GenomeNet

Database: Pfam
Entry: DUF3824
LinkDB: DUF3824
Original site: DUF3824 
#=GF ID   DUF3824
#=GF AC   PF12868.6
#=GF DE   Domain of unknwon function (DUF3824)
#=GF AU   Coggill P
#=GF SE   manual
#=GF GA   22.70 7.90;
#=GF TC   22.70 7.90;
#=GF NC   22.50 7.80;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024436;
#=GF CC   This is a repeating domain found in fungal proteins. It is
#=GF CC   proline-rich, and the function is not known.
#=GF SQ   417
#=GS A0A139HNL0_9PEZI/429-506    AC A0A139HNL0.1
#=GS A0A0S6X889_9FUNG/464-554    AC A0A0S6X889.1
#=GS A0A084G042_9PEZI/617-801    AC A0A084G042.1
#=GS D4AU90_ARTBC/558-692        AC D4AU90.1
#=GS A0A0U5FQN0_9EURO/517-650    AC A0A0U5FQN0.1
#=GS A0A0B7N6U1_9FUNG/214-285    AC A0A0B7N6U1.1
#=GS A0A0G4LM95_9PEZI/435-530    AC A0A0G4LM95.1
#=GS A0A0C9MGZ4_9FUNG/114-150    AC A0A0C9MGZ4.1
#=GS A0A0D2BWC7_9EURO/479-597    AC A0A0D2BWC7.1
#=GS A0A093Y5R9_9PEZI/922-999    AC A0A093Y5R9.1
#=GS A0A0G2EJI4_9EURO/389-457    AC A0A0G2EJI4.1
#=GS F9XE98_ZYMTI/636-827        AC F9XE98.1
#=GS F0U958_AJEC8/417-526        AC F0U958.1
#=GS A0A0F0I0U5_ASPPU/306-380    AC A0A0F0I0U5.1
#=GS A0A0D1Z4Z7_9EURO/364-449    AC A0A0D1Z4Z7.1
#=GS G9PCA8_HYPAI/432-520        AC G9PCA8.1
#=GS J3KI03_COCIM/349-390        AC J3KI03.2
#=GS A0A094DD18_9PEZI/423-500    AC A0A094DD18.1
#=GS A0A0D9MW47_ASPFA/304-375    AC A0A0D9MW47.1
#=GS W9Y839_9EURO/483-592        AC W9Y839.1
#=GS G2WRI8_VERDV/510-640        AC G2WRI8.1
#=GS B5YNX9_THAPS/110-231        AC B5YNX9.1
#=GS A0A010Q3X1_9PEZI/517-646    AC A0A010Q3X1.1
#=GS W6PSX9_PENRF/493-646        AC W6PSX9.1
#=GS C8V000_EMENI/27-137         AC C8V000.1
#=GS A0A100ITS5_ASPNG/555-694    AC A0A100ITS5.1
#=GS B5YNX8_THAPS/64-186         AC B5YNX8.1
#=GS A0A167RTY9_9PEZI/750-901    AC A0A167RTY9.1
#=GS A0A139HNL0_9PEZI/635-793    AC A0A139HNL0.1
#=GS A0A0G2JAW1_9EURO/566-703    AC A0A0G2JAW1.1
#=GS M2ZPK6_PSEFD/581-658        AC M2ZPK6.1
#=GS A0A0G2JAW1_9EURO/416-524    AC A0A0G2JAW1.1
#=GS A0A167AKY9_9HYPO/569-702    AC A0A167AKY9.1
#=GS S2JHI7_MUCC1/121-203        AC S2JHI7.1
#=GS A0A135SUF1_9PEZI/645-696    AC A0A135SUF1.1
#=GS A0A0D2BFS9_9EURO/644-799    AC A0A0D2BFS9.1
#=GS G3XV77_ASPNA/556-686        AC G3XV77.1
#=GS W9Y839_9EURO/107-205        AC W9Y839.1
#=GS A0A0S6X889_9FUNG/574-741    AC A0A0S6X889.1
#=GS A0A0D1Z4Z7_9EURO/625-782    AC A0A0D1Z4Z7.1
#=GS A0A0D1Y3N1_9EURO/654-803    AC A0A0D1Y3N1.1
#=GS K2S5L1_MACPH/454-539        AC K2S5L1.1
#=GS A1CSM6_ASPCL/393-490        AC A1CSM6.1
#=GS S9VEY3_9TRYP/92-148         AC S9VEY3.1
#=GS R0K5Y5_SETT2/571-717        AC R0K5Y5.1
#=GS Q2TZD9_ASPOR/411-515        AC Q2TZD9.1
#=GS E3QDR6_COLGM/644-698        AC E3QDR6.1
#=GS A0A100ITS5_ASPNG/302-372    AC A0A100ITS5.1
#=GS A0A0J8RJW6_COCIT/347-391    AC A0A0J8RJW6.1
#=GS A0A0K8LFQ8_9EURO/377-478    AC A0A0K8LFQ8.1
#=GS F2SD33_TRIRC/551-673        AC F2SD33.2
#=GS A0A168JGH6_CORDF/451-561    AC A0A168JGH6.1
#=GS J3KI03_COCIM/510-672        AC J3KI03.2
#=GS N4VHF5_COLOR/631-705        AC N4VHF5.1
#=GS A0A0D2I679_9EURO/641-794    AC A0A0D2I679.1
#=GS E3QDR6_COLGM/512-642        AC E3QDR6.1
#=GS A0A135SUF1_9PEZI/515-643    AC A0A135SUF1.1
#=GS U4LPE7_PYROM/313-369        AC U4LPE7.1
#=GS A0A0D2DS24_9EURO/497-604    AC A0A0D2DS24.1
#=GS A0A0J6Y2F6_COCIT/346-390    AC A0A0J6Y2F6.1
#=GS A0A150VE66_9PEZI/539-622    AC A0A150VE66.1
#=GS A0A150VE66_9PEZI/640-781    AC A0A150VE66.1
#=GS W3XH82_9PEZI/344-396        AC W3XH82.1
#=GS Q0C9I2_ASPTN/537-583        AC Q0C9I2.1
#=GS A0A177D9J9_ALTAL/595-748    AC A0A177D9J9.1
#=GS A0A0A1TGS9_9HYPO/569-721    AC A0A0A1TGS9.1
#=GS G7XHH0_ASPKW/403-503        AC G7XHH0.1
#=GS A0A0C9MGZ4_9FUNG/419-467    AC A0A0C9MGZ4.1
#=GS A0A0D2K9Q9_9EURO/364-452    AC A0A0D2K9Q9.1
#=GS A0A010Q3X1_9PEZI/698-843    AC A0A010Q3X1.1
#=GS A0A0F0I0U5_ASPPU/563-702    AC A0A0F0I0U5.1
#=GS G7XHH0_ASPKW/302-375        AC G7XHH0.1
#=GS A0A139HNL3_9PEZI/658-816    AC A0A139HNL3.1
#=GS G0SEH0_CHATD/691-755        AC G0SEH0.1
#=GS A0A0F0I0U5_ASPPU/414-516    AC A0A0F0I0U5.1
#=GS M2TBE1_COCSN/345-430        AC M2TBE1.1
#=GS U1HT54_ENDPU/646-826        AC U1HT54.1
#=GS J3KI03_COCIM/382-492        AC J3KI03.2
#=GS A0A0S8B9L4_9CHLR/1-74       AC A0A0S8B9L4.1
#=GS H1UXZ2_COLHI/467-515        AC H1UXZ2.1
#=GS A0A0C9MGZ4_9FUNG/487-519    AC A0A0C9MGZ4.1
#=GS A0A0G3A5Q5_9ACTN/4-80       AC A0A0G3A5Q5.1
#=GS A0A094GA47_9PEZI/423-500    AC A0A094GA47.1
#=GS A0A0F4GXD0_9PEZI/617-791    AC A0A0F4GXD0.1
#=GS G0SEH0_CHATD/485-525        AC G0SEH0.1
#=GS A0A168JB54_MUCCL/450-482    AC A0A168JB54.1
#=GS C5G976_AJEDR/340-451        AC C5G976.2
#=GS A0A0D2BFS9_9EURO/495-603    AC A0A0D2BFS9.1
#=GS A0A0D2BWC7_9EURO/364-449    AC A0A0D2BWC7.1
#=GS G2XR77_BOTF4/694-852        AC G2XR77.1
#=GS A0A165A7V2_9PEZI/202-299    AC A0A165A7V2.1
#=GS W9XB18_9EURO/369-456        AC W9XB18.1
#=GS G2WRI8_VERDV/647-805        AC G2WRI8.1
#=GS A0A163HMV4_DIDRA/361-431    AC A0A163HMV4.1
#=GS A0A094DD18_9PEZI/514-649    AC A0A094DD18.1
#=GS A0A139HNL0_9PEZI/536-622    AC A0A139HNL0.1
#=GS A0A168JB54_MUCCL/784-843    AC A0A168JB54.1
#=GS B8M1D8_TALSN/257-313        AC B8M1D8.1
#=GS A0A0A2V7C7_BEABA/446-520    AC A0A0A2V7C7.1
#=GS A0A0D1ZLV8_9EURO/661-832    AC A0A0D1ZLV8.1
#=GS A0A0D2APJ8_9EURO/651-803    AC A0A0D2APJ8.1
#=GS K2S5L1_MACPH/347-423        AC K2S5L1.1
#=GS A0A0D2CID4_9EURO/644-804    AC A0A0D2CID4.1
#=GS A0A0A2K6U1_PENEN/544-693    AC A0A0A2K6U1.1
#=GS A0A136J136_9PEZI/386-450    AC A0A136J136.1
#=GS A0A0L1J2N0_ASPNO/304-377    AC A0A0L1J2N0.1
#=GS A7EI77_SCLS1/520-622        AC A7EI77.1
#=GS C4JEK8_UNCRE/273-315        AC C4JEK8.1
#=GS A0A0U5FQN0_9EURO/371-476    AC A0A0U5FQN0.1
#=GS A0A094GA47_9PEZI/514-649    AC A0A094GA47.1
#=GS A0A166MYR9_9PEZI/691-854    AC A0A166MYR9.1
#=GS E5R2F7_ARTGP/550-689        AC E5R2F7.1
#=GS U4LPE7_PYROM/365-409        AC U4LPE7.1
#=GS E9DDF0_COCPS/382-494        AC E9DDF0.1
#=GS A0A0M8P4S7_9EURO/502-653    AC A0A0M8P4S7.1
#=GS A0A084G042_9PEZI/487-604    AC A0A084G042.1
#=GS A0A0D1XL11_9PEZI/419-472    AC A0A0D1XL11.1
#=GS A0A135SUF1_9PEZI/697-852    AC A0A135SUF1.1
#=GS S3CWZ7_OPHP1/711-838        AC S3CWZ7.1
#=GS A0A063BU25_9HYPO/577-740    AC A0A063BU25.1
#=GS S7ZET0_PENO1/503-650        AC S7ZET0.1
#=GS R8BUE6_TOGMI/691-750        AC R8BUE6.1
#=GS J3KI03_COCIM/287-350        AC J3KI03.2
#=GS C6HTC0_AJECH/453-591        AC C6HTC0.1
#=GS A0A074W448_9PEZI/322-398    AC A0A074W448.1
#=GS A0A139ISU8_9PEZI/431-506    AC A0A139ISU8.1
#=GS B8NBW3_ASPFN/412-514        AC B8NBW3.1
#=GS A0A074WG27_9PEZI/559-713    AC A0A074WG27.1
#=GS A0A194X7G0_9HELO/634-780    AC A0A194X7G0.1
#=GS W6XRN4_COCCA/587-743        AC W6XRN4.1
#=GS A0A093YVZ9_9PEZI/8-61       AC A0A093YVZ9.1
#=GS A0A0S7DWY3_9EURO/377-477    AC A0A0S7DWY3.1
#=GS A0A150VE66_9PEZI/433-518    AC A0A150VE66.1
#=GS M7SU52_EUTLA/536-613        AC M7SU52.1
#=GS E9DDF0_COCPS/348-390        AC E9DDF0.1
#=GS G3JMF7_CORMM/253-331        AC G3JMF7.1
#=GS H1UXZ2_COLHI/641-843        AC H1UXZ2.1
#=GS S3CWZ7_OPHP1/455-495        AC S3CWZ7.1
#=GS A0A0G2JAW1_9EURO/312-380    AC A0A0G2JAW1.1
#=GS A0A0A1TGS9_9HYPO/445-522    AC A0A0A1TGS9.1
#=GS A0A0J8QS49_COCIT/28-142     AC A0A0J8QS49.1
#=GS A0A0D2CBM0_9EURO/653-807    AC A0A0D2CBM0.1
#=GS N1PM89_DOTSN/650-820        AC N1PM89.1
#=GS A0A0D2DIH2_9EURO/472-589    AC A0A0D2DIH2.1
#=GS A0A161Y9K7_9PEZI/696-763    AC A0A161Y9K7.1
#=GS W9WD84_9EURO/496-601        AC W9WD84.1
#=GS A0A168JB54_MUCCL/840-902    AC A0A168JB54.1
#=GS A0A178AVN6_9PLEO/458-640    AC A0A178AVN6.1
#=GS C8V000_EMENI/175-307        AC C8V000.1
#=GS A0A101ME91_9EURO/1-78       AC A0A101ME91.1
#=GS A0A161Y9K7_9PEZI/566-695    AC A0A161Y9K7.1
#=GS A0A074YPM7_9PEZI/306-384    AC A0A074YPM7.1
#=GS A0A0D2FDQ0_9EURO/497-604    AC A0A0D2FDQ0.1
#=GS A0A0F8UEJ4_9EURO/530-673    AC A0A0F8UEJ4.1
#=GS S3CWZ7_OPHP1/661-722        AC S3CWZ7.1
#=GS W3XH82_9PEZI/247-324        AC W3XH82.1
#=GS A0A178E8Z5_9PLEO/580-633    AC A0A178E8Z5.1
#=GS E9E4W9_METAQ/460-561        AC E9E4W9.1
#=GS A0A0C9MGZ4_9FUNG/278-317    AC A0A0C9MGZ4.1
#=GS A0A0D1XL11_9PEZI/537-689    AC A0A0D1XL11.1
#=GS M1W061_CLAP2/575-717        AC M1W061.1
#=GS F9XE98_ZYMTI/399-476        AC F9XE98.1
#=GS G0SEH0_CHATD/522-587        AC G0SEH0.1
#=GS G4N0D9_MAGO7/696-761        AC G4N0D9.1
#=GS A0A0D2CBM0_9EURO/501-610    AC A0A0D2CBM0.1
#=GS A0A0U1M4K8_9EURO/488-632    AC A0A0U1M4K8.1
#=GS N4VHF5_COLOR/501-607        AC N4VHF5.1
#=GS A0A0G2EJI4_9EURO/637-779    AC A0A0G2EJI4.1
#=GS A0A0L1J2N0_ASPNO/527-588    AC A0A0L1J2N0.1
#=GS Q0UZC8_PHANO/537-676        AC Q0UZC8.2
#=GS A0A0D2DS24_9EURO/644-801    AC A0A0D2DS24.1
#=GS A0A0B7N6U1_9FUNG/281-349    AC A0A0B7N6U1.1
#=GS U4LPE7_PYROM/462-545        AC U4LPE7.1
#=GS M1W061_CLAP2/430-517        AC M1W061.1
#=GS A0A094JE74_9PEZI/406-494    AC A0A094JE74.1
#=GS C4JEK8_UNCRE/306-416        AC C4JEK8.1
#=GS A0A166MYR9_9PEZI/514-645    AC A0A166MYR9.1
#=GS A0A0S7DWY3_9EURO/522-657    AC A0A0S7DWY3.1
#=GS A0A0D2DIH2_9EURO/629-789    AC A0A0D2DIH2.1
#=GS A0A0L1HW30_9PLEO/562-719    AC A0A0L1HW30.1
#=GS C1GDB7_PARBD/522-661        AC C1GDB7.2
#=GS C5G976_AJEDR/468-605        AC C5G976.2
#=GS A0A163HMV4_DIDRA/593-755    AC A0A163HMV4.1
#=GS G3JMF7_CORMM/459-600        AC G3JMF7.1
#=GS F7W3Z0_SORMK/764-824        AC F7W3Z0.1
#=GS A0A0D2K9Q9_9EURO/477-584    AC A0A0D2K9Q9.1
#=GS M7SU52_EUTLA/643-785        AC M7SU52.1
#=GS H0EK30_GLAL7/414-499        AC H0EK30.1
#=GS U4LPE7_PYROM/209-267        AC U4LPE7.1
#=GS A0A177D9J9_ALTAL/354-428    AC A0A177D9J9.1
#=GS A0A0G4PFU6_PENCA/547-696    AC A0A0G4PFU6.1
#=GS U4LPE7_PYROM/400-461        AC U4LPE7.1
#=GS R0K5Y5_SETT2/335-402        AC R0K5Y5.1
#=GS A0A0J6Y2F6_COCIT/287-350    AC A0A0J6Y2F6.1
#=GS A0A0F4YIE0_TALEM/493-600    AC A0A0F4YIE0.1
#=GS A0A0J8RJW6_COCIT/382-491    AC A0A0J8RJW6.1
#=GS Q2TZD9_ASPOR/304-373        AC Q2TZD9.1
#=GS A0A0D2CID4_9EURO/495-604    AC A0A0D2CID4.1
#=GS M3CFH9_SPHMS/662-825        AC M3CFH9.1
#=GS A2QKM3_ASPNC/301-373        AC A2QKM3.1
#=GS T0KDB4_COLGC/499-614        AC T0KDB4.1
#=GS B8M1D8_TALSN/314-354        AC B8M1D8.1
#=GS A0A0D2E8L9_9EURO/496-603    AC A0A0D2E8L9.1
#=GS C4JEK8_UNCRE/550-601        AC C4JEK8.1
#=GS A0A168JB54_MUCCL/900-942    AC A0A168JB54.1
#=GS A0A0S8B8E0_9CHLR/2-80       AC A0A0S8B8E0.1
#=GS G2QTJ0_THITE/700-864        AC G2QTJ0.1
#=GS E9DDF0_COCPS/510-672        AC E9DDF0.1
#=GS U7PSX9_SPOS1/496-646        AC U7PSX9.1
#=GS A0A084G042_9PEZI/442-486    AC A0A084G042.1
#=GS W6XRN4_COCCA/345-431        AC W6XRN4.1
#=GS A1DGB5_NEOFI/392-493        AC A1DGB5.1
#=GS S3DTS4_GLAL2/454-537        AC S3DTS4.1
#=GS A0A0D2DIH2_9EURO/370-453    AC A0A0D2DIH2.1
#=GS B6H242_PENRW/542-687        AC B6H242.1
#=GS A0A135U1E0_9PEZI/645-691    AC A0A135U1E0.1
#=GS S3DTS4_GLAL2/755-867        AC S3DTS4.1
#=GS W9Y839_9EURO/636-791        AC W9Y839.1
#=GS A0A063BU25_9HYPO/461-568    AC A0A063BU25.1
#=GS S7ZET0_PENO1/261-334        AC S7ZET0.1
#=GS A0A059J342_9EURO/567-700    AC A0A059J342.1
#=GS A0A0D1Z4Z7_9EURO/479-597    AC A0A0D1Z4Z7.1
#=GS Q0C9I2_ASPTN/296-361        AC Q0C9I2.1
#=GS B8NBW3_ASPFN/561-699        AC B8NBW3.1
#=GS A1CSM6_ASPCL/293-357        AC A1CSM6.1
#=GS E9DDF0_COCPS/287-350        AC E9DDF0.1
#=GS A0A093Y5R9_9PEZI/1015-1087  AC A0A093Y5R9.1
#=GS K9FWG0_PEND2/304-377        AC K9FWG0.1
#=GS A0A0F4GXD0_9PEZI/303-351    AC A0A0F4GXD0.1
#=GS A0A074WG27_9PEZI/325-402    AC A0A074WG27.1
#=GS B6Q8Z7_TALMQ/273-331        AC B6Q8Z7.1
#=GS C4JEK8_UNCRE/432-491        AC C4JEK8.1
#=GS A2QKM3_ASPNC/397-504        AC A2QKM3.1
#=GS C1HCJ5_PARBA/372-473        AC C1HCJ5.2
#=GS S2JHI7_MUCC1/200-279        AC S2JHI7.1
#=GS A0A066XKL1_COLSU/488-525    AC A0A066XKL1.1
#=GS S2JHI7_MUCC1/469-529        AC S2JHI7.1
#=GS U4LPE7_PYROM/261-323        AC U4LPE7.1
#=GS A0A0D2APJ8_9EURO/500-608    AC A0A0D2APJ8.1
#=GS W9XB18_9EURO/486-592        AC W9XB18.1
#=GS W9XLQ4_9EURO/630-790        AC W9XLQ4.1
#=GS M2ZPK6_PSEFD/811-967        AC M2ZPK6.1
#=GS K2S5L1_MACPH/581-741        AC K2S5L1.1
#=GS W9XLQ4_9EURO/374-457        AC W9XLQ4.1
#=GS E5AFM9_LEPMJ/591-727        AC E5AFM9.1
#=GS A0A094JE74_9PEZI/550-621    AC A0A094JE74.1
#=GS G3JMF7_CORMM/325-456        AC G3JMF7.1
#=GS A0A0D1ZLV8_9EURO/395-477    AC A0A0D1ZLV8.1
#=GS M7U351_BOTF1/694-842        AC M7U351.1
#=GS A0A0L1HW30_9PLEO/341-403    AC A0A0L1HW30.1
#=GS S2JHI7_MUCC1/359-418        AC S2JHI7.1
#=GS W9XB18_9EURO/633-819        AC W9XB18.1
#=GS A0A0F8UEJ4_9EURO/277-347    AC A0A0F8UEJ4.1
#=GS C1GDB7_PARBD/373-473        AC C1GDB7.2
#=GS A0A0B7N6U1_9FUNG/109-176    AC A0A0B7N6U1.1
#=GS W9XLQ4_9EURO/485-605        AC W9XLQ4.1
#=GS Q0UZC8_PHANO/361-435        AC Q0UZC8.2
#=GS G3XV77_ASPNA/301-373        AC G3XV77.1
#=GS W9W1E3_9EURO/534-675        AC W9W1E3.1
#=GS U7PSX9_SPOS1/670-732        AC U7PSX9.1
#=GS A0A0N0NRB6_9EURO/357-444    AC A0A0N0NRB6.1
#=GS A0A0D2E8L9_9EURO/644-800    AC A0A0D2E8L9.1
#=GS A0A0N7Z0T5_ROSNE/488-564    AC A0A0N7Z0T5.1
#=GS A0A074W448_9PEZI/552-709    AC A0A074W448.1
#=GS A0A072PTE1_9EURO/632-778    AC A0A072PTE1.1
#=GS A0A0N0NRB6_9EURO/461-591    AC A0A0N0NRB6.1
#=GS A0A136J136_9PEZI/665-772    AC A0A136J136.1
#=GS G4N0D9_MAGO7/539-644        AC G4N0D9.1
#=GS A0A080WGP9_TRIRC/489-608    AC A0A080WGP9.1
#=GS A0A0D9MW47_ASPFA/561-699    AC A0A0D9MW47.1
#=GS A0A080WQ72_TRIRC/489-609    AC A0A080WQ72.1
#=GS A0A074YPM7_9PEZI/540-696    AC A0A074YPM7.1
#=GS G2QTJ0_THITE/535-639        AC G2QTJ0.1
#=GS A0A139HNL3_9PEZI/431-506    AC A0A139HNL3.1
#=GS A0A0D2AI73_9PEZI/125-211    AC A0A0D2AI73.1
#=GS A0A0P8X2H8_9CLOT/41-109     AC A0A0P8X2H8.1
#=GS R8BUE6_TOGMI/744-875        AC R8BUE6.1
#=GS H6C6Y6_EXODN/638-795        AC H6C6Y6.1
#=GS A0A0D2BWC7_9EURO/625-785    AC A0A0D2BWC7.1
#=GS J4TVZ1_9PAST/65-121         AC J4TVZ1.1
#=GS A0A0D1YR49_9PEZI/537-688    AC A0A0D1YR49.1
#=GS A0A0C9MGZ4_9FUNG/532-599    AC A0A0C9MGZ4.1
#=GS A0A168JB54_MUCCL/191-228    AC A0A168JB54.1
#=GS A0A168JB54_MUCCL/617-665    AC A0A168JB54.1
#=GS B4R4D9_DROSI/104-194        AC B4R4D9.1
#=GS N4VHF5_COLOR/690-808        AC N4VHF5.1
#=GS T0KDB4_COLGC/626-696        AC T0KDB4.1
#=GS A0A0G4LM95_9PEZI/553-711    AC A0A0G4LM95.1
#=GS A0A136J136_9PEZI/486-567    AC A0A136J136.1
#=GS A0A074YSE8_AURPU/317-395    AC A0A074YSE8.1
#=GS B2WNY2_PYRTR/600-753        AC B2WNY2.1
#=GS E3QDR6_COLGM/691-829        AC E3QDR6.1
#=GS S2K5A6_MUCC1/218-326        AC S2K5A6.1
#=GS A7EI77_SCLS1/616-790        AC A7EI77.1
#=GS A0A0F8UEJ4_9EURO/379-488    AC A0A0F8UEJ4.1
#=GS A0A0D2DS24_9EURO/379-467    AC A0A0D2DS24.1
#=GS M2MVN7_BAUCO/433-520        AC M2MVN7.1
#=GS W3XH82_9PEZI/412-479        AC W3XH82.1
#=GS B6Q8Z7_TALMQ/499-641        AC B6Q8Z7.1
#=GS F0U958_AJEC8/562-700        AC F0U958.1
#=GS H0EK30_GLAL7/634-744        AC H0EK30.1
#=GS J4UHD6_BEAB2/446-519        AC J4UHD6.1
#=GS E3QDR6_COLGM/476-516        AC E3QDR6.1
#=GS Q0C9I2_ASPTN/595-690        AC Q0C9I2.1
#=GS W2RLM0_9EURO/664-811        AC W2RLM0.1
#=GS Q2TZD9_ASPOR/561-699        AC Q2TZD9.1
#=GS A0A100ITS5_ASPNG/401-507    AC A0A100ITS5.1
#=GS A0A080WIC1_TRIRC/550-670    AC A0A080WIC1.1
#=GS A0A068RLC2_9FUNG/147-258    AC A0A068RLC2.1
#=GS A0A0S6X889_9FUNG/363-432    AC A0A0S6X889.1
#=GS S9VEY3_9TRYP/208-326        AC S9VEY3.1
#=GS A0A0J6Y2F6_COCIT/510-672    AC A0A0J6Y2F6.1
#=GS A0A0F4GXD0_9PEZI/399-461    AC A0A0F4GXD0.1
#=GS F7W3Z0_SORMK/439-492        AC F7W3Z0.1
#=GS A0A094EQ88_9PEZI/1075-1154  AC A0A094EQ88.1
#=GS A0A0A2KDD1_PENIT/540-687    AC A0A0A2KDD1.1
#=GS A0A165A7V2_9PEZI/98-169     AC A0A165A7V2.1
#=GS A0A167RTY9_9PEZI/701-763    AC A0A167RTY9.1
#=GS G2QTJ0_THITE/500-538        AC G2QTJ0.1
#=GS W9W1E3_9EURO/364-467        AC W9W1E3.1
#=GS C4JEK8_UNCRE/210-276        AC C4JEK8.1
#=GS A0A072PTE1_9EURO/382-455    AC A0A072PTE1.1
#=GS A0A0D1WQS0_9EURO/654-804    AC A0A0D1WQS0.1
#=GS A0A0C9MGZ4_9FUNG/321-378    AC A0A0C9MGZ4.1
#=GS A0A0J8QS49_COCIT/156-318    AC A0A0J8QS49.1
#=GS A0A0D9MW47_ASPFA/410-514    AC A0A0D9MW47.1
#=GS T0KDB4_COLGC/456-501        AC T0KDB4.1
#=GS A0A166MYR9_9PEZI/646-698    AC A0A166MYR9.1
#=GS A0A168JB54_MUCCL/709-750    AC A0A168JB54.1
#=GS A0A0D2CID4_9EURO/379-467    AC A0A0D2CID4.1
#=GS R7YPI0_CONA1/593-724        AC R7YPI0.1
#=GS A0A0K8LFQ8_9EURO/522-657    AC A0A0K8LFQ8.1
#=GS A6RCP1_AJECN/417-528        AC A6RCP1.1
#=GS V5G1I1_BYSSN/557-696        AC V5G1I1.1
#=GS A0A066XKL1_COLSU/524-653    AC A0A066XKL1.1
#=GS E3RIR8_PYRTT/543-696        AC E3RIR8.1
#=GS L8G585_PSED2/503-624        AC L8G585.1
#=GS A0A0G2EJI4_9EURO/487-587    AC A0A0G2EJI4.1
#=GS H6C6Y6_EXODN/485-594        AC H6C6Y6.1
#=GS A2QKM3_ASPNC/556-695        AC A2QKM3.1
#=GS A6RCP1_AJECN/562-700        AC A6RCP1.1
#=GS B6HIZ7_PENRW/640-721        AC B6HIZ7.1
#=GS A0A168JB54_MUCCL/358-432    AC A0A168JB54.1
#=GS K1WW28_MARBU/694-854        AC K1WW28.1
#=GS A0A0D1XL02_9EURO/427-575    AC A0A0D1XL02.1
#=GS A1DGB5_NEOFI/538-673        AC A1DGB5.1
#=GS L8G585_PSED2/408-485        AC L8G585.1
#=GS B8M1D8_TALSN/481-624        AC B8M1D8.1
#=GS A0A0N0NRB6_9EURO/594-749    AC A0A0N0NRB6.1
#=GS F7W3Z0_SORMK/375-438        AC F7W3Z0.1
#=GS A0A066XKL1_COLSU/654-716    AC A0A066XKL1.1
#=GS A0A0F4YIE0_TALEM/339-441    AC A0A0F4YIE0.1
#=GS A0A167RTY9_9PEZI/522-665    AC A0A167RTY9.1
#=GS M7SU52_EUTLA/431-503        AC M7SU52.1
#=GS U6KG47_9EIME/184-288        AC U6KG47.1
#=GS C0NM90_AJECG/562-700        AC C0NM90.1
#=GS C6HTC0_AJECH/382-462        AC C6HTC0.1
#=GS A0A0D1YR49_9PEZI/419-472    AC A0A0D1YR49.1
#=GS F9XE98_ZYMTI/303-350        AC F9XE98.1
#=GS C0NM90_AJECG/407-521        AC C0NM90.1
#=GS A0A0J8RJW6_COCIT/510-554    AC A0A0J8RJW6.1
#=GS S3DTS4_GLAL2/689-740        AC S3DTS4.1
#=GS F7W3Z0_SORMK/486-613        AC F7W3Z0.1
#=GS G4N0D9_MAGO7/486-540        AC G4N0D9.1
#=GS A0A101ME85_9EURO/545-585    AC A0A101ME85.1
#=GS W6PSX9_PENRF/699-813        AC W6PSX9.1
#=GS A0A074YSE8_AURPU/553-710    AC A0A074YSE8.1
#=GS W9CAG8_9HELO/706-866        AC W9CAG8.1
#=GS A0A0D2FDQ0_9EURO/644-803    AC A0A0D2FDQ0.1
#=GS A0A0J6Y2F6_COCIT/382-493    AC A0A0J6Y2F6.1
#=GS A0A136J136_9PEZI/620-688    AC A0A136J136.1
#=GS A0A178AVN6_9PLEO/350-419    AC A0A178AVN6.1
#=GS A0A168JB54_MUCCL/266-308    AC A0A168JB54.1
#=GS A0A010Q3X1_9PEZI/647-698    AC A0A010Q3X1.1
#=GS S2JHI7_MUCC1/417-457        AC S2JHI7.1
#=GS A0A0D2I679_9EURO/381-460    AC A0A0D2I679.1
#=GS A0A063BU25_9HYPO/416-462    AC A0A063BU25.1
#=GS A0A0U5FQN0_9EURO/276-337    AC A0A0U5FQN0.1
#=GS A0A072PTE1_9EURO/475-588    AC A0A072PTE1.1
