9YNW1_CLODR/1-139  AC C9YNW1.1
#=GS B2V019_CLOBA/1-139  AC B2V019.1
#=GS B1R508_CLOPF/1-134  AC B1R508.1
#=GS C5UW43_CLOBO/1-139  AC C5UW43.1
#=GS B1RFY3_CLOPF/1-134  AC B1RFY3.1
#=GS C9XLG5_CLODC/1-139  AC C9XLG5.1
#=GS D5RXR8_CLODI/1-139  AC D5RXR8.1
#=GS B1BV08_CLOPF/1-134  AC B1BV08.1
#=GS G6BCP1_CLODI/1-139  AC G6BCP1.1
#=GS G6BZC8_CLODI/1-139  AC G6BZC8.1
#=GS Q8XK35_CLOPE/1-134  AC Q8XK35.1
#=GS C4ICU6_CLOBU/1-136  AC C4ICU6.1
#=GS B6FWA5_9FIRM/1-138  AC B6FWA5.1
#=GS B1V4Q8_CLOPF/1-134  AC B1V4Q8.1
#=GS D5Q2S0_CLODI/1-139  AC D5Q2S0.1
#=GS H1CRG3_CLOPF/1-134  AC H1CRG3.1
#=GS G7MAR6_9CLOT/1-136  AC G7MAR6.1
#=GS A6M318_CLOB8/1-136  AC A6M318.1
B1R0D7_CLOBU/1-136             ...MEYKFTYNSKEYTLSSKNCEGIFFE...NYEEIKGLSLETILEALNSNEEVSFSKEYYAGKCT-C-DLQEKIEKYYCYLEYHFYIYTKEQEYVINTICKEYEDTSFNKLFRAGKIDKSHIVNITVCPECGTYSIEIEDCEV.
C1I8P7_9CLOT/1-138             ...MEYKFKFDEKEYILGEDNLEYFAND...ENEELEGIDGEKILELLSNSDEVEFQNAYYESCCSNCKAGKEEKKKVFDFLEFYFYAYGKNNKFITSSIDNEYDKKSFTRLNRERIVDKSYLVTVIVCKNCGTYSIEIEEFE-l
Q181X2_CLOD6/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
Q0TQ36_CLOP1/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
B2TR01_CLOBB/1-139             ...MEYKFVYDDKEYLLSKENCDGIFLDsdnESEEIEGLSLDIVLNALSEGEVINFSKEFYGDKCY-C-DSQEKINKSYAYLEYHFYIYTKENKYVINTLCKEYENTSYNKLARAGKIDNSYIVSVVVCPCCGNYTIEIEQCTV.
B0ADE0_9FIRM/1-137             ..m--LKFVYDEKEYVLEKDKNVCFLND...EEKPVEGISLDDILNMIDNLEEIDFDTQYYKEACVECLDGVKEKQKFFAFLEYHFYIYTKDQKFIISDIQKEYEGQSFNKLLRANKVDDSYIVSLIICKNCGDTLIQIENCVV.
G6BK24_CLODI/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSRDGEYVISNISIDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
H7CWU9_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
B1RS31_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGISFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
Q0SSQ0_CLOPS/1-134             ..m--FSFTFDEKEYTLSEEKLLYFFNE...---DVEGFDIDKLFEILNSSEGISFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYSKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
B1BGD7_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVKGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
C9YNW1_CLODR/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
B2V019_CLOBA/1-139             ...MEYKFVYDDKEYLLNKENCDGIFLDsddESEEIEELSLDIILNALCEGDNVNFSKEFYGDKCY-C-DSQEKINKSYAYLEYHFYIYTKENKYVINTLCKEYKNTSYNKLARAGKIDNSYIVSIVVCPCCGNYTIEIEQCTV.
B1R508_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
C5UW43_CLOBO/1-139             ...MEYKFVYDDKEYLLNKENCDGIFLDsddESEEIEELSLDIILNALCEGDNVNFSKEFYGDKCY-C-DSQEKINKSYAYLEYHFYIYTKENKYVINTLCKEYKNTSYNKLARAGKIDNSYIVSIVVCPCCGNYTIEIEQCTV.
B1RFY3_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGISFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
C9XLG5_CLODC/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
D5RXR8_CLODI/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYVFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIIQIENCIV.
B1BV08_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
G6BCP1_CLODI/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSRDGEYVISNISIDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
G6BZC8_CLODI/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYIFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIVQIENCIV.
Q8XK35_CLOPE/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
C4ICU6_CLOBU/1-136             ...MEYKFTYNSKEYTLSSKNCEGIFFE...NYEEIKGLSLETILEALNSNEEVSFSKEYYAGKCT-C-DLQEKIEKYYCYLEYHFYIYTKEQEYVINTICKEYEDTSFNKLFRAGKIDKSHIVNITVCPECGTYSIEIEDCEV.
B6FWA5_9FIRM/1-138             ...MEYKFNCDGREYVLDSEKCSEFFND...EEKEVSGFSVEEAMRLVSEAEDVEFAKEYYQEACPDCMAGVKEKQKFFAFYEYHFYIFTKDGKYVISDIDKEYKGNSFNKLSRAGEVDDSYIVSIIVCAECGEYIVQVENCEV.
B1V4Q8_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
D5Q2S0_CLODI/1-139             msl--YKFIYDDKEYLLKEENCSALIND...EENPVQGVSISKIIDILNEAEEVDFDVEYYQEACPLCLEGVKEKKKFFPFLEYHFYVFSKDGEYVISNISVDYKGLSFNKLSRANKVDNSYIVSVIICENCQDYIIQIENCIV.
H1CRG3_CLOPF/1-134             ..m--FSFTFDEKEYTLSEDKLLYFFNE...---DVEGFDIDKLFEILNSSEGVSFGKAYYDGPCEECKFGLEEKKKSFPFLEFNMFIYAKNGKFVISNIEKAYEGLTYNKLLRDKKVDKSYLVNINVCKNCGNFAVEVEELEV.
G7MAR6_9CLOT/1-136             ...MEYKFSHNGKEYVLTKENCDGIFFD...DEATVSGLSMDIILDALNEGEEVNFSNEYYMGKCS-C-NSQEEVNKSYRYLEYHFFIYTKNNQYVINTIGNEYKHTSFNQLFGFGKVDDSYIVSVTVCPNCGEYSISVEQCTV.
A6M318_CLOB8/1-136             ...MDYKFVYENKEYVLTENNCDGIFFE...GENEITGLSLDIILNALNEGEEISFSTEYYGDKCT-C-NTQEQINKSYRYLEYHFYIYTKDNEYVINTICNEYKNTSFNKLFGLGKIDDSYIVSVTVCPNCGIYSIYIDQCTV.
#=GC seq_cons                  ..h..aKFsaD-KEYhLsE-ph.hhFN-...t.t-VcGhsI-Klh-ILNpuEtVsFuptYYpssC..ChtGlEEKKK.FPFLEaaFaIYoKsGcaVISNIpK-YcGLSaNKLhRspKVDcSYlVslsVCcNCGsasVplEphpV.
//
DBGET integrated database retrieval system