#=GS W9WD84_9EURO/642-822        AC W9WD84.1
#=GS C1HCJ5_PARBA/521-660        AC C1HCJ5.2
#=GS G7XHH0_ASPKW/557-696        AC G7XHH0.1
#=GS B8NBW3_ASPFN/304-375        AC B8NBW3.1
#=GS K9FWG0_PEND2/544-691        AC K9FWG0.1
#=GS A1CSM6_ASPCL/533-664        AC A1CSM6.1
#=GS A0A194X7G0_9HELO/505-597    AC A0A194X7G0.1
#=GS W2RLM0_9EURO/515-654        AC W2RLM0.1
#=GS S3CWZ7_OPHP1/493-635        AC S3CWZ7.1
#=GS V5G1I1_BYSSN/410-507        AC V5G1I1.1
#=GS G3XV77_ASPNA/397-504        AC G3XV77.1
#=GS A0A177CV39_9PLEO/1-101      AC A0A177CV39.1
#=GS A0A0D2K9Q9_9EURO/624-785    AC A0A0D2K9Q9.1
#=GS A0A139ISU8_9PEZI/658-831    AC A0A139ISU8.1
#=GS W9Y839_9EURO/372-454        AC W9Y839.1
#=GS A0A0U1M4K8_9EURO/257-321    AC A0A0U1M4K8.1
#=GS H1UXZ2_COLHI/511-639        AC H1UXZ2.1
#=GS E9E4W9_METAQ/602-663        AC E9E4W9.1
#=GS A0A135U1E0_9PEZI/692-844    AC A0A135U1E0.1
#=GS A0A165A7V2_9PEZI/359-408    AC A0A165A7V2.1
#=GS A0A161Y9K7_9PEZI/741-876    AC A0A161Y9K7.1
#=GS M3CFH9_SPHMS/555-643        AC M3CFH9.1
#=GS M2TBE1_COCSN/587-741        AC M2TBE1.1
#=GS A0A0F7TW88_9EURO/493-640    AC A0A0F7TW88.1
#=GS A0A168JB54_MUCCL/525-568    AC A0A168JB54.1
#=GS W9WD84_9EURO/379-466        AC W9WD84.1
#=GS A0A0N7Z0T5_ROSNE/395-458    AC A0A0N7Z0T5.1
#=GS A0A167AKY9_9HYPO/444-515    AC A0A167AKY9.1
#=GS A0A135U1E0_9PEZI/515-643    AC A0A135U1E0.1
#=GS A0A0J8RJW6_COCIT/287-350    AC A0A0J8RJW6.1
#=GS Q0C9I2_ASPTN/392-495        AC Q0C9I2.1
#=GS U7PSX9_SPOS1/723-832        AC U7PSX9.1
#=GS R8BUE6_TOGMI/546-644        AC R8BUE6.1
#=GS A0A135M0D6_PENPA/537-678    AC A0A135M0D6.1
#=GS A0A094EQ88_9PEZI/1172-1242  AC A0A094EQ88.1
#=GS A0A0N7Z0T5_ROSNE/613-787    AC A0A0N7Z0T5.1
#=GS M2MVN7_BAUCO/647-824        AC M2MVN7.1
#=GS Q4X209_ASPFU/555-690        AC Q4X209.1
A0A139HNL0_9PEZI/429-506               .......................khrsrsrsKSLSR........RQ.Q...LGGLAA....V.A...G..V....A.A....L.A..G...Y...A..LN..KNKNKET.Iivn.......................dghrRR.SR..S..RR...........R.......R..........HSV...--........DTY.I.SD.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eerehrdpgh..................................................................................
A0A0S6X889_9FUNG/464-554               ...............................KSRSR........SR.L...RAGVPI....A.A...A..G....L.G....G.A..A...V...AglYE..RSKARKE.A..............................QR.EQ..V..TE...........R.......G..........VSV...SP........SRS.R.SR.S......RS....V....P..........YGE.DPN...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lrhatsdpalieyggdpiyaeqp.....................................................................
A0A084G042_9PEZI/617-801               ...............................RSRSR........LR.E...MAAAAL....G.T...G..A....A.A....M.G..F...K...E..YK..DRKKSKS.Rdrdmps.................dreaesaDD.RR..E..RR...........R.......R..........ERE...RR........RYE.N.DD.Y.....yDD....D....G..........YPP.SPR..hASggS.RPRMSGANsdpndfsTY.........PP..Q.TYY...P........V.PPDA...........TATypppgppPAD.AP....VYT..S..YPPP......QEP..NA...Y..PGP.....PPP-....-P...GAV.P.G.Y..............PP...............PTA-----...----------pgpapgpapgpsnrpppigpehn.....................................................................
D4AU90_ARTBC/558-692                   ...............................RSRSRhgn..gnlAA.G...LAAAGL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgvpp.psgpPG..G.RGY...P........P.PPGP...........---.......---.--....---..-..---P......--P..GP..gY..FGG.....PGP-....--...---.-.G.G..............PP...............VYRGDENV...PQPSRQHQN-g...........................................................................................
A0A0U5FQN0_9EURO/517-650               ...............................RHRSK........SR.D...IAGAAL....A.A...T..G....V.G....Y.A..A...H...K..YS..QHRERER.E..............................DR.DR..Q..RY...........-.......-..........DSD..gRP........SPY.E.EP.Y......SP....G....P..........YAA.SP-...--..-.NPGGSLDP.......QF.........RN..A.NYY...P........P.PPGS...........APV.......---.--....-PP..M..TPNP......YNP..AD...Y..PPP.....-NAA....PP...-QQ.Y.N.Y..............PP...............-PGPDPYA...NRPRRADENV............................................................................................
A0A0B7N6U1_9FUNG/214-285               ....................krssndndhhy-----........KR.D...VALGGG....V.A...G..A....T.G....I.A..G...L...D..VK..KHHDKQT.G..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ldnnhkdisshiqpdssniihsfndndhhrt.............................................................
A0A0G4LM95_9PEZI/435-530               ...........................rsrsRSKSR........IR.Q...GAEVVA....-.A...G..L....A.G....G.A..A...S...K..LW.hSRKDKKE.A.............................kER.EL..S..DE...........E.......Y..........EEEq.rRR........DRA.A.RR.R.....sRL....V....E..........YGT.DPL..pPS..Q.PPYPTND-.......Y-.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyksassqrr..................................................................................
A0A0C9MGZ4_9FUNG/114-150               ..........................hykrd-----........--.-...----AA....A.A...G..A....A.G....L.A..G...H...E..LK..DHHDQSS.N..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lnnhsttgn...................................................................................
A0A0D2BWC7_9EURO/479-597               ...............................RSRSR........IR.Q..aLPVVAA....G.L...G..S....A.A....V.A..-...G...L..YE..KHKAKKE.Aeeiad...................drrrarSR.SR..S..RA...........R.......S..........EH-...--........AYY.D.GP.G......QG....A....V..........NDP.GLI..eYG..N.APMYGNN-.......YG.........AD..Y.YGR...P........P.PPDG...........YYS.......NAV.VP....AA-..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tgpaagygaq..................................................................................
A0A093Y5R9_9PEZI/922-999               ...............................RSKSR........IR.T...GAELAA....A.G...L..A....T.A....A.A..A...N...L..YE..RRKAKQE.G..............................DR.SR..S..VS...........R.......S..........LSR...SR........SRS.R.GG.R......GL....D....E..........YER.P--...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------glveygaqplhsrg..............................................................................
A0A0G2EJI4_9EURO/389-457               ........................rrrsrse-SHSR........LK.Q...AGAVGL....G.A...A..A....L.A....V.A..A...A...V..AR..SRNKSVD.S..............................RR.SR..S..RH...........R.......R..........SSV...GP........ETV.D.DA.R......NP....S....H..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnk.........................................................................................
F9XE98_ZYMTI/636-827                   ...............................RNHSR........SR.N...AAIGGA....A.L...G..G....A.A....L.A..A...H...E..MG..KRRERSK.VakenrrerecrqsaddedlltqipgrddhqED.YY..D..DR...........R.......H..........DDR...RH........DDR.D.NN.-......--....M....G..........YND.YP-...QS..N.APYGGQPS.......TY.........PT..S.HYF...P........P.PPTG...........EDA.......ARN.DP....YGAqpQ..TYPA......YNP..AD...Y..AGQ.....PAQQ...hPP...YDQ.G.Q.Ygg..........geIPygesa....dpninqPYPGDAYA...GDQR------ygaehe......................................................................................
F0U958_AJEC8/417-526                   ...................kspgrirqgipi-----........--.-...-AVAGL....-.-...G..S....A.A....-.I..A...N...L..YE..KHKEKKE.S..............................ES.-S..E..RK...........E.......K..........NHR...RRsr...srsMAR.S.ST.Y......-P....D....P..........SRS.SPQlieYG..D.DPV-----.......-Yg......siPA..N.NYY...G........R.PPSR...........QSS.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------spraieasprrss...............................................................................
A0A0F0I0U5_ASPPU/306-380               ......................rsrsrshsh-SHSR........AR.T...LAELGL....G.A...A..A....I.A....G.A..V...A...L..AR.nKSKDERR.-..............................SR.SR..H..RS...........R.......S..........RHH...RS........SS-.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------vrsgrttdgekrsesq............................................................................
A0A0D1Z4Z7_9EURO/364-449               ............................rhr-SRSRsss..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSK.De............................gDR.GR..S..RS...........R.......S..........RSR...RR........KES.V.SS.L......ED....D....P..........DAP.SD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnt.........................................................................................
G9PCA8_HYPAI/432-520                   ............................srsRSKST........LR.R...GAELAA....G.A...A..A....V.G....V.A..G...K...M..WK..DHHDKKK.-..............................ER.ERgeS..TS...........R......gY..........SDE...-D........REY.D.GH.Ns....hSL....I....E..........YGH.DP-...LP..P.DPRS----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ptgqgyeseae.................................................................................
J3KI03_COCIM/349-390                   .............................dh----R........NR.R...MAEAGL...aG.A...A..V....A.G....L.V..E...H...V..RS..KSRSRKG.R..............................SR.SR..I..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tg..........................................................................................
A0A094DD18_9PEZI/423-500               ...............................RSKSR........IR.T...GAELAA....A.G...L..A....S.A....A.A..A...G...L..YE..RRKAKQE.G..............................DR.SV..S..RS...........L.......S..........RSK...SR........SRS.R.GV.R......GY....D....E..........YER.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pglveygaqplhsrg.............................................................................
A0A0D9MW47_ASPFA/304-375               ......................rsrsrshsh-SHSR........AR.T...LAELGL....G.A...A..A....I.A....G.A..V...A...L..AR.nKSKDERR.-..............................SR.SR..H..RS...........R.......S..........RHH...R-........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sssvrsgkttdgekrs............................................................................
W9Y839_9EURO/483-592                   .............................keRSRSR........IR.Q..aLPIVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aee.........................iakEQ.RR..A..RS...........R.......S..........RSR..aKS.......dGYY.D.GP.R......-D....A....A..........LSD.PGLi.eYG..T.GPMYGNN-.......FG.........PD..Y.YGR...P........P.PPEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygasdavvp...................................................................................
G2WRI8_VERDV/510-640                   ...........................rsrsRSKSR........IR.Q...GAEVVA....-.A...G..L....A.G....G.A..A...S...K..LW.hSRKDKKE.Akere......................lsdeEY.EE..E..QR...........R.......R..........---...--........DRA.A.RR.R......SR....S....R..........SQA.RS-...LY..S.EPRTDGPIgl...veY-.........-G..T.D--...P........L.PPSQ...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ppyptndygyesassqrrrrrsrgrgaddyspsg..........................................................
B5YNX9_THAPS/110-231                   .......................rnggedde-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..YE..ME--RRR.-..............................QM.EE..E..RY...........R.......L..........QDE..iRH........QMD.D.DN.Y......SD....H....H..........SRQ.LSR...RS..R.DPESDEAS.......RR.........SN..M.SGV...P........P.PPRS...........VRS.......--G.HS....QSH..Q..SRSR......YDP..DG...M..SHD.....FGAD....DP...-DG.R.H.Y..............AP...............GLN-----...----------nhggvpsvhtg.................................................................................
A0A010Q3X1_9PEZI/517-646               ...............................RSKSR........IR.T...GAEIAA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKEKKD.Re............................vDR.EL..E..EQ...........D.......Y..........EEE..vRR........ERR.E.RR.R......SR....S....R..........SQA.-RS...LY..S.EPRSADPElg..lveYGt.......ePL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RQR..R..RHRR......MSG..DD...Y..DG-.....----....--...---.-.-.-..............--...............--------...----------hepakk......................................................................................
W6PSX9_PENRF/493-646                   ...............................RHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSR-.-..............................ER.DR..E..HS...........T.......H..........DDN..vHR........DPY.E.ES.Y......NP....E....P..........YPL.SPQ..aAP..S.APPMPDPH.......YYpsnpnpnpnPN..P.NYY...P........P.PPGD...........STY.......---.--....NLN..S..TPAS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaPP...............GPGPEQYT...HRPRRAEDNV............................................................................................
C8V000_EMENI/27-137                    ...........................rsrsRSKSR........IR.K...ALPVVA....A.G...L..G....S.A....V.A..A...N...I..WD..KKKDKEA.E..............................EE.PR..R..KD...........R.......H..........RSR..sRG........RAP.S.DI.Y......PD....S....T..........RDS.AGLi.eYG..D.HPVHGS--.......-I.........PA..A.NYY...G........R.PPSS...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pgyhtdasdrvardag............................................................................
A0A100ITS5_ASPNG/555-694               ...............................KHRSR........SR.E...IAEAAL....A.A...T..G....V.G....Y.A..A...H...K..LS..QRNERKK.A..............................DR.DR..D..RP...........E.......S..........DED..aRR........EPY.D.NS.Y.....kTP....L....P..........YPA.TPA...AA..P.RPVDDHQ-.......YY.........PN..G.NYF...P........P.PPAT...........GPR.......P--.--....---..-..EPAP......YSP..AD...Y..PHP.....PGPV....PP...-QS.Y.E.Y..............PS...............GPGPDPYA...PRPRRADENV............................................................................................
B5YNX8_THAPS/64-186                    ......................trnggedde-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..YE..MER--RR.-..............................QM.EE..E..RY...........R.......L..........QDE..iRH........QMD.D.DN.Y......SD....H....H..........SRQ.LSR...RS..R.DPESDEAS.......RR.........SN..M.SGV...P........P.PPRS...........VRS.......--G.HS....QSH..Q..SRSR......YDP..DG...M..SHD.....FGAD....DP...-DG.R.H.Y..............AP...............GLN-----...----------nhggvpsvhtg.................................................................................
A0A167RTY9_9PEZI/750-901               ............................rdh-----........--.-...------....-.-...-..-....-.-....-.-..-...-...D..RD..RHRDEYR.-..............................DR.DR..N..RR...........H.......H..........DGD...-D........GAY.D.DY.Y......NE....H....D..........GHG.PP-...--..S.PPHASGGA.......FY.........PP..-.---...-........-.PPQPtppit.gsgafMQH.......PNV.AT....TDL..R..QTDP.....lYAP..TDhhdY..PPP.....PGP-....PP...STG.A.P.Lh............sQPa.............vHAQEAPVN...PNP-------agqhvhhadednpipdlnrpanndnd..................................................................
A0A139HNL0_9PEZI/635-793               ...............................RSRSR........RR.N...LAEAGA....A.A...G..V....A.A....V.A..A...H...E..IG..KRRERSR.As............................rSR.SR..E..RR...........R.......P..........ED-...--........DYY.E.DR.R......AD....D....P..........YSP.PPM..gNS..Y.PPYQNQDPya...qqAY.........PG..A.NYF...P........P.PPNG...........ETS.......GYV.EP....QPA..Y..AHAQ......YNP..AD...Y..AGQ.....PATQ...aPY...DHQ.Q.A.Ygg..........ysEPy.............pGQSHHSYA...HDAQYGD---egr.........................................................................................
A0A0G2JAW1_9EURO/566-703               ...............................RSRSR........TR.E...FATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKK.A..............................EK.DR..R..KY...........D.......H..........DHD...YQ........ESF.E.EG.Y......DP....A....P..........YAP.SP-...--..-.-PPNSSN-.......YY.........TQ..G.NQF...P........P.APGL...........TPI.......P--.--....-PN..V..QPGP......YNP..AD...Y..PPP.....PGAP...pQA...QSN.Y.P.Y..............PP...............PTGMDPYG...PRSARGDES-v...........................................................................................
M2ZPK6_PSEFD/581-658                   .......................khrsrsrsKSLSR........IQ.Q...VGGLAA....V.A...G..I....A.A....L.A..G...Y...A..LN..KNKNKET.Iivn.......................dghrRR.SR..S..RR...........R.......R..........HSV...--........DTY.I.SD.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eerehrnpeh..................................................................................
A0A0G2JAW1_9EURO/416-524               ......................kspsrikqg-----........--.-...LPIAAA....S.L...G..S....A.A....I.-..A...N...L..YE..KHKEKKE.S..............................ES.SE..R..QD...........K.......R..........HRR...QS........SRS.R.SV.R......RS....A....T..........YSD.PSR...SS..P.QLIEYGDD......pVYg......siPA..N.NYY...G........R.PPSR...........QSS.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------spraieasprr.................................................................................
A0A167AKY9_9HYPO/569-702               .............................rkRSRSR........LR.N...MASAGA....-.-...-..-....A.A....F.G..I...K...E..YK..DKKDREK.R..............................ER.R-..-..--...........S.......G..........ERQ..rSR........DDY.D.DG.Y......DR....R....D..........DRP.SS-...--..-.PLHASGGA.......YY.........PP..-.--Y...P........T.TPAAgg......pgdYNP......yNNP.AA....AQS..H..EYQP......YVP..QDymgY..APP.....PPPG....PP...PA-.-.-.-..............--...............--------...----------pvpgpmtgyppgp...............................................................................
S2JHI7_MUCC1/121-203                   ...........................hhkr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDQQS.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gldnhhassnplqpglghnshegvkssplhseaglgnhytsasnplrptsndhhy.....................................
A0A135SUF1_9PEZI/645-696               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..L...K...Q..YQ..KKKEKEE.E..............................ER.-R..E..ER...........R.......E..........DRR...SR........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ersa........................................................................................
A0A0D2BFS9_9EURO/644-799               ...........................rrqs-RRRS........SR.D...ATKMAA....A.A...G..A....G.A....V.A..A...S...E..YD..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEGg.yGH........DPY.E.DS.Y.....nPN....Q....Q..........YPP.TPP..pPV..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQ.......QQY.PP....QTS..N..PGAT.....tGNPygQA...Y..PPP....pPGPP....PN...ATG.T.N.Y..............EA..............yASGANPYA...PRG-------penv........................................................................................
G3XV77_ASPNA/556-686                   ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..LS..QRNERKK.A..............................DR.DR..D..RP...........-.......-..........--G...KP........CSY.K.NP.L......--....-....P..........YPA.TPA...AA..P.RPIDDHQ-.......YY.........PN..G.NYF...P........P.PPAT...........GPR.......P--.--....---..-..EPAP......YSP..AD...Y..PHP.....PGPV....PP...-QS.Y.D.Y..............PS...............GPGPDPYA...PRPRRADENV............................................................................................
W9Y839_9EURO/107-205                   ...................paaerelvirrt-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..-T..ERDDPRR.-..............................-D.EV..S..VA...........R.......Y..........EDR...GRd......vRIA.E.TR.Y......RD....D....Y..........EIV.APS...RS..F.DDRDLQR-.......YS.........RT..A.EYF...T........P.PPQP...........TTI.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------virqepiiirervrdddyqi........................................................................
A0A0S6X889_9FUNG/574-741               ......................rrrsrsrsn-SRSR........TR.G...LAEAAA....A.A...G..I....A.G....A.A..A...H...E..LT..KRSERKK.A..............................EK.ER..R..REympcgpvlgahK.......T..........NDP..qGR........ERE.D.EL.Y.....aQE....H....P..........YTP.PPM..gAN..A.GEYAHQGD.......YY.........PQ..S.NSF...P........P.PPAN...........DYS.......ARE.AN....YPP..G..EYPP......YNP..AD...Y..PPP.....PGGG....PN...AGV.D.H.Y..............PP...............SPGAHYN-...----------naggygpne...................................................................................
A0A0D1Z4Z7_9EURO/625-782               .............................dr-SRRR.......hSR.D...AAKMTA....A.A...A..A....G.A....I.G..A...T...E..YE..KRKQERR.E..............................RR.AR..K..RR...........E.......E..........EGY...GR........DPY.E.DN.Y......HPggqfA....P..........TPP.PPA...PV..N.DPYATQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQq....ypPQA.GP...aTAP..T..GAAP......YPP..QN...Y..PPPp...pPPGA....PP...APA.Q.P.Y..............EA..............yASGANPYA...PRG-------penv........................................................................................
A0A0D1Y3N1_9EURO/654-803               ..............................h-SRRR........SR.D...AGRSAA....A.A...A..G....G.A....A.A..A...S...E..YE..SRRKQEK.R..............................DR.KA..R..KR...........R.......E..........EQG..yGA........DPY.E.DN.Y.....nPA....Q....Q..........YSP.TPP...PA..N.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGA...........VPQ.......QYP.QN....AAP..G..AANP......YPT..QS...Y..PPPp...pPPGP....PP...TGA.A.N.Y..............DP..............yASGANPYA...PRG-------penv........................................................................................
K2S5L1_MACPH/454-539                   .............................ksRSRSR........IR.TgipVAAAGL....G.-...-..G....A.A....L.AglY...E...K..NA..AKKEDKE.E..............................RK.SR..S..RS...........R.......S..........RSR...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------svpsgsrrasasdpalvvyggdpiyveptasarr..........................................................
A1CSM6_ASPCL/393-490                   ...............................RSHSR........LR.H...ALPVVA....A.G...L..G....T.A....V.A..T...G...L..YE..KHKMKEG.E.............................eGK.HR..E..RR...........R.......A..........RSR...SRa.....psEIY.P.DP.N......RD....SagliE..........YGD.HPV...AG..S.IPSA---H.......YY.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------grpasqqgyyhsda..............................................................................
S9VEY3_9TRYP/92-148                    .......................mliacltp-----........--.-...------....-.-...-..-....-.-....I.C..I...Q...C..CE..AREEKKQ.A..............................KK.DE..K..KR...........K.......K..........EEK...KV........QKQ.Q.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eetxxxavqltdggqp............................................................................
R0K5Y5_SETT2/571-717                   ...............................RSKSR........VR.T...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AT..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........EDS...--........TYS.T.GT.Y......--....S....P..........YDS.PS-...-P..S.TAHAEDSR.......YF.........PE..T.NYF...P........P.PPNA...........S--.......--A.DP....NIH..N..PYPP......YNP..AD...Y..PPG.....PNHS...sQ-...---.-.-.YvnvprdeshignpyVP...............PQHQDHYY...GPPRRMDGNV............................................................................................
Q2TZD9_ASPOR/411-515                   ..............................sRSHSR........LR.K...ALPVVA....A.G...L..G....T.A....A.A..T...G...L..YE..KHKEKQE.Eg...........................eaSR.RR..E..RS...........R.......S..........RSR...--........-AP.S.EI.Y......-P....D....P..........TRD.SAGlieYG..Q.DPVHGRI-.......--.........PT..A.DYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------grptsqqayysdasdpavsd........................................................................
E3QDR6_COLGM/644-698                   ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..L...K...Q..YQ..KKKEREE.D..............................EE.EN..L..RS...........R.......E..........RSA...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsrdrs....................................................................................
A0A100ITS5_ASPNG/302-372               ........................rsrsrsh-SHSR........AR.H...LAELGLgaaaI.A...G..A....V.A....L.A..R...S...K..SN..SNKDRRS.R..............................SR.HR..R..AS...........S.......S..........RRS...LK........DSH.E.ET.R......SQ....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sqr.........................................................................................
A0A0J8RJW6_COCIT/347-391               ...........................dpdh----R........NR.R...MAEAGL...aG.A...A..V....A.G....L.V..E...H...V..RS..KSRSRKG.R..............................SR.SR..I..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tgi.........................................................................................
A0A0K8LFQ8_9EURO/377-478               ..............................sRSHSR........LR.Q...A--LPV....V.A...A..G....L.G....T.A..A...V...TglYE..KNKEKKE.E..............................EG.KR..R..ER...........R.......R..........SRS...RS........RAP.S.EA.Y......-P....D....P..........ARD.SAGlieYG..E.HPVTGS--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ipaahyygrpasqqgyysdasdrv....................................................................
F2SD33_TRIRC/551-673                   ..............................nRSRSRhgn..gnlAA.G...LAAASL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgvpp.ppgpPG..G.RGY...P........P.PPGP...........PP-.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gpgyfggpgpggppvyrgd.........................................................................
A0A168JGH6_CORDF/451-561               .............................rsRSKSR........LR.T...GAKIAG....A.A...A..A....A.G....V.A..G...K...L..YK..NHQEKKE.R..............................SR.SR..A..RS...........D.......T..........DDD...--........RYY.G.RR.D......RS....R....S..........RSR.SMA...RS..L.HSDAGADRelg.lveY-.........-G..N.GEL...P........P.PPDR...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rgydsdddrrsrrrrs............................................................................
J3KI03_COCIM/510-672                   ...............................RERSR........SR.D...LATAGL...aA.A...G..A....A.G....L.A..A...H...K..YA..QRKERKK.N..............................ER.DR..R..RD...........E.......E..........E-A...RQ........DSY.D.DT.Y......ST....I....P..........YPP.SPP...PP..S.ASSYPQDN.......YY.........PQ..T.NQFaqsPnq...ttgP.PPGH...........YQY......pPSN.YP....PPG..T..ASMPppnhvsHNP..AD...Y..PPP.....PGAP....PP...AQH.Y.N.Y..............PV...............PPAQDPYA...HLQPRGDENV............................................................................................
N4VHF5_COLOR/631-705                   ...............................RSKSR........LR.E...MAAAAV....G.T...G..A....A.A....I.G..I...K...Q..YQ..KGKDKEE.D..............................LR.ER..E..RS...........R.......D..........RER...RA........RSI.S.RD.R......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sisrdrgyprdrassrdrp.........................................................................
A0A0D2I679_9EURO/641-794               .............................hg--RRR........SR.D...AAKMAA....A.A...G..A....G.A....I.A..A...S...E..YE..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEG..yGR........DPY.E.DS.Y.....nPP....Q....P..........YSP.TPP..pPV..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQq....ypPQT.AS....APA..P..ATAS......SYP..QQ..tY..PPP.....PAGP....PP...AGA.P.T.Y..............DT..............yASGANTYA...PRG-------penvsa......................................................................................
E3QDR6_COLGM/512-642                   .............................rsRSKSR........LR.T...GAEVVA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKE.R..............................EL.DR..E..LSd.........dE.......Y..........EEE..aRR........ERR.E.HR.R......-S....R....S..........RSQ.ARS...LH..P.EPHSADSElg..lveYGt.......sPL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....GRR..R..RHRR......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------msaddyddrepak...............................................................................
A0A135SUF1_9PEZI/515-643               ...............................RSKSR........IR.T...GAEIAA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKEKKD.Re............................vDR.EL..E..EQ...........D.......Y..........EEE..vRR........ERR.E.RR.R......SR....S....R..........SQA.-RS...LY..S.EPRSADPElg..lveYGt.......ePL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......MSG..DD...Y..---.....----....--...---.-.-.-..............--...............--------...----------dghepak.....................................................................................
U4LPE7_PYROM/313-369                   .........................rsrsrsRSRSRpr...shtGR.H...IAAAAL....G.A...T..A....A.G....L.A..A...H...K..MR..HRRDSYS.S..............................-Y.S-..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sddeghhhr...................................................................................
A0A0D2DS24_9EURO/497-604               ...............................RSRSR........IR.Q..aLPVIAA....G.L...G..S....A.A....V.A..G...-...V..YE..KHKAKKE.Aeeive...................knrrarSR.SR..S..RA...........R.......S..........EH-...-S........AYY.D.GP.P......AP....P....T..........NEQ.SLV..eYG..N.TPMYGNN-.......-Y.........GA..D.YYG...R........P.PPQD...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyysnavvp...................................................................................
A0A0J6Y2F6_COCIT/346-390               ..........................rdpdh----R........NR.R...MAEAGL...aG.A...A..V....A.G....L.V..E...H...V..RS..KSRSRKG.R..............................SR.SR..I..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tg..........................................................................................
A0A150VE66_9PEZI/539-622               ........................rsksrgrRSKSR........VK.Q..gVPIAAA....G.L...G..G....A.A....L.A..Gl.yE...N..SK..ANKERKQ.Qqi.........................iedER.NR..G..RR...........R.......R..........SRT...--........---.-.--.-......--....-....-..........Y--.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gnepiypetgrgyysdeepgm.......................................................................
A0A150VE66_9PEZI/640-781               .............................rrRSRSR.......tGR.H...LAEAGA....A.A...G..V....A.A....V.A..A...H...E..IG..KRRERSR.-..............................QR.EA..E..RR...........R.......H..........EDD...--........AGY.G.DQ.Y......AH....D....-..........HGD.---...--..-.-GYNQQQ-.......AY.........PS..S.NYF...P........P.PPTG...........EYA.......QQQ.PY....PEQ..N..PYPP......YNP..SD...Y..AQQ.....PASQ....QP...Y-P.E.T.Y..............VP...............-YADESGA...PAPH------antphaggary.................................................................................
W3XH82_9PEZI/344-396                   .............................dh--RSR........--.D...-AALAF....G.A...G..A....A.A....Y.G..T...H...E..HE..QHNKRSE.T..............................SA.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sqpigsgtdpthadprtav.........................................................................
Q0C9I2_ASPTN/537-583                   ...............................RHRSK........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YS..QHKDRKK.A..............................DK.EA..E..RS...........R.......E..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------yip.........................................................................................
A0A177D9J9_ALTAL/595-748               ...............................RSKSR........AR.T...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AA..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........DDS...--........AYS.T.GT.Y......--....S....P..........YDS.PTP...ST..A.HPNDSR--.......FF.........PE..S.NYF...P........P.PPTA...........---.......-PV.DH....NPN..N..PYPP......YNP..AD...Y..PPP.....PSAY....EP...NHP.S.Q.Fv............nPPhedlhlg.npyapqhQQQHEPYY...GQPRRGGDNV............................................................................................
A0A0A1TGS9_9HYPO/569-721               ...............................RSRSR........LR.N...MAAAGA....A.A...G..A....A.A....M.G..I...K...E..YK..NRKDRKK.Rde.........................drhSR.ER..S..QE...........R.......Y..........EDE...--........RRH.E.RR.Y.....dEH....D....E..........RPQ.S--...--..-.PPTASGGA.......YY.........PP..-.--Y...P........P.TPGA...........-PY......gSPS.AA....QSY..D..NQQY......YVP..QDm.gY..APP.....PPPGpppaPN...TGP.A.N.Yg............pPP...............PPGP----...----------ppgpppgsnqapehg.............................................................................
G7XHH0_ASPKW/403-503                   ...............................RRESR........SH.S...AIRKALp..vV.A...A..G....L.G....T.A..A...A...TglYE..KNKEKKE.E..............................EE.SR..R..RE...........R.......R..........RSR..sRS........RAP.S.EV.Y......-P....D....P..........TRD.SPG..lIE..Y.G-------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dhpvhgsippnyygrpvsphgyysda..................................................................
A0A0C9MGZ4_9FUNG/419-467               ...........................hykr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKQ-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sgidgtsplhsksgldnhhsat......................................................................
A0A0D2K9Q9_9EURO/364-452               ............................rhr-SRSRsss..pskFK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSN.Dd............................gDR.GR..S..RS...........R.......S..........RSR...RR........RES.V.SS.L......ED....D....P..........DAP.SD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rntmak......................................................................................
A0A010Q3X1_9PEZI/698-843               ...............................RSRSR........DR.S...VTRERT....Y.S...R..E....R.A....Y.S..R...E...R..ST..DDRMRNR.-..............................ER.ER..D..RR...........R.......Y..........EED..aRD........DGY.Y.DN.Y......--....-....S..........RPP.SP-...--..-.-PHASGGS.......F-.........--..-.--Y...P........P.PPAAaa.......gfTQH......pNIS.TA....NLR..D..QYPP......YPS..SDs.vY..PPG.....PPPM....GP...SPP.M.A.Tgga........ggyPP...............PP------...----------pagghpppgggppgt.............................................................................
A0A0F0I0U5_ASPPU/563-702               ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YS..QRREGKK.A..............................EQ.ER..E..RP...........R.......F..........DED..aRQ........DSY.G.EP.Y......SP....E....P..........YHH.TA-...--..L.PPQSSEHQ.......YY.........PN..T.NYF...P........P.PPGS...........APR.......---.--....-PA..G..STAP......YNP..AD...Y..PPP.....PGAV....PP...SQQ.Y.G.Y..............PP...............PPGPESFV...SRPRRADENV............................................................................................
G7XHH0_ASPKW/302-375                   ......................rsrsrsrsh-SHSR........AR.H...LAELGLgaaaI.A...G..A....V.A....L.A..R...S...K..SN..SNKDRRS.R..............................SR.HR..R..AS...........S.......S..........RRS...LK........DSH.E.ET.R......SQ....S....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qrr.........................................................................................
A0A139HNL3_9PEZI/658-816               ...............................RSRSR........RR.N...LAEAGA....A.A...G..V....A.A....V.A..A...H...E..IG..KRRERSR.As............................rSR.SR..E..RR...........R.......P..........ED-...--........DYY.E.DR.R......AD....D....P..........YSP.PPM..gNS..Y.PPYQNQDPya...qqAY.........PG..A.NYF...P........P.PPNG...........ETS.......GYV.EP....QPA..Y..AHAQ......YNP..AD...Y..AGQ.....PATQ...aPY...DHQ.Q.A.Ygg..........ysEPy.............pGQSHHSYA...HDAQYGD---egr.........................................................................................
G0SEH0_CHATD/691-755                   ...............................RSGSR........LR.D...AAVGAA....A.V...G..A....A.A....I.G..L...K...K..LS.dKGKEKEE.Rg............................rSR.SR..E..RQ...........R.......S..........RSR..sRS........RSW.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srerdrere...................................................................................
A0A0F0I0U5_ASPPU/414-516               ...............................RSHSR........LR.K...ALPVIA....A.G...L..G....T.A....A.A..T...G...L..YE..KHKEKQE.Eg...........................eaSR.RR..E..RS...........R.......S..........RSR...--........-AP.S.EI.Y......-P....D....P..........TRD.SAGlieYG..Q.DPVHGRI-.......--.........PT..A.DYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------grptsqqayysdasdpavs.........................................................................
M2TBE1_COCSN/345-430                   ...............................RSKSR........AR.E...LGTLAA....L.A...G..V....G.A....L.A..Y...A...A..GQ..RNKAKTK.Eetv.......................tiieDR.HR..S..RS...........R.......H..........RSK...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srhrrgrrksrsvsvvsdrsrsrstskhmdpe............................................................
U1HT54_ENDPU/646-826                   .............................rh-NRSR........SR.D...IATPAL....A.A...I..G....G.G....I.A..A...T...E..YA..KRKEKKK.A..............................EK.AR..R..RY...........E.......E..........EYG...HGhg...qgqDPY.E.DE.Y......DPv..qR....R..........YTP.TPP...SS..A.DPYGNPNQ.......YY.........RS..D.DQL...P........P.PPGSapa....plypP-Qqp...paGYQ.QQ....GP-..Y..PAQP.....sYNP..AA...Y..AQQ.....PGA-....PP...PIN.P.A.Y..............PP...............QNSA----...----------ssagfppatpfasggngdprlprgrgdenv..............................................................
J3KI03_COCIM/382-492                   ...............................RSRSR........IR.TgipIAAAGL....G.S...A..A....I.A....A.A..Y...E...K..NK.aKNEDKKE.K..............................ET.RR..A..RS...........R.......S..........QSK...SR........---.A.RS.S......SE....S....Q..........VGV.PPHlieYG..D.DPVYGR--.......-I.........PA..S.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------graespyhtprkhthsrsrrspstd...................................................................
A0A0S8B9L4_9CHLR/1-74                  ..............................m----R........RR.R...VARAAV....G.T...A..V....V.A....G.T..A...G...A..VR..HHQQKKW.A..............................ED.DY..A..QQ...........Q.......Q..........IQ-...--........QDY.A.AE.N......EE....E....Y..........YDE.PPE..qYA..A.PPPQE---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dltak.......................................................................................
H1UXZ2_COLHI/467-515                   ........................rsrsrks-RKSR........SR.S...VAKAAA....A.T...A..A....A.A....G.L..V...Q...H..FR..NKSNSKS.R..............................SR.SR..S..KS...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------r...........................................................................................
A0A0C9MGZ4_9FUNG/487-519               ..........................hhykr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDN--.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qigidn......................................................................................
A0A0G3A5Q5_9ACTN/4-80                  .............................ll-----........-R.G...IARTAV....V.A...G..T....A.T....A.V..S...N...H..VS..RRQAGRW.A..............................QQ.DY..E..RQ...........Q.......Q..........YEQ...--........QYA.Q.PE.Y......AQ....P....Q..........QPP.PPP...PA..A.PPPAA---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pddmtqkid...................................................................................
A0A094GA47_9PEZI/423-500               ...............................RSKSR........IR.T...GAELAA....A.G...L..A....S.A....A.A..A...G...L..YE..RRKAKQE.G..............................DR.SV..S..RS...........L.......S..........RSK...SR........SRS.R.GV.R......GY....D....E..........YER.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pglveygaqplhsrg.............................................................................
A0A0F4GXD0_9PEZI/617-791               ...............................RNHSR........SR.N...AAIGGA....A.L...G..G....A.A....L.A..A...H...E..MG..KRRERSK.V..............................AK.EN..R..RE...........R.......R..........DDH...QD........DYY.D.DR.R......HD....D....RhhddrdnnmgYND.YP-...QP..N.APYGGQPS.......TY.........PT..S.HYF...P........P.PPTG...........EDA.......ARN.DP....YGA..HpqTYPA......YNP..AD...Y..AGQ.....PAQQ...hPP...YDQ.A.Q.Ygg..........geISygesa....dpninqPYPGDAYA...GDQRY-----gaehe.......................................................................................
G0SEH0_CHATD/485-525                   ...............................RSKSR........AS.S...LAKAAV....-.A...T..A....A.A....T.G..L...L...Q..HY..RHKSKSR.D..............................GK.SR..S..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------s...........................................................................................
A0A168JB54_MUCCL/450-482               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglggahh....................................................................................
C5G976_AJEDR/340-451                   .......................rikqglpi-----........--.-...-AAAGL....-.-...G..T....A.A....I.-..A...N...L..YE..KHKEKKE.S..............................ESsER..G..HR...........R.......R..........SRS...KS........VAR.S.ST.Y......-P....D....A..........SRS.APQlveYG..D.DPIYGS--.......-I.........PA..D.NYY...R........R.PPSR...........QPS.......--R.NR....RA-..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrtryrddgpgsgts...........................................................................
A0A0D2BFS9_9EURO/495-603               ..............................eRSQSR........VR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aeli.......................akdgRR.AR..S..RS...........R.......S..........RAR...SD........AYY.D.GP.R......EG....A....V..........SDP.GLI..eYG..N.GPMYGNN-.......FG.........PD..Y.YGR...P........P.PPEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygtsnavvp...................................................................................
A0A0D2BWC7_9EURO/364-449               ............................rhr-SRSRsss..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSK.De............................gDR.GR..S..RS...........R.......S..........RSR...RR........KES.V.SS.L......ED....D....P..........DAP.SD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnt.........................................................................................
G2XR77_BOTF4/694-852                   ...............................RSRSR........VR.D...LAAGAL....G.T...G..A....A.A....I.G..I...N...E..YR..KRKEKKE.Kkekk.....................daekhER.ER..E..RR...........R.......Y..........EDE...AP........ESY.Y.TN.F......RD....E....T..........YSP.SP-...--..-.-PHASGGS.......YY.........PE..N.NAF...P........P.PPTSnpet...ftnhGNKs.....tPFV.NE....IP-..-..PIPP......YNP..QD...Y..ASQ....rPTTH....DP...---.H.H.Y..............PPs............srVPGD----...----------nvsthqssnpep................................................................................
A0A165A7V2_9PEZI/202-299               .............................rsRSRSR........LRkG...LPIAAA....G.L...G..G....A.A....V.A..G...L...-..-Y..ERNQKEK.E..............................EA.ED..S..RR...........R.......H..........DHR...RG........SRS.R.SR.S......AS....A....P..........YSE.AG-...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrgtasdpglieygdqpvytadyygvptgrr............................................................
W9XB18_9EURO/369-456                   ............................rhr-SRSRsss..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSN.Ddg..........................drGR.SR..S..RS...........R.......S..........RSR...RR........RES.V.SS.L......ED....D....P..........NAP.SD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnt.........................................................................................
G2WRI8_VERDV/647-805                   ...............................RSRSR........IR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...E..YK..KKKDAEK.Eredeaarr..............arerslsrDY.SR..D..RS...........R.......R..........RDE...GR........RRY.E.EE.S......NP....N....P.........hYDD.YSR...PP..S.PPHASGGA.......Y-.........--..-.--Y...P........T.PTGS...........GFS.......--Q.NQ....SVN..D..PYPP......YSP..HA...YtgFPP.....PQPG...gPP...T--.-.-.-..............--...............--------...----------asgaaggfptptpggpplsyqggp....................................................................
A0A163HMV4_DIDRA/361-431               ...............................RSKSR........VK.E...VVTLAA....L.A...-..G....V.G....L.A..A...Y...A..VG..KHSKEKN.Apvtt.....................tvvkeHR.SR..S..RR...........R.......R..........GTS...RR........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gesrsrsvtvveed..............................................................................
A0A094DD18_9PEZI/514-649               ...............................RSRSR........AR.E...MLGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RH...........-.......-..........YSS...--........DSY.P.SS.R......RS....A....D..........YSP.SP-...--..-.-PHASGGA.......YY.........PN..H.PTQ...Q........Q.PPTH..........pYPT.......TPD.AH....PYG..A..HPDP......NAP..TA...F..PPP.....PVP-....-P...SGA.Y.H.P..............PPm.............gG-------...----------yeaqsqggpssgg...............................................................................
A0A139HNL0_9PEZI/536-622               .............................rdRSKSR........LR.T..gVPIAAA....G.L...G..G....A.A....L.A..G...-...L..YE..KNKANKE.A..............................KR.DA..-..-V...........I.......E..........DEL...GR........GRH.T.SR.S......RS....R....T..........YGH.DP-...--..I.YPESHRGQ.......Y-.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sdeepghyrrrg................................................................................
A0A168JB54_MUCCL/784-843               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKES.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------glegahhtsgnplhpgsdninrsadgnndhhykr..........................................................
B8M1D8_TALSN/257-313                   ........................rsrsrss-SHSR........AK.T...LAGIGL....G.A...A..A....I.A....G.A..V...A...L..AR..NKSQDDR.R..............................SR.SR..H..RR...........R.......S..........QSR...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sgda........................................................................................
A0A0A2V7C7_BEABA/446-520               ...............................RSKSR........LR.T...GAKIAG....A.A...A..A....A.G....V.A..G...K...L..YK..NHQEKKE.R..............................ER.SR..S..RA...........P.......S..........DED...--........DRF.Y.DR.R......AR....S....H..........S--.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsmarslhsdagad............................................................................
A0A0D1ZLV8_9EURO/661-832               .............................kh-RRKK........SR.D...AAKLAA....A.A...P..T....A.P....A.G..A...S...A..YD..RRKEEKR.E..............................RR.AR..R..QR...........E.......E..........EATa.yGH........DAY.D.DS.Y......HQ....S....G..........-RH.SPT..pPP..N.DPYASQHGfs..qptYY.........PE..N.TQF...P........P.PPGSvpnqypsqpdpTPIq.....pGAA.EH....PPQ..A..AYVPq....aYPP..QA...Y..PPP.....PPGG....PP...PAP.T.N.Y..............DA..............yASGANPYA...PRG-------penvsae.....................................................................................
A0A0D2APJ8_9EURO/651-803               ............................hhs-RRRS........SR.D...AAKMAA....A.A...G..A....G.A....V.A..A...S...E..YD..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........DSY...GH........DPY.E.DN.Y.....nPA....Q....Q..........YPP.TPP..pPA..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQ.......QQY.PP....QTS..T..PGPT.....aGNP..YGq.aY..PPP.....PPGP....PP...NVAvP.T.Y..............ET..............yASGANPYA...PRG-------penv........................................................................................
K2S5L1_MACPH/347-423                   ...............................RSHSK........GR.K...VAGVAA....L.A...A..V....G.A....L.A..Y...A...A..GR..GQKANTT.Vi............................eRR.SR..S..RR...........R.......R..........-HS...VS........GAS.G.DE.Y......SP....S....P..........SRS.RSR..sKH..R.DPE-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hrn.........................................................................................
A0A0D2CID4_9EURO/644-804               ............................rgg--RRH........SR.D...AAKMTA....A.A...A..A....G.A....I.G..A...S...E..AE..RRKQERR.D..............................RR.AR..R..RQ...........Q.......E..........EGY...GR........DPY.E.DNnY......NP...gA....Q..........YAP.TPP..pPG..N.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGS...........IPQq.....yPPQ.AApgmaPPA..P..GPAP......YAQ..QG...Y..PPPp...pPPGA....PP...PPG.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsae.....................................................................................
A0A0A2K6U1_PENEN/544-693               ...............................KHHSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......H..........DDN..vHR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..tAP..G.APPMADPH.......YY.........PN..N.NYF...P........P.PPGD...........STY.......---.-N....LNG..G..TPAP......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaQPgp...........gpGPGPEQYA...PRPRRADENV............................................................................................
A0A136J136_9PEZI/386-450               ...........................rsksRSKSR........SR.L...ATGLAI....G.A...A..A....L.A....V.A..G..gL...K..YMqsEKVEKEE.A..............................TR.GR..A..RR...........R.......H..........SYS...--........SYS.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------smsrsrsg....................................................................................
A0A0L1J2N0_ASPNO/304-377               ....................rsrsrsrsrsh-SHSR........AR.T...LAELGL....G.A...A..A....I.A....G.A..V...A...L..AR.nKSKDERR.-..............................SR.SR..H..RS...........R.......S..........RHH...RS........S--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------svrsgrttdgekrs..............................................................................
A7EI77_SCLS1/520-622                   ...............................RSQSR........VR.T...AAEIAG...sG.L...A..G....A.A....V.-..A...G...L..YE..NRKAKKE.A..............................EE.DE..E..HV...........R.......R..........ERV...RV........RSR.T.RS.R......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------trsrsrarstgvysdpgvdpelgmvqygtepvhthqqpapydrtneh.............................................
C4JEK8_UNCRE/273-315                   .............................eh----R........NK.R...MAEAGL...aG.A...A..V....A.G....L.I..E...H...A..RS..KSRSRKG.R..............................SR.SR..I..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tgi.........................................................................................
A0A0U5FQN0_9EURO/371-476               .............................rsRSKSR........LR.K...ALPVVA....A.G...L..G....S.A....V.A..A...N...V..WD..KHKDKEA.Eea..........................vhRK.DR..R..RS...........R.......S..........---...RG........RPQ.S.EI.Y......-P....D....P..........TRD.SAGlieYG..D.HPVTGS--.......-I.........PA..A.NYY...G........R.PVSS...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qgyhtdasdpvar...............................................................................
A0A094GA47_9PEZI/514-649               ...............................RSRSR........AR.E...MLGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RH...........-.......-..........YSS...--........DSY.P.SS.R......RS....A....D..........YSP.SP-...--..-.-PHASGGA.......YY.........PN..H.PTQ...Q........Q.PPTH..........pYPT.......TPD.AH....PYG..A..HPDP......NAP..TA...F..PPP.....PVP-....-P...SGA.Y.H.P..............PPm.............gG-------...----------yeaqsqggpssgg...............................................................................
A0A166MYR9_9PEZI/691-854               ...............................RSRSR........DR.S...ISRDRA....H.S...R..D....R.A....Y.S..R...E...R..ST..DRLR-NR.-..............................DR.ER..D..RR...........R.......Y..........EDT..aRD........DGY.Y.DD.Y......--....-....S..........RPS.SP-...--..-.-PHASGG-.......--.........--..-.SYY...P........P.PPAAsa.......gfTQH.......PNIsTA....NLR..D..QYPP......-YP..QD...Y..PPG.....PPPM....GP...SPP.M.A.Tgga........ggyPP...............--------...----------pppaggpppsggpppgtrfgpdhvsddisrsaspqdaqp.....................................................
E5R2F7_ARTGP/550-689                   ............................rsp-SRSRhgn..gnlAA.G...LAAAGL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......H..........DRD...YR........DPY.E.DE.Y......-P....S....P..........PGP.PPG..pSS..Y.QPPAAQE-.......YYgvppphpgpPG..G.RGY...P........P.PPGP...........---.......---.--....---..-..---P......--P..GP..gY..FAG.....PGPG....PG...---.-.-.G..............PP...............VYRGDENV...PQPSHQNQN-g...........................................................................................
U4LPE7_PYROM/365-409                   ..............................g-HHHR........GR.K...VAAGIA....G.A...T..A....A.G....L.A..A...R...H..YS..RRRDSST.S..............................ST.SS..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------negshk......................................................................................
E9DDF0_COCPS/382-494                   ...............................RSRSR........IR.TgipIAAAGL....G.S...A..A....I.A....A.A..Y...E...K..NK..AKKEDKKeK..............................ET.RR..A..RS...........R.......S..........RSK...--........-SR.A.RS.S......SE....S....Q..........VGV.PPHlieYG..D.DPVYGR--.......-I.........PA..S.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------graespyhtprnhthsrsrrspstdsw.................................................................
A0A0M8P4S7_9EURO/502-653               ...............................KHRSH........SK.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......R..........DDH..vHR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..tAP..G.APPMADPH.......YY.........PN..N.NYF...P........P.PPGD...........STY.......---.-N....LNS..G..TPVS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg............aAPrgp........gpgpGLGPEQYA...PRPRRADDNV............................................................................................
A0A084G042_9PEZI/487-604               ...............................RSRSR........LR.T...GAEIAA....A.A...V..A....G.G....A.A..G...K...L..YQ..RHKEKKE.-..............................ER.ER..S..RS...........R.......S..........SDS...HY........EPR.H.GS.R......SR....S....R..........SRS.TTR..sFH..P.EPGSADRElg...lvEY.........GH..D.PLR...P........E.PPYP...........DDE.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sdraarrrrrrrnrsrntgd........................................................................
A0A0D1XL11_9PEZI/419-472               .............................rsRSRSR........IR.QgvpIVAAGL....G.S...A..A....V.A....G.L..Y...E...N..MK..ARKEAKE.L..............................SR.SR..S..RS...........Y.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrsr......................................................................................
A0A135SUF1_9PEZI/697-852               ...............................RSRSR........DR.S...VTRERT....Y.S...R..E....R.A....Y.S..R...E...R..ST..DDRMRNR.-..............................ER.ER..D..RR...........R.......Y..........EED..aRD........DGY.Y.DN.Y......--....-....S..........RPP.SP-...--..-.-PHASGGS.......F-.........--..-.--Y...P........P.PPAAaa.......gfTQH......pNIS.TA....NLR..D..QYPP......YPS..SDs.vY..PPG.....PPPM....GP...SPP.M.A.Tgga........ggyPP...............PP------...----------pagghpppgggppgtrfgpdhvsed...................................................................
S3CWZ7_OPHP1/711-838                   .............................nd-----........--.-...------....-.-...-..-....-.-....-.-..-...-...D..YD..HERHQSH.-..............................DR.HR..R..RD...........K.......H..........HDR..dDA........HGY.N.GG.Y......YD....H....D..........DSR.PP-...--..S.PPHVSGGA.......YY.........P-..-.---...P........A.PPMG..........sTDEl.....mQHP.NS....NIS..D..GYMS......YNP..HDqtnY..PPP.....PGP-....PP...SHQ.G.-.-..............--...............--------...----------savdrlygefapgtapgvpsphaggaa.................................................................
A0A063BU25_9HYPO/577-740               ............................rrsRSRSR........LR.G...MAEAGA....-.-...-..-....A.A....I.G..I...K...E..FK..DRHDTKH.Kerrer....................rsrsrSI.DH..H..RR...........G.......H..........DEG...--........SRI.G.DS.R......RD....Y....F..........DDA.VPR...PH..S.PPTASGGA.......YY.........PP..Y.SPT...P.......gG.PPMApad....nyvpYPE.......SHG.SA....PLR..K..EYKP......YVP..QD...Y..TGG.....----....--...---.-.-.-..............--...............--------...----------lsawtgsawtspaarrpapdwwesstrsygvnt...........................................................
S7ZET0_PENO1/503-650                   ...............................RRHSR........SR.E...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YS..EHRDRKK.Aers........................rsrSR.SR..S..RN...........R.......Y..........DDD..aHR........DPY.E.ES.Y......DP....V....P..........YPP.SP-...--..-.-PSTHQHQa....dpYY.........PN..N.NYF...P........P.PPGS...........TTN.......---.--....-LN..S..TPQP......YNP..AN...Y..PPP.....PGAA....PP...SQP.Y.S.Y.............gAP...............PAGADPYA...ARPRRADEN-k...........................................................................................
R8BUE6_TOGMI/691-750                   ...............................RSRSR........LR.D...LATGAA....A.A...G..A....A.A....I.G..L...K...K..YG..ESKEKKG.R..............................ER.ER..E..SR...........E.......R..........DDR...DR........E--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rdrdrerdrd..................................................................................
J3KI03_COCIM/287-350                   ..............................t-SRSR........AR.T...LAGLGL....G.A...A..A....I.A....G.A..V...A...L..AK..KHSEKSS.K..............................QR.SS..G..RR...........S.......R..........SHR...RR........SSS.A.SS.S......S-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dardpdh.....................................................................................
C6HTC0_AJECH/453-591                   erssrrashsrsrtrshhyrddgsrsgssfs-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..---DRGH.S..............................HK.NR..T..YA...........-.......H..........DHD...YS........DSY.E.DG.Y......EP....A....P..........YPP.SP-...--..-.-PSNGPN-.......YY.........AQ..G.SQF...P........P.PPGA...........APV.......P--.--....PPN..V..QPGP......YNP..AD...Y..PPP.....PGAA...pQP...PSN.Y.P.Y..............PP...............PPGVDAYA...PRSARGDENV............................................................................................
A0A074W448_9PEZI/322-398               ...............................RSRSR........VR.T...LAKVGT....V.A...A..V....G.A....L.A..A...Y...A..LR..NRGNKET.Vivnn.....................evpppRR.SR..S..RR...........R.......R..........S--...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------svgsappppldarsrseskhrdp.....................................................................
A0A139ISU8_9PEZI/431-506               .........................rsrsrsKSLSR........RQ.Q...LGSLAA....V.A...G..V....A.A....L.A..G...Y...A..LN..KNKNKET.Iivn.......................dghrRR.SR..S..RR...........R.......R..........HSV...--........DTY.V.SD.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eerehrdpgh..................................................................................
B8NBW3_ASPFN/412-514                   ...............................RSHSR........LR.K...ALPVVA....A.G...L..G....T.A....A.A..T...G...L..YE..KHKEKQE.Eg...........................eaSR.RR..E..RS...........R.......S..........RSR...--........-AP.S.EI.Y......-P....D....P..........TRD.SAGlieYG..Q.DPVHGRI-.......--.........PT..A.DYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------grptsqqayysdasdpavs.........................................................................
A0A074WG27_9PEZI/559-713               ...............................RSRSR........TR.G...LAEGAA....A.A...G..V....A.A....I.A..A...H...E..LG..KQNERRR.Sd............................rDR.DR..E..RR...........R.......R..........EEE...-D........EMY.A.HD.R......--....-....P..........YSP.PPMganAA..Y.PPTPQSHE.......FY.........PA..T.NSF...P........P.PPTD...........---.......-NY.GH....QAD..Y..PYQP......YNP..AD...Y..PPP.....PAAGg.atRG...RHD.E.R.Y..............PSpep........nlgyPPANETFA...GDARYAGD--dr..........................................................................................
A0A194X7G0_9HELO/634-780               ...............................RSHSR........VR.D...IAGAAA....G.T...A..A....A.A....I.G..I...N...Q..YK..KRKEKKE.A..............................ER.ER..E..RR...........R.......Y..........EEE...APp......eNYY.A.RN.Y......PD....D....G..........YSP.SP-...--..-.-PHASGGS.......YY.........PE..T.NQF...A........P.PPQApag.....fthHNN.......QST.PH....VNE..T..NIPP......YNP..AD...Y..AGQ.....---Q...pPN...HDP.Y.G.Y..............PP...............RTGDNVSN...DTTSR-----qtp.........................................................................................
W6XRN4_COCCA/587-743                   ...............................RSKSR........AR.A...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AT..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........EDS...--........AYS.T.GT.Y......-D....S....P..........YGS.PT-...-T..S.TAYTNDSR.......YF.........PE..T.NYF...P........P.PPNA...........---.......PAV.DP....NAH..S..PYPP......YNP..AD...Y..PPP.....PNNA...yEP...NHP.S.Q.Yi............hPPhsdvhvg.npyapppPQQHDAYY...GQPRRTDGNV............................................................................................
A0A093YVZ9_9PEZI/8-61                  ........................srsrsrsRSRSR........AR.D...VLGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RR...........A.......Y..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tpt.........................................................................................
A0A0S7DWY3_9EURO/377-477               ..............................sRSHSR........LR.Q...A--LPV....V.A...A..G....L.G....T.A..A...V...TglYE..KNKEKKE.E..............................DG.KR..R..ER...........R.......R..........SRS...RS........RAP.S.EA.Y......-P....D....P..........ARD.SAGlieYG..Q.HPVTGS--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ipaahyygrpasqqgyysdasdr.....................................................................
A0A150VE66_9PEZI/433-518               .......................krrsrsrsKSLSR........AQ.Q...LGGLAA....V.A...A..V....G.A....L.A..G...Y...A..LN..KRSNKET.Vivnn......................dgppRR.SR..S..RR...........R.......G..........AS-...VD........TYY.T.DE.R......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lshgggkalnpehrn.............................................................................
M7SU52_EUTLA/536-613                   ...............................RSHSR........IR.T...GAEIAA....-.A...G..L....T.G....A.A..A...S...K..LW..ERHKNKK.-..............................EH.KK..D..KE...........V.......D..........DD-...--........SYY.S.DD.R......SR....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srglvpvavpgveygsqpidlhdgy...................................................................
E9DDF0_COCPS/348-390                   ............................pdh----R........NR.R...MAEAGL...aG.A...A..V....A.G....L.V..D...H...V..RS..KSRSRKG.R..............................SR.SR..I..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tg..........................................................................................
G3JMF7_CORMM/253-331                   ....................ekssnlkwlgp-----........--.-...------....L.A...A..G....A.G....LwA..L...L...R..NG..KKKQNRE.R..............................SR.SR..S..RS...........R.......S..........PSS...YRtnpevlssRGY.S.ER.F......YD....D....K..........YSE.PPQ..rKS..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sggg........................................................................................
H1UXZ2_COLHI/641-843                   ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...Q..YQ..KRKEKDE.D..............................RY.EE..S..V-...........-.......-..........---...RD........DGY.Y.DD.Y......--....-....S..........RPP.SP-...--..-.-PHASGGS.......Y-.........--..-.--Y...P........P.PPAPta.......gfTQH.......PNIsTA....NLR..D..QYPP......-YP..QD...Y..PPG.....PPPM....GP...SPP.M.A.-..............--...............--------...----------tggaggyxppppaggpppsggpppgtrfgpdhvsdelsrsaspqdaqpveqqaeeearkqedppslseeqleslrpvlsrrrsssdpsssra
S3CWZ7_OPHP1/455-495                   .............................rp-KKSR........SR.S...VAKVAA...gT.A...A..V....A.G....I.V..H...H...F..RS..KSRQRDG.K..............................A-.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsh.........................................................................................
A0A0G2JAW1_9EURO/312-380               ........................rhrsrss-SDSR........VK.T...LASLGL....G.A...A..A....I.AgavaL.A..R...K...Q..SQ..KNAEKSN.N..............................-N.SR..S..RR...........S.......R..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srhrrgsesssgegkt............................................................................
A0A0A1TGS9_9HYPO/445-522               ...............................RSKSK........LR.R...GAEIAG....A.A...A..A....A.G....I.A..G...K...M..WK..NHQEKKE.R..............................SR.SQ..S..RA...........A.......S..........RDV..dDR........DHYgR.RD.Y......SR....S....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsrsiarshqsdrda...........................................................................
A0A0J8QS49_COCIT/28-142                ...............................RSRSR........IR.TgipIAAAGL....G.S...A..A....I.A....A.A..Y...E...K..NK.aKNEDKKE.K..............................ET.RR..A..RS...........R.......S..........RSKs.rAR........SSS.-.--.-......-E....S....Q..........VGV.PPHlieYG..D.DPVYGR--.......-I.........PA..S.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------graespyhtprkhthsrsrrspstdswss...............................................................
A0A0D2CBM0_9EURO/653-807               .............................ys-RRRS........SR.D...AAKMAA....A.A...G..A....G.A....V.A..A...S...E..YD..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........ENY...GH........DPY.E.DN.Y.....nPA....Q....Q..........YPP.TPP..pPV..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQ.......QQY.PP....QTS..T..PGPT.....aGNP..YGq.aY..PPP.....PPGP....PP...NTT.VpT.Y..............ET..............yATGANPYA...PRG-------penvsav.....................................................................................
N1PM89_DOTSN/650-820                   ..............................rRSRSR........GK.E...FATAGV....A.A...A..A....G.A....A.A..A...H...Q..YG..KSRERSR.S.............................rAA.SR..E..RG...........H.......N..........DRR...GS........GYY.D.DG.Y......GN....E....P..........YSP.PPD..dHY..I.QGNQQNAGyg..qqqSY.........PS..S.NYF...P........P.PPTG...........DQAy....geHAY.AQ....QPQ..Q..SYPA......YNP..AD...Y..ANQ.....PPQQ...hPY...ENT.RgA.Ygdsd......anlgQ-...............PYPGETYA...GDAR------ygtpdhnrg...................................................................................
A0A0D2DIH2_9EURO/472-589               ....................rsksrardgkeRSRSR........IR.Q..aLPVVAA....G.L...G..S....A.A....V.A..-...G...L..YE..KHKAKKE.Aee.........................ivdER.RR..A..RS...........R.......S..........RSRarsEH........AYY.D.GP.A......QA....A....M..........TDP.GLI..eYG..N.APMYGNN-.......FG.........PD..Y.YGR...P........P.PAD-...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyysnavvp...................................................................................
A0A161Y9K7_9PEZI/696-763               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...Q..YQ..KKKEKEM.D..............................ED.RR..S..RE...........R.......N..........ARS..rSR........D--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsisrdraysrdraysr...........................................................................
W9WD84_9EURO/496-601                   ...............................RSRSR........IR.Q..aLPVIAA....G.L...G..S....A.A....V.A..G...-...V..YE..KHKAKKE.Aeeivd...................knrrarSR.SR..S..RA...........R.......S..........EHS...--........AYY.D.GP.P......PP....Q....N..........DQS.LVE...YG..N.TPMYGNNFg....adYY.........--..-.--G...R........P.PPQE...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyyssavv....................................................................................
A0A168JB54_MUCCL/840-902               ...........................hykr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKES.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------glegahhtsgnplhpgsdnanrsvdgnndhhykrd.........................................................
A0A178AVN6_9PLEO/458-640               .............................rsRSHSR........IR.EgvpIAAAGV....A.G...A..A....G.A....V.A..V...TvevE..VE.vKIKQLTR.Qpna........................eiaKR.RK..R..SA...........R.......N..........DHT...ESspg.dedsAYS.T.GS.Y......--....S....P..........YDS.PRP...ST..A.HPNDSQ--.......YF.........PQ..S.TYF...P........P.PPTV...........PVN.......EPV.H-....-HN..A..PYPP......YNP..AD...Y..PPP.....PSTV...fEP...NHP.S.G.Yv...........haPPppsddlnhgnpyarpSANNQPYY...GQPRHPGDNV............................................................................................
C8V000_EMENI/175-307                   ...............................RHRSR........SR.D...LAGAAL....A.A...T..G....V.G....Y.A..A...H...K..YS..QHRKE--.-..............................DK.ER..D..RQ...........R.......Y..........DSD...GP........SLF.E.QP.F......SP....G....P..........YPP.SP-...-G..T.GPVDSSQ-.......YR.........PN..-.NYY...P........P.PPGP...........APA.......---.--....-PA..P..GPAH......YNP..AD...Y..PPP.....PNAV....PP...-QQ.Y.S.Y..............PP...............-PAADAYA...PRPRRADENV............................................................................................
A0A101ME91_9EURO/1-78                  .............................ma-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.-----DPH.......YY.........PN..N.NYF...P........P.PPGD...........STY.......---.-N....LNS..G..TPMS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaPPgp...........gpGPGPEQYA...PRPRRADDNV............................................................................................
A0A161Y9K7_9PEZI/566-695               ...............................RSKSR........IR.T...GAEVVA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKD.R..............................EV.DR..E..LSd.........hE.......Y..........EEE..aRR........ERR.E.RR.R......-S....R....S..........RSQ.ARS...VY..S.EPRSADPElg..lveYGt.......sPL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......MSG..DD...Y..DDP....eP---....--...---.-.-.-..............--...............--------...----------akk.........................................................................................
A0A074YPM7_9PEZI/306-384               ...............................RSRSR........AR.T...LAKVGT....V.A...A..V....G.A....L.A..A...Y...A..LR..NRGNKET.Vivnn.....................evpppRR.SR..S..RR...........R.......R..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------asvgsvpppldardrsrseskhrdpe..................................................................
A0A0D2FDQ0_9EURO/497-604               ...............................RSRSR........IR.Q..aLPVIAA....G.L...G..S....A.A....V.A..G...-...V..YE..KHKAKKE.Aeeive...................knrrarSR.SR..S..RA...........R.......S..........EH-...-S........AYY.D.GP.P......AP....P....T..........NEQ.SLV..eYG..N.TPMYGNN-.......-Y.........GA..D.YYG...R........P.PPQD...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyysnavvp...................................................................................
A0A0F8UEJ4_9EURO/530-673               ...............................RHRSR........SH.D...LAGAAL....A.A...T..G....V.G....Y.A..A...H...R..YS..QHKDRQA.A..............................EN.ER..E..RQ...........R.......F..........KDE..gRP........APY.D.EP.Y......NS....E....P..........YPP.SP-...AP..G.QPVDSSQ-.......Y-.........KP..G.NYY...P........P.PPGS...........APA.......---.--....LVA..S..GPAP......YIP..AD...Y..APPp..nvPAPA....PP...QQQ.-.-.Yy............pPP...............PAGPNTYA...PQSRAVDEN-s...........................................................................................
S3CWZ7_OPHP1/661-722                   ...............................RSQSR........LR.N...LAAGGA....A.A...A..A....A.A....I.G..I...K...K..YE..DKKKRDD.S..............................KR.RE..E..ER...........S.......R..........DDG...--........SVY.N.DD.Y......DH....E....R..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hqsh........................................................................................
W3XH82_9PEZI/247-324                   ..........................agsht-----........AR.D...GAGMAT....A.G...A..V....A.A....Y.A..A...H...H..HN..QHDSRSS.T..............................SK.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ptgsgidptdsdpragqtsidrngsrqchqnerddssalhh...................................................
A0A178E8Z5_9PLEO/580-633               ...............................RSKSR........AR.T...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AA..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........STN...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rpprkts.....................................................................................
E9E4W9_METAQ/460-561                   ...............................RSKSR........LR.R...VAEIGG....V.A...A..A....A.G....V.A..N...K...L..WQ..SHKEKKE.Hardps....................assddE-.--..Y..YR...........R.......R..........DSR..sR-........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hrslsgsrhrsrsrsmarspysqpgadpelglveygndplypesrd..............................................
A0A0C9MGZ4_9FUNG/278-317               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHQNQQ-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------fgfanhragnnpiqs.............................................................................
A0A0D1XL11_9PEZI/537-689               ...............................RSRSR........SK.G...LAEVAA....A.A...G..V....A.G....V.A..A...H...E..LT..KRRERRR.-..............................--.ER..E..RR...........R.......Q..........EEE..aAA........AAS.N.SE.Y......TS....T....T..........DAN.SP-...--..-.--------.......YY.........PA..S.NHF...A........P.PPNAaeg....gyppMNH.......PND.SA....YYS..N..PVPP......YNP..AD...Y..GPT.....TGPT...lPR...DDP.Y.A.Q..............PYnqqh......hdnfaTPHQDPYS...PKNK------dprapenv....................................................................................
M1W061_CLAP2/575-717                   .............................rkRSKSR........LR.D...MAAAGA....-.-...-..-....A.A....I.G..I...K...D..FK..DRHDRKG.Kd...........................rrDS.RS..S..RS...........R.......D..........DDD...RRh.....heGAS.R.RD.Y......--....-....F..........DDA.GPR...PH..S.PPTASGGA.......YY.........PP..-.--Y...P........P.TPGDhpma..sganyTPYp....ggQGG.RS....MSG..A..EFQP......YVP..QD...Y..TGYa..ppPPP-....PP...---.-.-.-..............--...............--------...----------agpppmpse...................................................................................
F9XE98_ZYMTI/399-476                   .............................rsRSRSRsf....nrTQ.K...LGGLAA....V.A...A..V....A.A....L.G..A...Y...A..LK..NRNNKET.Vivk.......................eqppRR.SR..S..RR...........R.......R..........SS-...--........--Y.D.S-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------apssvrpgsehrspdh............................................................................
G0SEH0_CHATD/522-587                   ...............................RSRSR........LR.T...VAEMTA....-.A...G..L....A.G....A.G..A...K...K..LY.dSHKEKKE.A.............................kER.ER..D..RD...........R.......G..........ESD...YE........SEF.E.RD.R......RR....R....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------drshsh......................................................................................
G4N0D9_MAGO7/696-761                   ...............................RSKSR........LR.E...MAAAGA....G.A...A..A....A.A....I.G..L...K...G..IQ..KRREKSK.E..............................RD.EE..E..ER...........R.......H..........EDE...MR........ERD.R.DR.D......RD....R....P..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnrsrv......................................................................................
A0A0D2CBM0_9EURO/501-610               .............................reRSKSR........VR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aeqi.......................vkdeRR.AR..S..RS...........R.......S..........RAR...SD........AYY.D.GP.R......EG....A....I..........SDP.GLI..eYG..A.GPMYGNN-.......YG.........PD..Y.YGR...P........P.PPEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygasnavvp...................................................................................
A0A0U1M4K8_9EURO/488-632               .............................reRSGSR........IR.D...FAEAGL....A.A...A..G....L.G....Y.A..A...N...K..IS..GKKDRKD.K..............................EH.RR..R..SR...........H.......G..........NDR...EH........DSY.E.EP.Y......DP....A....P..........YMP.SP-...PP..A.GPAPGGDN.......YY.........PY..T.NSF...P........P.PPGA...........TSN.......---.--....-P-..-..GSMP......YPP..TE...Y..APP.....PGAG....PV...PQP.Q.G.Y..............PPpp...........gpPPTSEPYA...PQPRRADENV............................................................................................
N4VHF5_COLOR/501-607                   ...............................RSKSR........IR.T...GAEIAA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKE.R..............................EI.ER..E..LS...........-.......-..........DEE..yEE........DLR.R.ER.R......-A....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rrrsrsrsqarsiyseprsadpelglveygtsplprdppyplddgyasatd.........................................
A0A0G2EJI4_9EURO/637-779               .............................khRSRSQ........SH.D...LATAGV....A.A...A..G....G.A....L.A..A...N...E..YQ..KRKERKR.Aek..........................eaRR.EE..R..RR...........R.......E..........AEA..aHQ........EPY.E.EG.Y......DP....A....P..........YVP.---...--..-.-PAQD--Q.......YY.........PQ..S.NNF...P........P.PPGA...........VPQ.......E--.--....-YP..Q..QQNP......YNP..GD...Y..QAH.....PGSI....PQ...-PG.T.A.Y..............NPsy...........paNPAV-DQY...GRPRRGDENV............................................................................................
A0A0L1J2N0_ASPNO/527-588               ...............................KHRSR........SR.D...LTEAAL....A.A...T..G....V.G....Y.A..A...H...K..YS..QRRERKK.A..............................EQ.ER..E..RP...........R.......F..........DED..tRQ........DSY.G.EP.F......S-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lnhi........................................................................................
Q0UZC8_PHANO/537-676                   .....rrlrrnaindvslptanietsctess-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......P..........GDE...DS........AYS.T.GS.Y......SP....Y....D..........SPR.PST..tST..S.HPNDSR--.......FF.........PE..S.NYF...P........P.PPTA...........---.......P-I.DH....Q--..A..PYPP......YNP..AD...Y..PPP.....PSTT...fEP...SHP.S.T.Yv............hPPhddinh..gnpyappQHQSNYYY...GQPRRPDDNV............................................................................................
A0A0D2DS24_9EURO/644-801               ............................rgg--RRH........SR.D...AAKMTA....A.A...A..A....G.A....I.G..A...S...E..AE..RRKQERR.D..............................RR.AR..R..RQ...........Q.......E..........EGY...GR........DPY.E.DNnY......NP...gA....Q..........YAP.TPP..pPG..N.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGS...........IPQq.....yPPQ.AApgmaPPA..P..GPAP......YAQ..QG...Y..PPPp...pPPGA....PP...PPG.Q.P.Y..............DA..............yASGANPYA...PRG-------penv........................................................................................
A0A0B7N6U1_9FUNG/281-349               .........................dhhrtr-----........--.-...--DAAL....G.A...S..T....N.G....V.A..G...S...E..MQ..KHPNENK.N..............................TS.SS..Q..VR...........A.......S..........NNS...SP........KSS.T.EK.K......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gaaahdkplntggdahh...........................................................................
U4LPE7_PYROM/462-545                   .............................rn-RSSR........SG.T...LAKAAA....V.T...M..A....G.A....L.A..E...R...Q..LH..NHRSRSA.D..............................AA.AR..R..RQ...........R.......H..........AEG..eKR........VHY.R.NR.E.....qGD....G....N..........YES.SIH...--..-.-PE-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ssvsnnphrrrgs...............................................................................
M1W061_CLAP2/430-517                   ...............................RSKSR........LR.R...VAEIGG....V.A...A..A....A.G....V.A..N...K...L..WK..SHNDKKE.R..............................AR.SR..S..VG...........G.......V..........DDD...N-........YPR.H.D-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrgryrslsrsrhrsrsrsivpspysqagadpe.........................................................
A0A094JE74_9PEZI/406-494               ...............................RSKSR........IR.T...GAELAA....A.G...L..A....T.A....A.A..A...G...L..YE..RRKAKQE.Gergvs....................rslsrSK.SR..S..RS...........R.......G..........GRR..kLD........DDY.E.RP.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------glveygaqplhsrglergyadqr.....................................................................
C4JEK8_UNCRE/306-416                   ...............................RSRSR........IR.TgipIAAAGL....-.-...G..S....A.A....I.A..A...-...M..YE..KTKAKKE.E..............................NK.EK..E..AR...........R.......A..........RSR..sRS........KSR.A.RS.Y......PD....A....P..........AGV.PTHlieYG..E.DPVYGR--.......-I.........PA..S.DYY...G........R.P---...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------esphyvarrhsrssrsrrrsps......................................................................
A0A166MYR9_9PEZI/514-645               .............................rsRSKSR........IR.T...GAEVVA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKD.R..............................EL.DR..E..LSd.........hE.......Y..........EEE..aRR........ERR.E.RR.R......SR....S....-..........RSQ.ARS...LY..S.EPRSADPElg..lveYGt.......sPL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......MSG..DD...Y..DDP....eP---....--...---.-.-.-..............--...............--------...----------akk.........................................................................................
A0A0S7DWY3_9EURO/522-657               ...............................KHRSR........SR.E...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YK..QSRDRKK.-..............................-E.ER..E..RS...........K.......Y..........DD-...--........DSY.P.SS.Y.....pSD....L....P..........YPP.SPL...PP..T.QPGENP--.......YY.........PN..S.NYF...P........P.PPGS...........TPA.......---.--....-PA..A..PAAP......YNP..AD...Y..PPP.....PGAV....PP...AQS.Y.G.Y..............PP...............EPGPDRYA...PRPRRADENV............................................................................................
A0A0D2DIH2_9EURO/629-789               .............................dr-SRRR.......hSR.D...AAKMTA....A.A...A..A....G.A....I.G..A...T...E..YE..KRKQERR.E..............................RR.AR..K..RR...........-.......E..........EDG..yGR........DPY.E.DN.Y......NP...gA....Q..........YAP.TPPppgPV..N.DPYASQQG.......FY.........PQ..S.SQF...P........P.PPGA...........VPQp....ypPQA.GP....GTA..P..---Pg...aaPYP..AQ..aY..PPPp...pPPGA....PP...APA.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsae.....................................................................................
A0A0L1HW30_9PLEO/562-719               ...........................rsrsRSKGR........AR.S...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AT..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........EDS...--........AYS.T.GT.Y......--....S....P..........YDS.PTP...ST..A.HPNDSQ--.......YF.........PQ..T.NYF...P........P.PPNV...........---.......-PV.DH....NAH..A..PYPP......YNP..AD...Y..PPG.....PQSA...yEP...NHP.S.R.Yv............nPPhddvhv..gnpyappPQHHEPYY...GQPRRADGNV............................................................................................
C1GDB7_PARBD/522-661                   ...............................RSRSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKK.A..............................EK.GR..R..KY...........A.......R..........DHD...YT........DSY.E.EG.Y......DP....V....P..........HVP.SP-...--..-.-PPNGAN-.......YY.........PH..S.NHF...P........P.PPGS...........TPV.......P--.--....-PN..H..QGGP......YNP..AD...Y..PPS.....PGAP...pMT...QAN.Y.S.Yp............pPP...............PPAADPYS...PRSINGEENV............................................................................................
C5G976_AJEDR/468-605                   ...............................RSRSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKK.A..............................EK.ER..R..TY...........P.......H..........DHD...YL........QSF.E.EE.Y......EP....S....T..........YVA.SP-...--..-.-PLNSP--.......YY.........PQ..E.NRF...P........L.PPGS...........TPI.......PP-.-P....PPN..V..QPGP......YNP..AD...Y..PPP.....PAAA....QP...PPN.H.P.Y..............PP...............PPGGDSSA...PRT-RADEN-k...........................................................................................
A0A163HMV4_DIDRA/593-755               ...............................RSKSR........AR.S...VAETAA....V.A...S..V....A.G....L.A..A...H...E..AA..KRRDRKK.A..............................EK.ER..D..RR...........H.......E..........DES...--........AYS.Q.GS.YspggrySP....G....Q..........YSA.---...GQ..Y.SPGQSTARpn..dshYF.........PE..T.NYF...P........P.PPTA...........-PV......gHVD.GN....LPN..A..PYPP......YNP..AD...Y..PPQ.....NGHG....PP...PPG.G.G.Yvh.........edmNPgn...........pyARQDQNHY...HQARRGDENV............................................................................................
G3JMF7_CORMM/459-600                   ............................ggg-----........--.-...VAKGIL....G.G...L..G....M.G....W.I..A...K...K..LA..DRRNKKQ.E..............................ER.LR..E..--...........-.......E..........DDM...RS........GTN.V.SR.F......TG....D....G..........YPS.PTR...DS..R.RPPPVRRQt.....gY-.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gasygtdtalsemtessidhpprvgarsdniqpvpmplrpprssgppvsepvsmpsmpadphgvlhsgae......................
F7W3Z0_SORMK/764-824                   ...............................RSKSR........LG.R...LAAGAA....A.A...G..A....A.A....I.G..I...K...K..LG..DNKDKKD.N.............................kEK.ER..E..RE...........R.......E..........REK...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ggdkeiereerdi...............................................................................
A0A0D2K9Q9_9EURO/477-584               .............................keRSRSR........IR.Q..aLPVVAA....G.L...G..S....A.A....V.A..-...G...L..YE..KHKAKKE.Aeg.........................iadER.RR..A..RS...........R.......S..........RSRa.rSE........NPY.Y.DQ.G......QG....A....I..........NDP.GLI..eYG..N.APMYGNN-.......YG.........PD..Y.YGR...P........P.PQD-...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyysnavvp...................................................................................
M7SU52_EUTLA/643-785                   ...............................RSRSR........LR.E...VAAGVL....G.T...G..A....A.A....I.G..L...K...K..YQ..DRQKSKD.R..............................DR.DR..D..RD...........R.......K..........RDE...-K........PRY.E.DE.A......QP....D....P..........YYS.DY-...DV..E.APPSP--H.......YA.........SG..G.AYY...P........P.PPGP...........APPp.....aTMP.TP....PPT..G..PAGP.....gAAP..GD...F..VQH.....PNQS....-T...MNL.N.A.Y..............PP...............PPPLNTYN...PQD-------ytni........................................................................................
H0EK30_GLAL7/414-499                   .............................rs--RSRsssrhshtK-.-...-VKTALg.laV.A...G..L....A.A....A.A..A...A...K..YV..SNRNQNK.Ee............................lGR.GR..S..RT...........R.......S..........RGR..gRS........SSY.S.SD.Y......GS....R....A..........RSK.SV-...-H..T.DPKH----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnat........................................................................................
U4LPE7_PYROM/209-267                   .............................rsRSSHR........VR.H...LAEAGL....A.A...G..G....A.K....I.L..Y...D...R..HR..AHQQGAH.S..............................AH.SS..H..HS...........H.......H..........SAH...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sshshsdphh..................................................................................
A0A177D9J9_ALTAL/354-428               ...............................RSKSR........VK.E...LGTLAA....L.A...G..V....G.A....L.A..Y...A...A..GQ..-RNKNKT.Avkeet....................vtvieDR.HR..S..RS...........R.......H..........GGR...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrksrrrhrsvsavgsd.........................................................................
A0A0G4PFU6_PENCA/547-696               ...............................KHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......R..........DDH..vHR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..tAP..G.APPMADPH.......YY.........PN..N.NYF...P........P.PPGD...........STY.......---.-N....LNS..G..TPVS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaPPgp...........gpGPAPEQYA...PRPRRADDNV............................................................................................
U4LPE7_PYROM/400-461                   ........................stssneg-----........SH.K...LRNAAL....G.I...G..A....A.G....L.A..A...H...H..HR..KKKEREA.-..............................EE.RR..T..RS...........R.......S..........R--...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srpgilrrlsrsysap............................................................................
R0K5Y5_SETT2/335-402                   .............................rhRSRSR........AK.E...IGTLAA....I.A...G..V....G.A....L.A..Y...A...A..GQ.rNKKVNKE.Etvt........................iieDR.HR..S..RS...........R.......H..........GRS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hhtrgrrrsrsv................................................................................
A0A0J6Y2F6_COCIT/287-350               ..............................t-SRSR........AR.T...LAGLGL....G.A...A..A....I.A....G.A..V...A...L..AK..KHSEKSS.K..............................QR.SS..G..RR...........S.......R..........SHR...RR........SSS.A.SS.S......S-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dardpdh.....................................................................................
A0A0F4YIE0_TALEM/493-600               ...............................RSSSR........IR.D...LAEAGL....A.A...A..G....V.G....Y.A..A...S...K..YA..ERKEKKK.Kadk........................erhSR.ER..E..RR...........R.......N..........ESD..rEH........DSY.E.EQ.Y......DH....A....P..........YAP.SPPv.gIA..G.EPA--E-N.......YY.........PY..T.NRF...P........P.PPGA...........HNL.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------geyrppps....................................................................................
A0A0J8RJW6_COCIT/382-491               ...............................RSRSR........IR.TgipIAAAGL....G.S...A..A....I.A....A.A..Y...E...K..NK.aKNEDKKE.K..............................ET.RR..A..RS...........R.......S..........RSKs.rAR........SSS.-.--.-......-E....S....Q..........VGV.PPHlieYG..D.DPVYGR--.......-I.........PA..S.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------graespyhtprkhthsrsrrspst....................................................................
Q2TZD9_ASPOR/304-373                   ......................rsrsrshsh-SHSR........AR.T...LAELGL....G.A...A..A....I.A....G.A..V...A...L..AR.nKSKDERR.-..............................SR.SR..H..RS...........R.......S..........RHH...R-........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sssvrsgkttdgek..............................................................................
A0A0D2CID4_9EURO/495-604               .............................keRSRSR........IR.Q..aLPVIAA....G.L...G..S....A.A....V.A..-...G...V..YE..KHKAKKE.Aeeive...................knrrarSR.SR..S..RA...........R.......S..........EH-...-S........AYY.D.GP.P......AP....P....T..........NEQ.SLV..eYG..N.TPMYGNN-.......-Y.........GA..D.YYG...R........P.PPQD...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyysnavvp...................................................................................
M3CFH9_SPHMS/662-825                   .............................srRSRSR........-R.G...LASAGAl..gA.A...G..V....G.A....V.A..A...H...E..WS..KRRERSR.-..............................SR.SR..S..RS...........R.......H..........GDR...RRd......dDDY.Y.DD.R......RD....D....H..........YGA.PPM...NS..S.DPYNNNPYqq..ggqQY.........PS..S.NYF...P........P.PPNAd........ytQPR.......GNI.EP....QPE..Y..AHAHa....pYNP..AE...Y..ANQ.....PATQ...qPY...DPQ.Y.GgY.............gEP...............-YPSDPYA...GDQRYPHD--ph..........................................................................................
A2QKM3_ASPNC/301-373                   ......................rsrsrsrsh-SHSR........AR.H...LAELGLgaaaI.A...G..A....V.A....L.A..R...S...K..SN..SNKDRRS.R..............................SR.HR..R..AS...........S.......S..........RRS...LR........DTH.E.EK.R......SQ....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sqr.........................................................................................
T0KDB4_COLGC/499-614                   ...............................RSKSR........LR.T...GAEIAA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKE.R..............................EI.ER..E..LSd.........eE.......Y..........EED..lRR........ERR.R.SR.R......RS....R....S..........RSQ.ARS...LY..S.EPRNADTElg...lvEYg......taPL..P.SEP...P........Y.PPDD...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gyesaanerrrrrhr.............................................................................
B8M1D8_TALSN/314-354                   ...............................RSKSR........NR.H...IAAAGL....-.A...G..A....A.A....A.G..I...I...E..KV..RSRSRPR.-..............................SK.SR..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------irqg........................................................................................
A0A0D2E8L9_9EURO/496-603               ...............................RSQSR........VR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aeli.......................akdgRR.AR..S..RS...........R.......S..........RAR...SD........AYY.D.GP.R......EG....A....V..........SDP.GLI..eYG..N.GPMYGNN-.......FG.........PD..Y.YGR...P........P.PPEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygtsnavvp...................................................................................
C4JEK8_UNCRE/550-601                   .......................lhqcrrqi-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..-KSH......ITP..AD...Y..PPP.....PGAP....PP...PQH.Y.H.Y..............AP...............PTAQDPYA...PRQPRGDENV............................................................................................
A0A168JB54_MUCCL/900-942               .............................kr-----........--.-...--DAAL....G.A...A..G....T.G....L.A..A...H...E..MK..DHHDKKE.A..............................AS.NR..S..S-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------vssvgsgekk..................................................................................
A0A0S8B8E0_9CHLR/2-80                  ..............................m----R........RR.R...VGRAVV....G.T...A..V....V.A....G.T..A...G...A..VH..HHQDKKW.A..............................AQ.DA..Q..QQ...........A.......E..........YDD...--........EQY.E.EE.P.....aEQ....E....Q..........YAP.TPQ..qAP..A.APGS----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dmtdqlqql...................................................................................
G2QTJ0_THITE/700-864                   ...............................RSGSR........LR.D...LAAGAA....A.A...G..A....A.A....I.G..I...K...K..FN..ERRAKEK.Ereekaea...............erekdrerNR.ER..E..RD...........K.......G..........KER...DR........RRY.D.AE.A......SA....D....E..........YDG.YGR..rGA..S.PPNASGGF.......YN.........PP..P.PAP...P........A.PPAGmn.......gfTQH.......P--.NV....ATT..N..LHQQ......YTP..--...Y..PGP.....-GNV....DF...TA-.-.-.-..............--...............--------...----------mpapppnsagvpdgapppfnpkdpeh..................................................................
E9DDF0_COCPS/510-672                   ...............................RERSR........SR.D...LATAGL...aA.A...G..A....A.G....L.A..A...H...K..YA..QRKERKK.N..............................ER.DR..R..RD...........E.......G..........EA-...RQ........DSY.D.DT.Y......ST....T....P..........YPP.SPP...RP..S.ASLYPQGN.......YY.........PQ..T.TQF...PqspnqttgP.PPGH...........YQY......pPSN.YP....PPG..T..ASMPppnhvsHNP..AD...Y..PPP.....PGAP....PP...AQH.Y.N.Y..............PV...............PPAQDPYA...HLQPRGDENV............................................................................................
U7PSX9_SPOS1/496-646                   ...............................RSHSR........LR.T...GAEIAG....A.A...L..A....G.A....A.A..K...K...L..YD..KHKDKKQ.L..............................ER.EQ..K..EA...........A.......Y..........YSD...DP........YSE.D.DR.Y......SR....Hg.rgS..........RSH.SRN...RS..A.APSQSPPP.......L-.........SG..A.TRT...P........Y.PPSG...........A--.......---.--....DPE..L..GLVE......YGD..QP..lY..ADP.....----....--...---.-.-.-..............--...............--------...----------gapardgaivghrgsydsaadaserddrrarrrhrhsrn.....................................................
A0A084G042_9PEZI/442-486               ...............................RKRSR........SR.S...IAKAAL....A.T...A..A....T.A....G.V..L...K...H..LR..NRSKSKS.R..............................SR.SR..S..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------vksqs.......................................................................................
W6XRN4_COCCA/345-431                   ...............................RSKSR........AR.E...LGTLAA....I.A...G..V....G.A....L.A..Y...A...A..GQ..RNKAKTK.Eetv.......................tiieDR.HR..S..RS...........R.......H..........RSK...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srhrrgrrksrsvsvvsdrsrsrstskhmdpeh...........................................................
A1DGB5_NEOFI/392-493                   .............................gsRSHSR........LR.Q...A--LPV....V.A...A..G....L.G....T.A..A...V...TglYE..KNKEKKE.E..............................DG.KR..R..ER...........R.......R..........SRS...RS........RAP.S.EA.Y......-P....D....P..........ARD.SAGlieYG..Q.HPVTGS--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ipaahyygrpasqqgyysdasdr.....................................................................
S3DTS4_GLAL2/454-537                   .............................rs--RSS........SR.HshtKVKTALg.laV.A...G..L....A.A....A.A..A...A...K..YV..SNRNQNK.Ee............................lGR.GR..S..RT...........R.......S..........RGR..gRS........SSY.S.SD.Y......GS....R....A..........RSK.SV-...-H..T.DPKH----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnat........................................................................................
A0A0D2DIH2_9EURO/370-453               ............................rrr-SRSRsss..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSK.D..............................EG.DR..G..RS...........R.......S..........RSR...RR........RES.V.SS.L......ED....D....P..........DAP.TD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rnt.........................................................................................
B6H242_PENRW/542-687                   ...............................KHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......H..........DDV...HR........DPY.E.ES.Y......DP....E....P..........YPP.SPQ..rAP..G.APPMADPH.......YY.........PN..S.NYF...P........P.PPGD...........STY.......---.-N....LGG..G..TPVS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........avPP..............gGPGPDQYA...PRPRRAEDNV............................................................................................
A0A135U1E0_9PEZI/645-691               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..L...K...Q..YQ..KKKEKEE.E..............................IR.EE..R..RS...........R.......E..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsa.........................................................................................
S3DTS4_GLAL2/755-867                   .............................sg-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......Y..........EEE..pPD........DYY.S.RD.Y......VD....D....G..........YSP.SP-...--..-.-PHASGGS.......FY.........PD..H.NQF...Q........P.PQQPayt.....pgfTQH.......-PN.LS....TPN..V..GQSPl...ptYNP..AD...Y..APGt...gPAPQ....PP...HDP.Y.G.Y..............PPt.............vPRSGDNVS...PRTT------thqy........................................................................................
W9Y839_9EURO/636-791                   ..............................gRRRS-........SH.D...AVKTAA....A.A...G..A....G.A....I.A..A...S...E..YE..RHKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEG..yGH........DPY.E.DN.Y.....nPA....Q....P..........YPP.TPP..pPA..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGS...........VPQq.....yPPQ.QT....TPT..A..GPAAg....tSYP..AQ..pY..PPP.....PPASg..pPP...PTT.T.P.Y..............DA..............yGSGANPYA...PRG-------penvs.......................................................................................
A0A063BU25_9HYPO/461-568               ...............................RSKSR........LR.R...AAEIGG....V.A...A..A....A.G....V.A..N...K...L..WN..DHKEKK-.-..............................DR.SR..D..LS...........E.......S..........GDD...--........DYY.R.RR.R......ST....S....G..........RRR.SPS...GS..L.VEYGTD-P.......LY.........PA..S.RVA...P........A.PRDL...........DP-.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eaedrraerrrrrrrdpsvs........................................................................
S7ZET0_PENO1/261-334                   ......................rsrsrsrsq-SHSR........AK.T...LLELGL....G.A...AavA....A.G....V.A..A...L...K..SK..SDNDRRS.R..............................SR.NR..S..HS...........R.......S..........GSR...LR........ALS.R.S-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsekdkdgeg..................................................................................
A0A059J342_9EURO/567-700               ...............................RSRSRhgn..gnlAA.G...LAAAGL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgap..ppgpPG..G.RGY...P........P.PPGP...........---.......---.--....---..-..---P......--P..GP..gY..FGG.....PGP-....--...---.-.G.G..............PP...............VYRGDENV...PQPSRQHQN-g...........................................................................................
A0A0D1Z4Z7_9EURO/479-597               ...............................RSRSR........IR.Q..aLPVVAA....G.L...G..S....A.A....V.A..-...G...L..YE..KHKAKKE.Aeeiad...................drrrarSR.SR..S..RA...........R.......S..........EH-...--........AYY.D.GP.G......QG....A....V..........NDP.GLI..eYG..N.APMYGNN-.......YG.........AD..Y.YGR...P........P.PPDG...........YYS.......NAV.VP....AA-..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tgpaagygaq..................................................................................
Q0C9I2_ASPTN/296-361                   ........................rsrsrsh-SHSR........AR.T...FAEIGL....G.A...A..AiagaV.A....L.A..R...N...K..SK.sDRRSRSR.H..............................RR.SA..S..V-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------kstregdekrsesq..............................................................................
B8NBW3_ASPFN/561-699                   ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YT..QRRERKK.A..............................EQ.ER..E..RP...........R.......F..........DED..aRQ........DSY.G.EP.Y......SP....E....P..........YQH.TA-...--..L.PPQSSEHQ.......YY.........PN..T.NYF...P........P.PPGS...........APR.......---.--....-PA..G..STAP......YNP..AD...Y..PPP.....PVAV....PP...SQQ.Y.G.Y..............PP...............-PGPESFV...SRPRRADENV............................................................................................
A1CSM6_ASPCL/293-357                   ........................rsrsrsh-SHSR........AK.T...LAEIGL....G.A...A..A....I.A....G.A..V...A...L..AR..KKSKNDR.R..............................SR.SR..H..RR...........A.......S..........SSS...RP........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ekdaksekgs..................................................................................
E9DDF0_COCPS/287-350                   ..............................t-SRSR........AR.T...LAGLGL....G.A...A..A....I.A....G.A..V...A...L..AK..KHSEKSS.Q..............................QR.SS..C..RR...........S.......R..........SHR...RR........SSS.A.SS.S......S-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dardpdh.....................................................................................
A0A093Y5R9_9PEZI/1015-1087             ...............................RSRSR........VR.D...VVGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RR...........Y.......S..........S--...--........DSY.P.SS.R......RS....A....D..........YSP.SP-...--..-.-PHASGGA.......YY.........PH..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------p...........................................................................................
K9FWG0_PEND2/304-377                   ........................rsrsrsh-SHSR........VK.T...LIELGV....G.A...AavA....A.G....V.A..A...L...H..SK.sKAEERKD.R..............................SR.SR..T..RT...........R.......-..........-SR...S-........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rafsrgrsekdgdhgersm.........................................................................
A0A0F4GXD0_9PEZI/303-351               ...........................rsrsRSQSR........KR.S...LATGAL....-.-...A..G....A.G....A.A..A...I...L..GQ..HRKKQGH.E..............................ES.HR..G..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------nvlgga......................................................................................
A0A074WG27_9PEZI/325-402               ...............................RSRSR........AR.T...LAKVGT....V.A...A..V....G.A....L.A..A...Y...A..LR..NRGNKET.Vivnn.....................elpppRR.SR..S..RR...........R.......R..........S--...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------svgsapppldarnrsrseskhrdp....................................................................
B6Q8Z7_TALMQ/273-331                   ........................rsrsrss-SHSR........AK.T...LAGIGL....G.A...A..A....L.A....G.A..V...A...L..AR..NRTQDDR.R..............................SR.SR..H..RR...........R.......S..........QSR...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ggdaas......................................................................................
C4JEK8_UNCRE/432-491                   .........................rskrsg--RSR........SR.D...LATAGL...aA.A...G..A....A.G....I.A..A...H...E..YK..QRKERKK.N..............................ER.DR..G..MN...........K.......R..........KR-...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ksrpvictm...................................................................................
A2QKM3_ASPNC/397-504                   ..........................rsrsrRRESR........SH.S...AIRKALp..vV.A...A..G....L.G....T.A..A...A...TglYE..KNKEKKE.E..............................EE.SR..R..RE...........R.......R..........RSR..sRS........RAP.S.EV.Y......-P....D....P..........TRD.SPG..lIE..Y.G-------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dhpvhgsippnyygrpvsphgyysdasd................................................................
C1HCJ5_PARBA/372-473                   ...............................RSRSR........IR.Q..gLPIAAA....S.L...G..S....A.A....I.A..G...-...L..YE..KHKEKKE.N..............................ES.SQ..R..HH...........R.......R..........RSR..sRS........VVP.S.SA.Y......-S....D....P..........SGS.APQlieYG..D.DPVYGS--.......-I.........PT..N.HYY...G........R.P---...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ssrqsspraiessf..............................................................................
S2JHI7_MUCC1/200-279                   .........................dhhykr-----........--.-...--DAAL....G.A...G..T....A.G....L.A..G...H...E..MK..NHHDHQS.G..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lnnhhassnplqpglghnnyegaidnplqsetdklhqsskdndhhykrd...........................................
A0A066XKL1_COLSU/488-525               ...............................KSKSR........SR.S...VAKAAA....AtA...A..A....A.G....L.V..Q...H...F..RD..KSKSRSR.-..............................--.--..S..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rs..........................................................................................
S2JHI7_MUCC1/469-529                   ..........................ndhhy-----........KR.D...AAIGAG....A.A...G..A....A.G....V.A..G...H...E..MK..EHHDKEA.-..............................SS.NR..T..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------svssagsgekkgaavhdkplnt......................................................................
U4LPE7_PYROM/261-323                   .........................shsdph---HR........AR.H...LAEAGL....G.A...A..A....L.V....G.A..D...K...L..YS..RRRSQVR.Srpgsrp.................gsrssssDR.SR..S..RS...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsr.......................................................................................
A0A0D2APJ8_9EURO/500-608               .............................reRSKSR........VR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aeqi.......................vkedRR.AR..S..RS...........R.......S..........RAR...SD........AYY.D.GP.R......EG....A....I..........SDP.GLI..eYG..A.GPMYGNN-.......YG.........PD..Y.YGR...P........P.PPEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygasnavv....................................................................................
W9XB18_9EURO/486-592                   ...............................RSRSR........VR.Q..aLPVVAA....G.L...G..S....A.A....V.A..-...G...L..YE..KHKAKKE.Aee.........................ivdER.RR..A..RS...........R.......S..........RSRarsEH........AYY.D.GP.N......QG....A....I..........NDP.GLI..eYG..N.APMYGNN-.......YG.........PD..Y.YGR...P........P.PQ--...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dgyysnavvp..................................................................................
W9XLQ4_9EURO/630-790                   ..........................rskhgR-RRS........SH.D...AAKMAA....A.A...G..A....G.A....I.A..A...T...E..YE..KRKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEG..yAG........DPY.E.DN.Y.....hPS....Q....P..........YPP.TPP..pPV..N.DPYAAQQG.......FY.........PQ..T.SQF...P........P.PPGS...........VPQq.....yPPQ.QP....PPT..A..GPAAg....tSYP..TQ..pY..PPP.....PPAG...gPP...PTT.N.P.Y..............DA..............yGSGANPYP...PRG-------penvsde.....................................................................................
M2ZPK6_PSEFD/811-967                   ...............................RSRSR........RR.N...LAEAGA....A.A...G..V....A.A....V.A..A...H...E..IG..KRRERSR.A..............................SR.SR..E..RR...........R.......P..........ED-...--........DYY.D.DR.R......AD....D....P..........YAP.PPM..gNS..Y.PPYQNNDPya...qqAY.........PG..A.NYF...P........P.PPNG...........ETS.......GYV.EP....QPA..Y..AHAQ......YNP..AD...Y..AGQ.....PATQ...aPY...DHQ.Q.A.Ydg..........ygEPy.............pGQSHHNYA...RDTQY-----gdegr.......................................................................................
K2S5L1_MACPH/581-741                   ...............................RSRSR........SR.A...VAEAAA....L.A...G..V....A.G....V.A..A...H...E..AA..KRRERKK.A..............................EK.KE..K..KR...........V.......E..........EER...--........PFS.E.DG.Y.....gSP....P....P..........QGY.PPE..pYP..P.GPYQPDNG......rYY.........PE..S.NQF...P........P.PPQG...........YDPa.....mQQN.VY....EPA..HygGPAP......YNP..AD...Y..GPN.....PGPT...qPA...YAH.Q.Q.Qap..........yfPPp............prEPQQEYYD...DRGHHHGDD-n...........................................................................................
W9XLQ4_9EURO/374-457                   .........................rsrsrrRSRSRses..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...A...I..AS..KRMNKDK.E..............................EP.RR..S..RS...........R.......H..........RTQ...--........--S.V.SS.L......EN....D....P..........SAP.SD-...DA..R.NPKHR---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------nkr.........................................................................................
E5AFM9_LEPMJ/591-727                   ...............................RSKSR........AR.S...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AA..KRRDKKK.A..............................EK.ER..E..RR...........R.......E..........DDS...--........AYS.T.GT.Y......SP....G....S..........YDS.PRS...ST..V.HPNDSR--.......FF.........PE..T.NYF...P........P.PPSA...........---.......-PV.DH....ATT..T..PYPP......YNP..AD...Y..PPP.....PQTA...yEP...QHP.S.H.Fv...........nhPP...............PPPHDMNY...GNP-------............................................................................................
A0A094JE74_9PEZI/550-621               ...............................RSRSR........AR.D...VIGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RR...........A.......Y..........TPE...-I........TLS.S.AH.L......-P....T....P..........P-I.SPS...TP..F.SP------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ahtn........................................................................................
G3JMF7_CORMM/325-456                   .......................rkssgggf-----........MK.T...LATVAA....A.V...G..A....G.G....L.A..A...N...F..MK..KRNNREE.Eys..........................avST.DT..P..RR...........N.......R..........SGR..gQP........SDY.G.SE.Y......-T....D....D..........YTA.TQT...SL..L.PPSANPAT.......TYtt.....rtTG..D.TGR...P........T.TPRS...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sypsrrdhdesdyssyvspshrrpaensgg..............................................................
A0A0D1ZLV8_9EURO/395-477               ....................rsrsrsrsrsa-SRSR........LK.T...LATAGLgaaaL.A...A..V....A.T....I.A..T...K...K..LA..GNKDQDQ.Dqe..........................ppRR.SR..S..RR...........R.......R..........EET...LT........ELE.N.D-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ptaddarnpkh.................................................................................
M7U351_BOTF1/694-842                   ...............................RSRSR........VR.D...LAAGAL....G.T...G..A....A.A....I.G..I...N...E..YR..KRKEKKE.Kkekk.....................daekhER.ER..E..RR...........R.......Y..........EDE...AP........ESY.Y.TN.F......RD....E....T..........YSP.SP-...--..-.-PHASGGS.......YY.........PE..N.NAF...P........P.PPTSnpet...ftnhGNKs.....tPFV.NE....IP-..-..PIPP......YNP..QD...Y..ASQ....rPTTH....DP...---.H.H.Y..............PP...............S-------...----------srvpgdni....................................................................................
A0A0L1HW30_9PLEO/341-403               ...............................RSKSR........VK.E...LGTLAA....I.A...G..V....G.A....L.A..Y...A...A..GQ..RNKNKNK.Eetv.......................tiieDR.HR..S..KS...........R.......S..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rrgrrrsrsvsv................................................................................
S2JHI7_MUCC1/359-418                   .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..DHHGKES.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------glenhhttsgnplhsgsnnvnhsvndnndhhykr..........................................................
W9XB18_9EURO/633-819                   ..............................r-SRRR.......hSR.D...AAKMTA....A.A...A..A....G.A....I.G..A...A...E..YE..KRKQEKR.-..............................ER.RA..R..RR...........R.......E..........EEG..yGR........DPY.E.DN.Y......NP...gA....Q..........YAP.TPPpppPV..N.DPYANQQG.......FY.........PQ..T.SQF...P........P.PPGA...........APQq....ypPQA.GP...gTAP..A..GGAQ......YPP..QN...Y..PPPpppppPPGA....PP...APA.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsaepsstfgnpfaptvpsndqhhvpdg.............................................................
A0A0F8UEJ4_9EURO/277-347               ......................rsrsrsrsh-SHSR........AK.T...FAEIGL....G.A...A..A....I.V....G.A..I...A...L..AR..KQSSRSR.R..............................SH.SR..H..RR...........G.......T..........SSSr.sVK........DSS.D.NK.R......SQ....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sqr.........................................................................................
C1GDB7_PARBD/373-473                   ...............................RSRSR........IR.Q..gLPIAAA....S.L...G..S....A.A....I.A..-...G...L..YE..KHKEKKE.N..............................ES.SE..R..HH...........R.......H..........RSR..sRS........VAP.S.SA.Y......-S....D....P..........SGS.APQlieYG..D.DPVYGS--.......-I.........PT..N.HYY...G........R.P---...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ssrqsspraiess...............................................................................
A0A0B7N6U1_9FUNG/109-176               ..........................hhykr-----........--.-...--DAAL....T.A...G..A....T.G....P.A..G...H...E..LN..KHHNNQP.K..............................PD.AS..H..HN...........G.......I..........EST...--........-P-.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hkddisdsktfepeighssagnrhe...................................................................
W9XLQ4_9EURO/485-605                   .............................keRSRSR........IR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKAKKE.Aeki.......................stegRR.AR..S..RS...........R.......S..........RAR...SD........GYY.D.GP.R......DA....A....L..........ADP.GLI..eYG..T.GPMYGNN-.......FG.........PD..Y.YGR...P........P.PAEG...........Y--.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ygasdavvprdpytaqrgar........................................................................
Q0UZC8_PHANO/361-435                   ...............................RSKSR........VR.E...IGALAA....I.A...G..V....G.A....L.A..Y...A...A..GR..KNKDKGV.Tt...........................vvEE.HR..H..RS...........R.......S..........RKS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rskrghsrrgrsrsvtvietdggps...................................................................
G3XV77_ASPNA/301-373                   ......................rsrsrsrsh-SHSR........AR.H...LAELGLgaaaI.A...G..A....V.A....L.A..R...S...K..SN..SNKDRRS.R..............................SR.HR..R..AS...........S.......S..........RRS...LR........DTH.E.EK.R......SQ....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sqr.........................................................................................
W9W1E3_9EURO/534-675                   ..............................k-NKNR........LQ.D...VASIGI....A.A...L..G....L.K....G.A..Y...S...E..WQ..ETREAQR.E..............................QK.EE..K..EK...........R.......E..........RHK..aKRa.....arRRK.M.SM.I......AA....H....N..........YVD.SGF...TG..S.MPNLASYPq....qqYP.........PQ..Q.PTF...P........P.PPGA...........FAY.......---.--....---..-..--GT......GSP..VH...Y..ADD....nPYG-....AI...SQQ.Q.A.Y..............VP...............APHHEPQV...GVPRA-----eth.........................................................................................
U7PSX9_SPOS1/670-732                   ...............................RSRSR........LR.N...LATAGA....G.A...A..A....A.A....I.G..I...K...K..YS..DSKKKKE.E..............................EA.NR..R..DR...........R.......D..........HE-...RD........RDH.D.RD.F......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------drdhdrqr....................................................................................
A0A0N0NRB6_9EURO/357-444               ......................rsrsrsrsq-SRSR........LK.N...LGLLGL....G.A...A..G....L.A....A.A..A...V...V..AT..KKMKQNN.E.............................dKA.DE..N..RG...........R.......S..........QSR...VR........TDR.V.ET.I......EE....L....A..........NDP.TAE...DA..R.NPKHRN--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------krma........................................................................................
A0A0D2E8L9_9EURO/644-800               ...........................rrqs-RRRS........SR.D...ATKMAA....A.A...G..A....G.A....V.A..A...S...E..YD..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEGg.yGH........DPY.E.DS.Y.....nPN....Q....Q..........YPP.TPP..pPV..N.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQ.......QQY.PP....QTS..N..PGAT.....tGNPygQA...Y..PPP....pPGPP....PN...ATG.T.N.Y..............EA..............yASGANPYA...PRG-------penvs.......................................................................................
A0A0N7Z0T5_ROSNE/488-564               ...........................rsksRSQSR........IK.T...GAKIAA....A.G...L..A....G.A....T.A..T...K...L..WE..HRQDKKH.-..............................-R.EN..H..ER...........S.......D..........DEY...SR........DRS.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------isrsqsrsrslgrhhhprdttad.....................................................................
A0A074W448_9PEZI/552-709               ...............................RSRSR........TR.G...LAEGAA....A.A...G..V....A.A....V.A..A...H...E..LG..KRNERRR.Ad............................rER.DR..D..RR...........R.......H..........EEE...-D........DMY.A.HD.R......--....-....P..........YSP.PPMganAA..Y.PPTPQSHE.......FY.........PA..T.NTF...P........P.PPTD...........NYR.......-HQ.AD....YPP..Q..EYRP......YNP..AD...Y..PPP.....PAAT...sAPr.gRQD.E.R.Y..............PSpdp........nlgyPPANETFA...GDPRYAGDN-r...........................................................................................
A0A072PTE1_9EURO/632-778               ..............................h-SRRR........SR.D...AAKYAA....A.A...A..A....G.A....I.G..T...S...E..YN..RRKEEKR.-..............................ER.KA..R..RQ...........E.......E..........EAAy.rAH........DPY.E.DS.Y.....nTG....A....P..........YAA.TP-...--..-.DPYAAQQG.......FY.........PQ..T.SQF...P........P.PPGG...........MPG.......-QY.NP....QPA..A..TQMPga..apYGG..QV...Y..PPP.....PAGP....-P...PVT.N.N.Y..............DA..............yASGANPYA...PRG-------penvs.......................................................................................
A0A0N0NRB6_9EURO/461-591               .......................rsksrgrdRSRSR........VR.Q...AAPV--....V.A...A..G....L.G....S.A..A...-...-..LA..GLYERNK.A..............................KK.EA..E..VI...........R.......K..........EEK...GR........CFS.D.PN.L......--....I....E..........YGD.GPMh.gNN..Y.GPDYYGRNlp..qenFY.........AN..Q.TAV...V........P.APGQ...........SPG.......APA.QY....AQR..D..LS--......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------peysnrrsrsrsrstsp...........................................................................
A0A136J136_9PEZI/665-772               ...........rsrarsrdmsrdrsrsrsvd-----........--.-...------....-.-...-..-....-.-....-.-..-...-...A..RS..DRKSRGR.L..............................SR.DR..E..RR...........R.......Y..........EEE...--........-AD.A.DR.Y......--....D....D..........YDA.PP-...--..-.SPLHAS--.......--.........-G..G.AYY...P........P.PPGP...........PPG.......--H.LP....QAG..Y..GASP......YPP..AG...A..PPP.....AAAY....PP...RD-.-.-.-..............--...............--------...----------pgnm........................................................................................
G4N0D9_MAGO7/539-644                   .............................rhRSRSR........LR.T...GAEIVA....-.A...G..L....A.G....G.A..A...K...K.iYD..KHQEKKE.R..............................ER.SR..S..VA...........A.......G..........KRRsrsRS........LSS.D.WS.Y......DD....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rdrrrrsrshsrsnararlpplphndssradselgmveygnnp.................................................
A0A080WGP9_TRIRC/489-608               ...............................RSRSRhgn..gnlAA.G...LAAASL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgvpp.ppgpPG..G.RGY...P........P.PPGP...........PP-.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gpgyfggpgpggppvyr...........................................................................
A0A0D9MW47_ASPFA/561-699               ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YT..QRRERKK.A..............................EQ.ER..E..RP...........R.......F..........DED..aRQ........DSY.G.EP.Y......SP....E....P..........YQH.TA-...--..L.PPQSSEHQ.......YY.........PN..T.NYF...P........P.PPGS...........APR.......---.--....-PA..G..STAP......YNP..AD...Y..PPP.....PGAV....PP...SQQ.Y.G.Y..............PP...............-PGPESFV...SRPRRADENV............................................................................................
A0A080WQ72_TRIRC/489-609               ...............................RSRSRhgn..gnlAA.G...LAAASL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgvpp.ppgpPG..G.RGY...P........P.PPGP...........PP-.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gpgyfggpgpggppvyrg..........................................................................
A0A074YPM7_9PEZI/540-696               ...............................RSRSR........TR.G...LAEGAA....A.A...G..V....A.A....V.A..A...H...E..LG..KRDERRR.Sd............................rDR.DR..E..RR...........R.......R..........DED...-E........DMY.A.RD.R......--....-....P..........YSP.PPMganAA..Y.PPTPQNQD.......FY.........PA..T.NSF...P........P.PPTD...........-NY.......GRE.AD....YPP..H..EYPP......YNP..AD...Y..PPP.....PGAA....PAprgRHN.D.R.Y..............SPdpn.........lgyPPANETFA...GDTRYAG---dtr.........................................................................................
G2QTJ0_THITE/535-639                   .............................ksRSRSR........LR.T...GAEMLA....-.A...G..L....A.G....A.G..A...K...K..LY.dRHKEKKE.A..............................ER.DR..D..RG...........Y.......S..........DDE...--........-YY.E.DD.A......RD....-....-..........YNR.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsrslsrsgptypdgdpsaadpelgmveygahplyanpaypad...............................................
A0A139HNL3_9PEZI/431-506               .........................rsrsrsKSLSR........RQ.Q...LGGLAA....V.A...G..V....A.A....L.A..G...Y...A..LN..KNKNKET.Iivn.......................dghrRR.SR..S..RR...........R.......R..........HSV...--........DTY.I.SD.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------eerehrdpgh..................................................................................
A0A0D2AI73_9PEZI/125-211               ..................svaaahfatglls-----........--.-...------....K.A...A..I....I.A....G.G..V...Y...L..YK..QHKDKKR.A..............................ER.TS..E..HH...........R.......Y..........TDA...-V........DQN.T.QD.Y......QP....P....K..........YND.YPS..dHK..S.QPQV----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dyarksnpsyetmsn.............................................................................
A0A0P8X2H8_9CLOT/41-109                .........................nglkgd-----........--.-...----GA....F.G...G..G....A.P....F.A..Y...E...E..YE..GYRNESR.K..............................EK.KR..K..KK...........H.......R..........KHR...DE........REY.E.EA.Y......-Q....N....D..........QSQ.AP-...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------fippfnlddst.................................................................................
R8BUE6_TOGMI/744-875                   ........................drerdrd-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..RERDRER.R..............................DR.DR..E..RR...........R.......Y..........EEE...TA........ADY.D.DA.Y......-D....A....Q..........RPP.SP-...--..-.-PHASGGA.......YY.........PP..P.PAA...P........AaPPAAaapy...gagfTQH......pNIA.TT....NLN..E..GYQP......YHP..ADytgY..PPP.....PPGP....PP...SHP.Q.T.Pt...........gfPP...............PPTGG---...----------haagdnm.....................................................................................
H6C6Y6_EXODN/638-795                   ..........................skhss-RRRS........SR.D...AANMAA....A.A...G..A....G.A....I.A..A...S...E..YE..RRKQEKR.-..............................ER.KA..R..RR...........R.......E..........EEG..yGR........DPY.E.DN.Y.....nPA....Q....P..........YPP.TPP..pPA..S.DPYASQQG.......FY.........PQ..T.SQF...P........P.PPGS...........VPQq.....yPPQ.QS....TPS..A..GPPPa....aSYP..AQ..sY..PPP.....PPPG....GP...PTT.T.P.Y..............DA..............yGSGANPYA...PRG-------penvs.......................................................................................
A0A0D2BWC7_9EURO/625-785               .............................dr-SRRR.......hSR.D...AAKMTA....A.A...A..A....G.A....I.G..A...T...E..YE..KRKQERR.E..............................RR.AR..K..RR...........E.......E..........EGY...GR........DPY.E.DN.Y......HPggqfA....P..........TPP.PPA...PV..N.DPYATQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQq....ypPQA.GP...aTAP..T..GAAP......YPP..QN...Y..PPPp...pPPGA....PP...APA.Q.P.Y..............EA..............yASGANPYA...PRG-------penvsae.....................................................................................
J4TVZ1_9PAST/65-121                    .............................na-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-HKEEKK.Hr............................aER.ER..E..HR...........H.......H..........HEG..fRP........ARY.EyDD.F......DD....R....H..........HKPhRPK..hHK..H.KPHHH---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ddd.........................................................................................
A0A0D1YR49_9PEZI/537-688               ...............................RSRSR........SK.G...LAEVAA....A.A...G..V....A.G....V.A..A...H...E..LT..KRRERRR.-..............................--.ER..E..RR...........R.......Q..........EEE..aAA........AAS.N.SE.Y......TS....T....T..........DAN.SP-...--..-.--------.......YY.........PA..S.NHF...A........P.PPNAaeg....gyppMNH.......PND.SA....YYS..N..PVPP......YNP..AD...Y..GPT.....TGPT...lPR...DDP.Y.A.Q..............PYnqqh......hdnfaTPHQDPYS...PKN-------kdprapen....................................................................................
A0A0C9MGZ4_9FUNG/532-599               ...........................lsip-----........-R.D...AAIGAG....A.A...G..A....A.G....A.A..G...H...E..MK..EHHDKKE.A..............................AS.GR..T..S-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------vssassgekkgaavhdkplntggdahhva...............................................................
A0A168JB54_MUCCL/191-228               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglegthhtsgnp...............................................................................
A0A168JB54_MUCCL/617-665               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglegahhtsgnplhsgsgidnhh....................................................................
B4R4D9_DROSI/104-194                   ...................rssllvnsaltn-----........--.T...VAA-AA....A.A...A..A....A.A....V.A..S...N...T..LQ..QHQQHHQ.Q..............................QQ.QQ..Q..QQ...........Q.......Q..........QQQ..qQQ........QQQ.Q.QQ.H......SP....Q....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qhliraipvsrfisarnvtrvannrhp.................................................................
N4VHF5_COLOR/690-808                   ...................rdrgyprdrass-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-RDRPIN.R..............................ER.ER..D..RR...........R.......Y..........DEA...PR........EGY.Y.DD.Y......--....-....S..........RPP.SP-...--..-.-PHASGGA.......Y-.........--..-.--Y...P........P.PAATsa.......sfTQH.......PNI.ST...tNLR..D..TYPP......-YP..QD...Y..PTP.....PMAT....GG...A--.G.G.Y..............PP...............PP------...----------pggpppaggppsttr.............................................................................
T0KDB4_COLGC/626-696                   ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...Q..YQ..KKKEKEE.Dd...........................rrS-.-R..E..RS...........A.......R..........SRS...RD........R--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sisrdraysrdrasrdrvsr........................................................................
A0A0G4LM95_9PEZI/553-711               ...............................RSRSR........IR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...E..YK..KKKDAEK.Eredeaarra............rerslsrdySR.DR..S..RR...........R.......D..........EDR...--........RRY.E.EE.S......NP....N....P.........hYDD.YSR...PP..S.PPHASGG-.......--.........--..-.AYY...P........P.PTGS...........GFS.......--Q.NQ....SVN..D..PYPP......YSP..HA...Y..TGF.....PPPQ....P-...---.-.-.-..............--...............--------...----------ggpstasgaaggfptptpggpplsypggp...............................................................
A0A136J136_9PEZI/486-567               ...............................RSKSR........IR.T...GAEIAA....-.A...G..L....T.G....A.A..A...S...K..LW..ERQKDKK.D..............................KK.EH..H..RS...........Rdr...dfV..........EDDy.vRH........RSY.S.RS.Q......SR....S....R..........SRV.RSL...DS..R.QPTA----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------nrel........................................................................................
A0A074YSE8_AURPU/317-395               ...............................RSRSR........AR.T...LAKVGT....V.A...A..V....G.A....L.A..A...Y...A..LR..NRGNKET.Vivnn.....................evpptRR.SR..S..RR...........R.......R..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------asvgsvpppldarprsrseskhrdpe..................................................................
B2WNY2_PYRTR/600-753                   ...............................RSKSR........AR.T...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AA..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........EDT...--........AYS.T.ST.Y......--....S....P..........YDS.PTS...ST..A.HPDDSR--.......YF.........PE..T.NYF...P........P.PPSA...........---.......-PV.DH....NPN..N..PYPP......YNP..AD...Y..PPG.....PQST...yEP...NHP.S.Q.Fv............nPPhndlhp..gnpyappQQQQDFYY...GQPRHPDDNV............................................................................................
E3QDR6_COLGM/691-829                   ...............................RSRSR........DR.S...VSRPRA....H.S...R..D....R.A....Y.S..R...E...R..ST..DRPINR-.-..............................DR.ER..D..RR...........R.......Y..........EEG..vRD........DEY.Y.TD.Y......--....-....S..........RPP.SP-...--..-.-PHASGG-.......--.........--..-.SYY...P........P.PPAAaa.......gfTQY.......PNIsTA....NLR..E..QYPP......-YP..QD...Y..PPG.....PPPM....GP...SPP.M.A.-..............--...............--------...----------tggaggyppppaggpppsgglpp.....................................................................
S2K5A6_MUCC1/218-326                   .........................sgmssg-----........-M.K...MAGAAA....V.G...V..A....G.G....L.A..I...G...S..IM..HHEEEQS.-..............................--.DR..I..ER...........L.......E..........QEQ...RQ........LEQ.Q.QQ.Y......NQ....Q....P.........sYSA.PP-...--..-.-PPQEQ--.......Y-.........--..-.-NA...P........P.PPME...........-QQ.......---.--....PYD..G..GYGN......YNP..GD...Y..QQQ.....DGGG....--...---.-.-.-..............--...............--------...----------dtqttiire...................................................................................
A7EI77_SCLS1/616-790                   ......................ydrtnehds-----........--.-...--AVAA....A.A...A..G....A.A....Y.G..A...S...R..RS..RSRSRQR.Krdsssdd................ekrprsrS-.-R..S..QS...........RvrdlaagY..........EDE..aSP........ESY.Y.TN.F......RD....D....T..........YSP.SP-...--..-.-PHASGSS.......YY.........PD..N.NQF...P........P.PPTSvpqg...ftrhGNQs.....sPFV.NE....IP-..-..PIPP......YNP..QD...Y..AGR....rPSTH....EP...H--.V.N.Y..............PP...............------YP...PSS-------ripgdnvnrlnnstpttpv.........................................................................
A0A0F8UEJ4_9EURO/379-488               ...............................RSRSR........SK.S...TFRKALp..vV.A...A..G....L.Gt..aV.A..T...G...L..YE..KNKEKRE.Se...........................eeSR.RR..E..RR...........R.......S..........RSR...-S........RPP.S.EI.Y......-P....D....P..........TRD.SAG..lIE..Y.GEHPVPG-.......II.........PA..A.NYY...G........R.PASS...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qgyisdasdkvssg..............................................................................
A0A0D2DS24_9EURO/379-467               .............................rrRSRSRses..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKNK.Nnd.........................dddRR.GR..S..HS...........R.......S..........RSR...RR........AES.V.SS.L......EN....D....P..........DAP.SD-...DA..R.NPKH----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rrnt........................................................................................
M2MVN7_BAUCO/433-520                   .........................rsrsrsKSLSR........AQ.Q...LGGLAA....V.A...A..V....G.A....L.A..G...Y...A..LT..RNKNKET.Vvv.........................eppHR.SR..S..RR...........R.......R..........ASV...-D........SYY.T.DD.R......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tvlsdgggramdpnhrntriaq......................................................................
W3XH82_9PEZI/412-479                   ..............................d-HRSR........DA.A...LG-AGA....A.T...G..V....A.A....Y.G..M...H...E..YN..KYKEPSA.-..............................SR.KP..V..GS...........G.......V..........D--...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sthldsrtspsgdhrdpqsasrdhi...................................................................
B6Q8Z7_TALMQ/499-641                   ...............................RSSSR........IR.D...LAEAGL....A.A...A..G....L.G....Y.A..A...S...K..IS.gNKKDKSR.H..............................SR.ER..E..SR...........R.......H..........DHD...-N........DSY.E.EP.Y......DP....A....P..........YMP.TPS..pGA..P.GPPTEN--.......YY.........PY..T.NSF...P........P.PPGS...........TPN.......---.--....---..L..PPTS......YHP..GE...Y..PPPp...aPGAV....PP...MHE.Y.P.H..............PPg.............aPPGNEPYA...PQPRRADENV............................................................................................
F0U958_AJEC8/562-700                   ...............................RSRSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKR.A..............................EK.DR..R..TY...........A.......H..........DHD...YS........DSY.E.DG.Y......EP....A....P..........YPP.SP-...--..-.-PSNGPN-.......YY.........AQ..G.SQF...P........P.PPGA...........APV.......P--.--....PPN..V..QPGP......YNP..AD...Y..PPP.....PGAA...pQP...PSN.Y.P.Y..............PP...............PPGVDAYA...PRSARGDENV............................................................................................
H0EK30_GLAL7/634-744                   ...............................RSRSR........VR.D...IAGAAA....G.T...A..A....A.A....I.G..I...N...Q..YK..KRKEKKE.A..............................QR.ER..E..RR...........R.......Y..........EEE..pPD........DYY.S.RD.Y......VD....D....G..........YSP.SP-...--..-.-PHASGGS.......FY.........PD..H.NQF...Q........P.PQQP...........AYT.......PGF.TQ....HPN..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lstpnrhnllmtp...............................................................................
J4UHD6_BEAB2/446-519                   ...............................RSKSR........LR.T...GAKIAG....A.A...A..A....A.G....V.A..G...K...L..YK..NHQEKKE.R..............................ER.SR..S..RA...........P.......S..........DDD...--........DRY.Y.DR.R......AR....S....H..........S--.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsmarslhsdaga.............................................................................
E3QDR6_COLGM/476-516                   ...............................KSKSR........SR.S...VAKAAA....A.T...A..A....A.A....G.L..V...K...H..FR..DRSKSK-.-..............................SR.SR..S..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sk..........................................................................................
Q0C9I2_ASPTN/595-690                   ........................htvgpgy-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......-..........DD-...RR........EPY.E.DP.Y......AP....E....P..........YAN.SP-...--..-.--HDN--Q.......YY.........PN..S.NYF...P........P.PPGS...........APR.......---.--....-VA..G..TGPA......YNP..AD...Y..PPP.....PGAV....PP...AQP.Y.S.Y..............AT...............PPAPEPYA...PRPRRADENV............................................................................................
W2RLM0_9EURO/664-811                   ...............................RRRSS........RR.R...VAEAGA....A.A...A..A....G.A....A.G..A...S...M..YE..RSKQEKR.-..............................ER.KA..R..KR...........R.......E..........QEQ...YG........DPY.E.EG.Y......NP....Q....A..........SHA.PP-...-P..S.DPYGAPPQp.....gYY.........PE..S.GAF...P........P.PPGA...........GQY.......---.AP....DPA.aQ..QAGN......YMQ..QG...Y..PPP....pPGGPg..mPP...PPG.V.G.Y..............EP..............yASGANPYA...PPR-------gadnvr......................................................................................
Q2TZD9_ASPOR/561-699                   ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YT..QRRERKK.A..............................EQ.ER..E..RP...........R.......F..........DED..aRQ........DSY.G.EP.Y......SP....E....P..........YQH.TA-...--..L.PPQSSEHQ.......YY.........PN..T.NYF...P........P.PPGS...........APR.......---.--....-PA..G..STAP......YNP..AD...Y..PPP.....PVAV....PP...SQQ.Y.G.Y..............PP...............-PGPESFV...SRPRRADEN-g...........................................................................................
A0A100ITS5_ASPNG/401-507               ...............................RRESR........SH.S...AIRKALp..vV.A...A..G....L.G....T.A..A...A...TglYE..KNKEKKE.E..............................EE.SR..R..RE...........R.......R..........RSR..sRS........RAP.S.EV.Y......-P....D....P..........TRD.SPG..lIE..Y.GDH-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pvhgsippnyygrpvsphgyysdasdpvas..............................................................
A0A080WIC1_TRIRC/550-670               .............................enRSRSRhgn..gnlAA.G...LAAASL....-.A...A..G....A.G....Y.A..G...H...E..YA.kHHRDQKH.-..............................--.SN..G..RA...........E.......Y..........DRD...YR........DPY.E.EE.Y......-P....S....P..........PGP.PPG..pAS..Y.QPPAAQE-.......YYgvpp.ppgpPG..G.RGY...P........P.PPGP...........PP-.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gpgyfggpgpggppvy............................................................................
A0A068RLC2_9FUNG/147-258               ..........................gmstg-----........-M.K...VAAGAA....V.A...G..L....A.G....Y.G..I...A...E..FV.eHEHEQSE.Rld..........................dlER.EN.qE..LQ...........R.......Q..........QDE..lER........EQQ.Q.QE.Y......YQ....Q....P..........PPP.PPP...AE..S.YPPAGED-.......-Yga.....ppPP..P.SEY...P........P.PPEE...........QGT.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tttiinedgg..................................................................................
A0A0S6X889_9FUNG/363-432               ...............................RSKSR........IR.Q...LGGVAA....V.A...A..V....G.A....L.A..G...Y...A..LR..NRNKQQI.I.............................eRR.SR..S..RH...........R.......R..........GSV..eRE........EI-.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ietggprsvddpkppdh...........................................................................
S9VEY3_9TRYP/208-326                   ..................liacltpiciqcc-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..-E..AREEKKQ.A..............................KK.DE..K..KR...........K.......K..........EEK..kVQ........KQQ.E.ET.Q......NS....N....Q..........YYN.YYD...TQ..Q.QPQQGATYga..ppvYY.........GN..T.VTY...G........A.PPAN...........VGYgv...plNNE.VH....APT.yG..QPTP......SKP..VD...-..---.....----....--...---.-.-.-..............--...............--------...----------thpvttptp...................................................................................
A0A0J6Y2F6_COCIT/510-672               ...............................RERSR........SR.D...LATAGL...aA.A...G..A....A.G....L.A..A...H...K..YA..QRKERKK.N..............................ER.DR..R..RD...........E.......E..........E-A...RQ........DSY.D.DT.Y......ST....I....P..........YPP.SPP...PP..S.ASSYPQDN.......YY.........PQ..T.NQFaqsPnq...ttgP.PPGH...........YQY......pPSN.YP....PPG..T..ASMPppnhvsHNP..AD...Y..PPP.....PGAP....PP...AQH.Y.N.Y..............PV...............PPAQDPYA...HLQPRGDENV............................................................................................
A0A0F4GXD0_9PEZI/399-461               .............................rsRSRSRsf....nrTQ.K...LGGLAA....V.A...A..V....A.A....L.G..A...Y...A..LK..NRNNKET.Vi............................vKE.QP..P..RR...........R.......S..........EHR...SP........D--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hrnrr.......................................................................................
F7W3Z0_SORMK/439-492                   ...............................RSKSR........AG.S...VAKAAL....G.T...A..A....A.V....G.V..V...Q...H..IR..HKRSKSR.H..............................-G.SR..S..SS...........S.......S..........SD-...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsghhsklk...................................................................................
A0A094EQ88_9PEZI/1075-1154             ...............................RSKSR........IR.T...GAELAA....A.G...L..A....T.A....A.A..A...G...L..YE..RRKAKQE.Gergvs....................rslsrSK.SR..S..RS...........R.......G..........GRR..rLD........DDY.E.R-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------pglveygaqplhsrg.............................................................................
A0A0A2KDD1_PENIT/540-687               ...............................KHHSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......H..........DDN..vHR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..tAP..G.APPMVDSH.......YY.........PN..N.NYF...P........P.PPGD...........STH.......---.-N....LNG..G..TPAP......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaPPg.............pGPGPEQYA...SRPRRADENV............................................................................................
A0A165A7V2_9PEZI/98-169                ...............................RSHSR........VK.E...LAGLGL....G.A...A..A....I.A....A.A..V...S...F..AN..KNNKKKN.Ddrg.......................drgeRR.SR..S..RR...........R.......R..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hsvtgvdresraeskhrdpkh.......................................................................
A0A167RTY9_9PEZI/701-763               ...............................RSRSR........LR.N...LAAAGA....G.A...A..A....A.A....I.G..I...K...K..YQ..DKKNRDE.Rn...........................kqDR.DR..D..YD...........R.......E..........QERd.hDR........DRH.R.DE.Y......R-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------d...........................................................................................
G2QTJ0_THITE/500-538                   ...............................RSRSR........AS.S...LAKAGL....G.A...A..A....L.T....G.L..V...Q...H..YR.hKSKSRD-.-..............................GK.S-..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rs..........................................................................................
W9W1E3_9EURO/364-467                   ..............................s-KRSR........SR.S...IAARGL....A.A...L..G....L.K....D.A..A...D...K..VD..PGRERD-.-..............................-R.RR..N..YD...........N.......Y..........DDD...GR........SSR.Y.GG.Y......--....-....G..........YND.S--...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rdvgtiqpqydyanggprslsvprgapsgyeldygprhtgdpetds..............................................
C4JEK8_UNCRE/210-276                   ..............................s-SRSR........AR.T...LAGLGL....G.A...A..A....I.A....G.A..V...A...L..AK..KHSEKNE.Krek........................sstRR.SR..S..RR...........R.......R..........SSS...-T........SSS.S.DA.R......DP....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ehrn........................................................................................
A0A072PTE1_9EURO/382-455               ............................rsh-SRSR........LK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AT..KRLGKKE.Tee..........................ppRR.SR..S..RR...........R.......R..........EET...LS........ELE.N.DP.T......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------addarnpkhrnk................................................................................
A0A0D1WQS0_9EURO/654-804               ..............................h-SRRR........SR.D...AGRSAA....A.A...A..G....G.A....A.A..A...S...E..YE..SRRKQEK.R..............................DR.KA..R..KR...........R.......E..........EQG..yGA........DPY.E.DN.Y.....nPA....Q....Q..........YSP.TPP...PA..N.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGA...........VPQ.......QYP.QN....AAP..G..AANP......YPT..QS...Y..PPPp...pPPGP....PP...TGA.A.N.Y..............DP..............yASGANPYA...PRG-------penvs.......................................................................................
A0A0C9MGZ4_9FUNG/321-378               hnnheginnphhsendklhqsssnndhhykr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..DRH----.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gdanplq.....................................................................................
A0A0J8QS49_COCIT/156-318               ...............................RERSR........SR.D...LATAGL...aA.A...G..A....A.G....L.A..A...H...K..YA..QRKERKK.N..............................ER.DR..R..RD...........E.......G..........EA-...RQ........DSY.D.DT.Y......ST....I....P..........YPP.SPP...PP..S.ASSYPQDN.......YY.........PQ..T.NQFaqsPnq...ttgP.PPGH...........YQY......pPSN.YP....PPG..T..ASMPppnhvsHNP..AD...Y..PPP.....PGAP....PP...AQH.Y.N.Y..............PV...............PPAQDPYA...HLQPRGDENV............................................................................................
A0A0D9MW47_ASPFA/410-514               .............................esRSHSR........LR.K...ALPVVA....A.G...L..G....T.A....A.A..T...G...L..YE..KHKEKQE.Eg...........................eaSR.RR..E..RS...........R.......S..........RSR...--........-AP.S.EI.Y......-P....D....P..........TRD.SAGlieYG..Q.DPVHGRI-.......--.........PT..A.DYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------grptsqqayysdasdpavs.........................................................................
T0KDB4_COLGC/456-501                   .........................rsrsrs-RKSR........SR.S...VAKAAA....A.T...A..A....AaG....L.V..K...H...F..RD..KSKSK--.-..............................SR.SR..S..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sk..........................................................................................
A0A166MYR9_9PEZI/646-698               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..I...K...Q..YQ..KKKEKEK.D..............................ED.RR..S..RE...........R.......S..........ARS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrdrs......................................................................................
A0A168JB54_MUCCL/709-750               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglegahhtsgnplhsg...........................................................................
A0A0D2CID4_9EURO/379-467               .............................rrRSRSRses..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKNK.Nnd.........................dddRR.GR..S..HS...........R.......S..........RSR...RR........AES.V.SS.L......EN....D....P..........DAP.SD-...DA..R.NPKH----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rrnt........................................................................................
R7YPI0_CONA1/593-724                   ...............................RSKSR........TR.R...VAEAAA....L.A...G..V....A.G....V.A..A...N...R..AS..KRRRSKD.Rgsr........................ergSR.ER..G..SR...........E.......R..........NDG..dRQ........RRM.E.EG.T.....sAS....D....N..........YGT.PPP..qAG..YpIPPYQGGR.......YY.........PE..T.NEF...P........P.PPTI...........ASE.......DYA.MH....PPM..N..GYPP......NPP..MN..gY..PPP.....PMS-....--...---.-.-.-..............--...............--------...----------ay..........................................................................................
A0A0K8LFQ8_9EURO/522-657               ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YK..QSRDRKK.E..............................EK.ER..S..K-...........-.......Y..........DD-...--........DSY.P.SS.Y.....pSD....L....P..........YPP.SPL...PP..T.HPVENQH-.......-Y.........PN..S.NYF...P........P.PPGS...........TPA.......---.--....-PA..A..PPAP......YNP..AD...Y..PPP.....PGAV....PP...AQS.Y.G.Y..............PP...............EPGPDRYA...PRPRRADENV............................................................................................
A6RCP1_AJECN/417-528                   ...................kspgrirqgipi-----........--.-...-AVAGL....-.-...G..S....A.A....-.I..A...N...L..YE..KHKEKKE.S..............................ES.-S..E..RK...........E.......K..........NHR...RRsr...srsMAR.S.ST.Y......-P....D....P..........SRS.SPQlieYG..D.DPV-----.......-Yg......siPA..N.NYY...G........R.PPSR...........QSS.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------spraieasprrssrr.............................................................................
V5G1I1_BYSSN/557-696                   ..............................g-SRSR........SR.H...LAEAAL....T.A...A..A....G.G....F.A..A...D...K..YA..KKKERKK.A..............................EK.ER..R..RH...........E.......S..........DED...-Y........DPY.E.DQ.Y......DP....E....P..........YTP.PPP..pAG..A.APYD---H.......YY.........PQ..T.NSF...P........P.PPAS...........APA.......P--.--....-PQ..S..QPAP......YNP..GE...Y..PPP.....PGAA....PP...PQP.Y.G.Y..............QP...............PPGPDPYA...PRPRRADENV............................................................................................
A0A066XKL1_COLSU/524-653               ...............................RSKSR........IR.T...GAEVVA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKEKKD.R..............................E-.-L..D..RE...........L.......S..........DDE...YE........EEL.R.RE.R......RE....H....R..........RSR.SRSq.aRS..L.HPEPRNADselglveYGa.......sPL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......MSP..DD...Y..DDR....eP---....--...---.-.-.-..............--...............--------...----------akk.........................................................................................
E3RIR8_PYRTT/543-696                   ...............................RSKSR........AR.T...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AA..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........DDS...--........AYS.T.GT.Y......--....S....P..........YDS.PT-...-P..S.TAHTNDSR.......YF.........PE..T.NYF...P........P.PPSA...........---.......-PV.DH....NPN..N..PYPP......YNP..AD...Y..PPG.....PQST...yEP...NHP.S.Q.Fv............nPPhndlhp..gnpyappQQQQDFYY...GQPRHPDDNV............................................................................................
L8G585_PSED2/503-624                   ...............................RSKSR........TR.D...VLGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RR...........-.......Y..........SS-...--........GSY.P.SS.H......RS....A....D..........YSP.SPP...--..T.PPAAPTT-.......--.........PT..TpPNL...P........P.TPTP...........TRT.......HTQ.TQ....---..-..-TTA......HTP..TP...T..PQP.....P---....--...---.-.-.-..............--...............--------...----------shhllsrhrartmprrwg..........................................................................
A0A0G2EJI4_9EURO/487-587               ...............................RSRSR........IR.TglpIAAAGL....G.S...A..A....I.A....G.L..Y...E...K..NK..AKREEQA.Aia.........................erkSR.SR..T..RS...........R.......S..........RHS..vYP........DSS.R.GA.I......SD....Pn.miE..........YGT.DPV...YG..A.IPQQ---G.......YY.........GQ..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sgapdsyydna.................................................................................
H6C6Y6_EXODN/485-594                   .............................keRSRSR........VR.Q..aLPVVAA....G.L...G..S....A.A....L.A..G...-...L..YE..KNKARKE.Akq.........................iaeEQ.RR..A..RS...........R.......S..........RSR..aRS.......dGYY.D.GP.R......-D....A....A..........LSD.PGLi.eYG..N.GPMYGNN-.......FG.........PD..Y.YGR...P........P.PAEG...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------yygasnavvp..................................................................................
A2QKM3_ASPNC/556-695                   ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..LS..QRNERKK.A..............................DR.DR..D..RP...........E.......S..........DED..aRR........EPY.D.SS.Y.....kNP....L....P..........YPA.TPA...AA..P.RPIDDHQ-.......YY.........PN..G.NYF...P........P.PPAT...........GPR.......P--.--....---..-..EPAP......YSP..AD...Y..PHP.....PGPV....PP...-QS.Y.D.Y..............PS...............GPGPDPYA...PRPRRADENV............................................................................................
A6RCP1_AJECN/562-700                   ...............................RSKSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRKERKR.A..............................EK.DR..R..TY...........A.......H..........DHD...YS........DSY.E.DG.Y......EP....A....P..........YPP.SP-...--..-.-PSNGPN-.......YY.........AQ..G.SQF...P........P.PPGA...........APV.......P--.--....PPN..V..QPGP......YNP..AD...Y..PPP.....PGAA...pQP...PSN.Y.P.Y..............PP...............PPGVDAYA...PRSARGDENV............................................................................................
B6HIZ7_PENRW/640-721                   .............................gd--RSR........SR.E...ISSAAL....G.A...T..G....L.G....Y.A..A...H...K..YS..QQKVRRR.S..............................-E.ER..E..LL...........W.......K..........KEK..kEE........VSR.K.RS.R......SC....S....D..........NDD.APR..gRT..R.TPYNQ---.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dlispav.....................................................................................
A0A168JB54_MUCCL/358-432               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglggthhtsgnplhpgsgmdnhhstsgnplqpgsgidnhhpasgnplhp..........................................
K1WW28_MARBU/694-854                   ...............rsrsrrrrhsssssgg--RRR........SR.S...VAKVAA....G.T...A..A....A.A....I.G..M...N...Q..YQ..KRKGRKE.A..............................DR.ER..E..RR...........R.......Y..........EEE...EQp.....peNYY.A.RD.Y......-Q....D....D..........YSP.SP-...--..-.-PHASGGS.......YY.........PQ..N.NAF...P........P.PPQPg.........fTQHt.....tTST.TH....VTR..D..GIPP......YNP..AD...W..ANP.....PPPP....LH...HDP.Y.V.Y..............SG..............hHAGENPYF...PPP-------pvap........................................................................................
A0A0D1XL02_9EURO/427-575               ...................ghhgnamaigag-----........--.-...----GL....A.AgvlG..G....A.A....I.A..H...H...Q..TN..KRRSRSS.S.............................gDS.NS..D..LR...........R.......H..........SQG..sNR........GYS.R.SP.H......RL....N....G..........EVP.SP-...-G..H.DLSTSSSD.......TY.........VE..G.LTE...P........S.PPQS...........IPP.......PSR.PD....NPR..R..DSDP......-DP..ST...I..PPT.....PTTR....SR...-RN.S.A.Lg...........tmAP...............PSAIHSYI...HRP-------aips........................................................................................
A1DGB5_NEOFI/538-673                   ...............................KHRSR........SR.D...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YK..QSRDRKK.-..............................-E.DR..E..RS...........K.......Y..........DD-...--........DSY.P.SS.Y.....pSD....L....P..........YPP.SPL...PP..T.QPGENP--.......YY.........PN..S.NYF...P........P.PPGS...........TPA.......---.--....-PP..A..PAAP......YNP..AD...Y..PPP.....PGAV....PP...AQP.Y.G.Y..............PP...............EPRPDRYA...PRPRRADENV............................................................................................
L8G585_PSED2/408-485                   ...............................RSKSR........VR.T...GAELAA....A.G...L..A....T.A....A.A..A...G...L..YE..RRKAKQE.Gergv.....................sslsrSK.SR..S..RS...........R.......G..........GR-...--........-RY.D.DD.Y......E-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rpglveygaqplhsrg............................................................................
B8M1D8_TALSN/481-624                   ...............................RSSSR........IR.D...FAEAGL....A.A...A..G....L.G....Y.A..A...S...K..IS.gNKKEKSH.R..............................SR.ER..E..SR...........R.......H..........DHD...-T........DSY.E.EP.Y......DP....A....P..........YMQ.PP-...PP..G.APVPPTES.......YY.........PY..T.NSF...P........P.PPGS...........TPN.......---.--....---..P..PPAP......YNP..TE...Y..PPPp...pPGAV....PP...-PV.H.G.Y..............PPpp...........gaPPGNEPYA...PQPRRADENV............................................................................................
A0A0N0NRB6_9EURO/594-749               ...............................RRRSS........RR.R...AADAAA....A.A...G..G....G.A....A.A..A...S...A..YE..RSKAEKR.A..............................RK.EA..K..RR...........E.......R..........EG-...YA........DQY.E.DP.Y.....nAP....Q....Q..........GYQ.PPV...DP..Y.APNAQQP-.......YY.........QQ..P.GAF...P........P.PPGA...........EQY.......---.-A....QPG..A..FPPP......-PP..GGp.pM..PPP.....PGA-....PG...YEP.Y.A.Yg............aNPn............apT-------...----------rgadnvsvplqnsipdgvntsrsmn...................................................................
F7W3Z0_SORMK/375-438                   .............................rsRSRSR........SH.S...RIKTGL....G.I...A..A....V.A....L.A..A...A...G..AA..KYYESKK.Iek.........................eeaER.GR..A..PR...........R.......Y..........SES...--........DYY.S.R-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------spsrk.......................................................................................
A0A066XKL1_COLSU/654-716               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..L...K...Q..YQ..KKKEKEK.D..............................ED.ED..R..RS...........R.......E..........RSP...RS........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrdrsisrsrays..............................................................................
A0A0F4YIE0_TALEM/339-441               .............................rsRSRSR........IRkS...LPIVAA....G.L...G..S....A.A....I.A..G...-...L..YE..KHKEKKE.E..............................EA.AA..E..RQ...........R.......R..........QSR...SR........SRA.R.SA.I......HP....D....P..........TRE.SPGlieYG..N.DPVYGS--.......-I.........PT..T.DYY...G........R.PATP...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qgyysdavvp..................................................................................
A0A167RTY9_9PEZI/522-665               ...............................RSHSR........LR.T...GAEIAA....-.A...G..L....A.G....A.A..A...K...K..LY.dRHKDKK-.-..............................ER.ER..E..LQ...........D.......C..........ELH...ER........GSS.Y.DE.Y......DG....Y....E..........SDR.RRRrrsGS..R.SRSRSRSA.......PS.........PGavR.SPY...P........P.PAGA...........DAE......lG--.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lveygaqplymhpsqadpgrhgvrnyrggydsaaeasdpgsrrrh...............................................
M7SU52_EUTLA/431-503                   ..............................r-HRSK........SR.S...RLKTGL....A.I...G..A....A.A....L.A..V...AgglK..YMqdNKVEKEE.A..............................NR.GR..A..RR...........R.......Y..........SSG...--........---.-.-S.Y.....sRS....P....S..........YGH.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------skshskshsks.................................................................................
U6KG47_9EIME/184-288                   ........................gtaevpa-----........--.-...-AAAAA....A.A...T..A....A.A....A.A..A...A...A..AQ..QHQQQQQ.H..............................QQ.QQ..Q..QQ...........Q.......Q..........QQ-...--........DLS.L.FL.L......QQ....Q....Q..........QKQ.TPS..lLL..Q.HPQHPQQ-.......QH.........PQ..Q.QQH...P........Q.HPHQ...........HPQ.......QQQ.QQ....QQQ..Q..Q---......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------qamkst......................................................................................
C0NM90_AJECG/562-700                   ...............................RSRSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKR.A..............................EK.DR..R..TY...........A.......H..........DHD...YS........DSY.E.DG.Y......EP....A....P..........YPP.SP-...--..-.-PSNGPN-.......YY.........AQ..G.SQF...P........P.PPGA...........APV.......P--.--....PPN..V..QPGP......YNP..AD...Y..PPP.....PGAA...pQP...PSN.Y.P.Y..............PP...............PPGVDAYA...PRSARGDENV............................................................................................
C6HTC0_AJECH/382-462                   ...................kspgrirqgipi-----........--.-...-AVAGL....-.-...G..S....A.A....-.I..A...N...L..YE..KHKEKKE.S..............................ES.-S..E..RK...........E.......K..........NHR...RRsr...srsMAR.S.ST.Y......-P....D....P..........SRS.SPQ...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------lierssrrashs................................................................................
A0A0D1YR49_9PEZI/419-472               .............................rsRSRSR........IR.QgvpIVAAGL....G.S...A..A....V.A....G.L..Y...E...N..MK..ARKEAKE.L..............................SR.SR..S..RS...........Y.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrsr......................................................................................
F9XE98_ZYMTI/303-350                   ...........................rsrsRSQSR........KR.S...LATGAL....-.-...A..G....A.G....A.A..A...I...L..GQ..HRKKQGH.E..............................ES.HR..G..R-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------nvlgg.......................................................................................
C0NM90_AJECG/407-521                   ..........rsksrsrkgekspgrirqgip-----........--.-...IAVAGL....-.-...G..S....A.A....I.-..A...N...L..YE..KHKEKKE.S..............................ES.-S..E..RK...........E.......K..........NHR...RRsr...srsMAR.S.ST.Y......-P....D....P..........SRS.SPQlieYG..D.DPV-----.......-Yg......siPA..N.NYY...G........R.PPSR...........QSS.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------spraieas....................................................................................
A0A0J8RJW6_COCIT/510-554               ...............................RERSR........SR.D...LATAGL...aA.A...G..A....A.G....L.A..A...H...K..YA..QRKERKK.N..............................ER.DR..T..S-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sil.........................................................................................
S3DTS4_GLAL2/689-740                   ...............................RSRSR........VR.D...IAGAAA....G.T...A..A....A.A....I.G..I...N...Q..YK..KRKEKKE.A..............................QR.ER..E..RR...........R.......E..........DPS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tldlv.......................................................................................
F7W3Z0_SORMK/486-613                   ..............................g-HHSK........LK.T...GAEIVA....A.G...V..A....A.G....V.A..K...K...A..YD..KHKEKK-.-..............................ER.SR..S..RH...........A.......A..........DDR...DR........EFY.D.DDgY.....dRD....R....D..........YRS.HSR...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrsqhrsalpssqnnhasqrtvaddpeslglveygmnpvpvdsprddeqrqqqqshsksn..............................
G4N0D9_MAGO7/486-540                   ...........................rtrsRSRSR........AA.S...VAKAAA...gT.A...A..V....A.G....I.V..K...H...L..RD..KSRARSG.G.............................rSR.SR..S..HS...........R.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sksprh......................................................................................
A0A101ME85_9EURO/545-585               ...............................KHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSKE.R..............................ER.EH..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sm..........................................................................................
W6PSX9_PENRF/699-813                   .................dstvgsgssshrgg-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..--RDHRH.-..............................DR.DR..D..RD...........R.......D..........RDR..dSR........HHH.H.RR.S......SS....V....P..........YPP.MPP...PS..S.TASD-RHN.......FY.........PD..S.SHHrhhP........S.APKH...........HEE.......RDQ.NK....APE..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------adsdstidlpsrfdgqgrplperdpa..................................................................
A0A074YSE8_AURPU/553-710               ...............................RSRSR........TR.G...LAEGAA....A.A...G..V....A.A....V.A..A...H...E..LG..KRDERRR.S..............................DR.DR..D..RD...........R.......D..........RRE..eEE........DMY.A.HD.R......--....-....P..........YSP.PPMganAA..Y.PPTPQSQD.......YY.........PA..T.NSF...P........P.PPTD...........-NY.......GRQ.PD....YPP..H..EYPP......YNP..AD...Y..PPP.....PGAAg.vpRG...RHD.E.R.Y.............aSPdpn.........lgyPPANETFA...GDTRYAGDN-r...........................................................................................
W9CAG8_9HELO/706-866                   ...............................RSRSR........VR.D...LAAGAL....G.T...G..A....A.A....I.G..I...N...E..YR..KRKDKKE.Kkekk.....................daekhER.ER..E..RR...........R.......Y..........EDE..sSP........ESY.Y.TN.F......RD....E....G..........YSP.SP-...--..-.-PHASGGS.......YY.........PD..N.IQF...P........P.PPASapeg...fthhGNHs.....tPFI.NE....TP-..-..PIPP......YNP..QD...Y..AGQ.....RAAV....-Q...DPH.V.N.Y..............PPs............srAP------...----------gdnvsayqssnsep..............................................................................
A0A0D2FDQ0_9EURO/644-803               ............................rgg--RRH........SR.D...AAKMTA....A.A...A..A....G.A....I.G..A...S...E..AE..RRKQERR.D..............................RR.AR..R..RQ...........Q.......E..........EGY...GR........DPY.E.DNnY......NP...gA....Q..........YAP.TPP..pPG..N.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGS...........IPQq.....yPPQ.AApgmaPPA..P..GPAP......YAQ..QG...Y..PPPp...pPPGA....PP...PPG.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsa......................................................................................
A0A0J6Y2F6_COCIT/382-493               ...............................RSRSR........IR.TgipIAAAGL....G.S...A..A....I.A....A.A..Y...E...K..NK.aKNEDKKE.K..............................ET.RR..A..RS...........R.......S..........RSKs.rAR........SSS.-.--.-......-E....S....Q..........VGV.PPHlieYG..D.DPVYGR--.......-I.........PA..S.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------graespyhtprkhthsrsrrspstds..................................................................
A0A136J136_9PEZI/620-688               ...............................RSKSR........LR.E...AAAGIL....G.T...G..A....A.A....I.G..I...K...K..YS..DHQKAKE.Re...........................arS-.-R..E..QS...........R.......D..........RSRa.rSR........DMS.R.D-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsrsrsvdarsd................................................................................
A0A178AVN6_9PLEO/350-419               ...............................RSKSR........VR.E...IGALAA....I.A...G..V....G.A....L.A..Y...A...A..GR..KNKDKGT.Ttv.........................veeH-.-R..H..RS...........R.......S..........RRS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rskrghsrrgrsrsvtvies........................................................................
A0A168JB54_MUCCL/266-308               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglegahhtsgnplhpgs..........................................................................
A0A010Q3X1_9PEZI/647-698               ...............................RSKSR........LR.D...MAAAAV....G.T...G..A....A.A....I.G..L...K...Q..YQ..KKKEKEE.-..............................-E.RR..E..ER...........R.......E..........ERR...SR........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ersar.......................................................................................
S2JHI7_MUCC1/417-457                   .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHNRES.S..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------adghhsssgnplhp..............................................................................
A0A0D2I679_9EURO/381-460               .............................rrRSRSRses..pskLK.K...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AS..KRMNKSN.-..............................DD.DR..R..RS...........R.......S..........RHR...RE........SVS.S.LE.N......--....D....S..........DAP.SD-...DA..R.NPR-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hrnk........................................................................................
A0A063BU25_9HYPO/416-462               .............................rsRSRSK........RR.S...LSTVAK....A.A...L..G....T.A....A.T..A...G...I..IK..HIRDKSK.S.............................kSR.DR..S..RS...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rs..........................................................................................
A0A0U5FQN0_9EURO/276-337               ............................rsh-SRSR........AR.T...FAEIGL....G.A...A..A....I.A....G.A..V...A...L..AR..KKSDKDR.R..............................SR.SR..H..RR...........G.......V..........SSS...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rsvkgsedekrse...............................................................................
A0A072PTE1_9EURO/475-588               .........................rsksrnRSQSK........VR.-...---QALp..vV.A...A..G....L.G....S.A..Al.aG...L..YE..KNKAKKE.Aevv.......................qkeeRR.AR..S..RS...........R.......S..........RAR...TD........AYY.D.GP.R......-D....A....A..........VSD.PGLi.eYG..N.GPMHGNNFg....pdYYgr.....paPV..D.NYY...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ntsnavvp....................................................................................
W9WD84_9EURO/642-822                   ............................rgg--RRH........SR.D...AARVTA....A.A...A..A....G.A....A.G..A...S...E..AE..RRRQERR.-..............................ER.RA..R..RR...........Q.......H..........EEG..yGR........DPY.E.DNnY.....aPG....G....Q..........YAP.TPP..pPA..H.DPYATQQG.......FY.........PQ..S.SQF...P........P.PPGS...........IPQq.....yPPQ.AG....PGM..A..PPPPgs..apYGQ..QG...Y..PPPp...pPPGA....PP...APA.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsaepspvfgnpfapttpmndqnh.................................................................
C1HCJ5_PARBA/521-660                   ...............................RSRSR........TR.D...LATAGL....A.A...A..G....A.G....L.A..A...R...E..YT..QRQERKK.A..............................EK.DR..R..KY...........A.......R..........DHD...YT........DSY.E.EG.Y......DP....V....P..........RVP.SP-...--..-.-PPNGAN-.......YY.........PH..S.NHF...P........P.PPGS...........TPV.......P--.--....-PN..H..QGGP......YNP..AD...Y..PPS.....PGAP...pMT...QAN.Y.S.Yp............pPP...............PPAADPYS...PRSIKGEENV............................................................................................
G7XHH0_ASPKW/557-696                   ...............................KHRSR........SR.E...IAEAAL....A.A...T..G....V.G....Y.A..A...H...K..LS..QRNERKK.A..............................DR.DR..D..RP...........E.......S..........DED..aRR........EPY.D.NP.Y.....kTP....L....P..........YPA.TPA...AA..P.RPVDDHQ-.......YY.........PN..G.NYF...P........P.PPAT...........GPR.......---.--....---..P..ELAP......YSP..AD...Y..PHP.....PGPV....PP...-QS.Y.E.Y..............PS...............GPGPDPYA...PRPRRADENV............................................................................................
B8NBW3_ASPFN/304-375                   ......................rsrsrshsh-SHSR........AR.T...LAELGL....G.A...A..A....I.A....G.A..V...A...L..AR.nKSKDERR.-..............................SR.SR..H..RS...........R.......S..........RHH...R-........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sssvrsgkttdgekrs............................................................................
K9FWG0_PEND2/544-691                   ...............................KHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..HS...........K.......H..........DDN..vHR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..tAP..G.APPMADTH.......YY.........PN..S.NYF...P........P.PPGD...........STY.......---.-N....LNG..G..TPVS......YNP..AD...Y..PPP.....PGAA....PP...-QP.Y.A.Yg...........aaPPg.............pGPRPEQHA...PRPRRADDNV............................................................................................
A1CSM6_ASPCL/533-664                   ...............................KHRSR........SR.E...IAEAAL....A.A...T..G....V.G....Y.A..A...H...K..LK..QHRDHKK.-..............................-E.ER..E..RS...........K.......Y..........EDD...--........---.-.-S.F......SE....P....P..........YPP.SPL..pPA..Q.QPAETQ--.......FY.........PN..T.NYF...P........P.PPGP...........TPV.......---.--....-PI..A..NNMP......YNP..AD...Y..PPP.....PGAV....PP...AQG.Y.G.Y..............PP...............ESGPNRYA...PRPRRADENV............................................................................................
A0A194X7G0_9HELO/505-597               ...............................RSKSR........IR.T...GAEIAG....-.A...G..L....A.G....A.A..VaglY...E..NR..KAKEDVR.Ee...........................veED.RR..E..RR...........R.......S..........RSR...ARs......vGAY.S.DP.G.....vDP....ElgmvQ..........YGT.EPV...YT..H.TPA-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------yqqgydydp...................................................................................
W2RLM0_9EURO/515-654                   .............................rdRSRSR........IR.T...AAPVVA....-.-...A..G....L.G....S.AalA...G...L..YE..RNKAKKE.Aev.........................iqkDE.RR..N..RS...........R.......S..........RSR...AR........SEY.T.EG.Y......RD....G....P..........LND.PGLi.eYG..D.GPMHGNN-.......-Y.........GE..G.YYG...R........P.APQE...........GYY.......---.AN....QTA..V..VPAPg....tAAP..AP...Y..GA-.....----....--...---.-.-.-..............--...............--------...----------trdfrdpspgygrerrsrs.........................................................................
S3CWZ7_OPHP1/493-635                   ...............................RSHSR........IR.T...GAEIAA....-.A...G..L....A.G....A.A..A...K...K..IY.dKHQDKKE.V..............................ER.DR..E..LN...........R.......E..........LD-...YS........DEY.E.DD.R......GH....H....S..........ARH.STR...SL..S.RSQSR---.......SR.........SA..H.PRA...P........Y.PPST...........ADA.......---.--....-DE..L..GLVE......YGS..QP..lY..ADP.....ANSN...aAT...YNR.S.S.Y..............DSa............adAVDQDDR-...----------hrrhrrhrsrr.................................................................................
V5G1I1_BYSSN/410-507                   ............................ersRSRSR........IR.Q...ALPIVA....A.G...L..G....S.A....A.A..A...G...L..YE..KNKAKKE.N..............................EE.GR..Q..RR...........S.......R..........SRS...R-........SRS.G.TN.-......PD....A....P..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rdsaglieygdrpvygnipeadyygrptspdgyysda.......................................................
G3XV77_ASPNA/397-504                   ..........................rsrsrRRESR........SH.S...AIRKALp..vV.A...A..G....L.G....T.A..A...A...TglYE..KNKEKKE.E..............................EE.SR..R..RE...........R.......R..........RSR..sRS........RAP.S.EV.Y......-P....D....P..........TRD.SPG..lIE..Y.G-------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dhpvhgsippnyygrpvsphgyysdasd................................................................
A0A177CV39_9PLEO/1-101                 ............................qed-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..-------.-..............................--.--..-..--...........-.......-..........---...--........---.-.SA.Y......ST....G....S..........YSP.PP-...--..-.-PGAEDPQ.......YF.........PQ..T.NYF...P........P.PPTQ...........---.......PVD.YS....NNN..N..NYPP......YNP..AD...Y..PPPnngysPSNA...gHI...HPA.T.G.Yt............pPP...............PEPGNPYAhqdPRYRRPDDNV............................................................................................
A0A0D2K9Q9_9EURO/624-785               .............................dr-SRRR.......hSR.D...AAKMTA....A.A...A..A....G.A....I.G..A...T...E..YE..KRKQDRR.E..............................RR.AR..K..RR...........E.......E..........EGY...GR........DPY.D.DN.F......NP....G...tQ..........YAP.TPPppgPV..I.DPYANQQG.......FY.........PQ..T.SQF...P........P.PPGA...........VPQq....ypPQA.GP....GTA.pP..GAAP......YPP..QN...Y..PPPp..ppPPAA....PP...APT.Q.P.Y..............DA..............yASGANPYA...PRG-------penvsae.....................................................................................
A0A139ISU8_9PEZI/658-831               ...............................RSRSR........RR.H...LAEAGA....A.A...G..V....A.A....V.A..A...H...E..IG..KRRERSR.A..............................SR.SR..E..GR...........R.......EyqpprvstasD--...-Tdga.gpedDYY.D.DR.R......PD....D....P..........YAP.PPM..gNS..Y.PPYQNQDPya...qqAY.........PG..A.NYF...P........P.PPNG...........ETS.......GYV.EP....QPA..Y..AHAQ......YNP..AD...Y..AGQ.....PATQ...aPY...DHQ.P.A.Yggy........gepHP...............GQSHHNYA...HDAQYGD---egr.........................................................................................
W9Y839_9EURO/372-454                   .........................rsrsrrRSRSRsgs..pskFK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AA..KRMNKNK.E..............................EP.RR..S..RS...........Q.......H..........RRE...SL........SSL.E.ND.A.....sAP....S....D..........---.---...TA..R.NPK-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------hrnk........................................................................................
A0A0U1M4K8_9EURO/257-321               ......................rhrsrsrss-SHSR........AK.T...LAGIGL....G.A...A..A....L.A....G.A..V...A...V..AR..KKSQSNR.D..............................RR.SR..S..RH...........R.......R..........DSP...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srvdsarsss..................................................................................
H1UXZ2_COLHI/511-639                   ...............................RSKSR........IR.T...GAEVVA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKDKKD.R..............................EV.DR..ElsDQ...........E.......Y..........EEE..lRR........ERR.E.RR.R......SR....S....R..........SQA.R-S...LY..P.EPRSADPElg..lveYGt.......sPL..P.TDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------msgddyddaepak...............................................................................
E9E4W9_METAQ/602-663                   ...............................RSRSR........LR.D...VAAAGA....A.A...G..A....A.A....M.G..I...K...E..FK..DRKDRKD.Q..............................EKrDR..R..SR...........E.......R..........DDE...RR........N--.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------vvlvqktetdq.................................................................................
A0A135U1E0_9PEZI/692-844               ...............................RSRSR........DR.S...VTREGT....Y.S...R..E....R.A....Y.S..R...E...R..ST..DDRMRNR.-..............................ER.ER..D..RR...........R.......Y..........EED..aRD........DGY.Y.DN.Y......--....-....S..........RPP.SP-...--..-.-PHASGGS.......F-.........--..-.--Y...P........P.PPAAag......agfTQH......pNIS.TA....NLR..D..QYPP......YPS..SDs.vY..PPG.....PPPM....GP...SPP.M.A.Tgga........ggyPP...............--------...----------pppaggppppdggpprtrfgpdh.....................................................................
A0A165A7V2_9PEZI/359-408               ...............................RSRSR........SR.H...LAEAAA....V.A...G..A....A.G....L.A..A...N...E..IG..KRRERKK.Q..............................DK.ER..R..Q-...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------inlfhrsrr...................................................................................
A0A161Y9K7_9PEZI/741-876               ...............................RSRSR........DR.S...ISRDRA....Y.S...R..D....R.A....Y.S..R...E...R..ST..DRLR-NR.-..............................DR.ER..D..RR...........G.......Y..........EDT..aRD........DGY.Y.DD.Y......--....-....S..........RPP.SP-...--..-.-PHASGG-.......--.........--..-.SYY...P........P.PPAAaa.......gfTQH.......PNIsTA....NLR..D..QYPP......-YP..QD...Y..PPG.....PPPM....GP...SPP.M.A.Tgga........ggyPP...............--------...----------pppaggpppsg.................................................................................
M3CFH9_SPHMS/555-643                   .............................rdRSKSR........VR.T..gVPIAAA....G.L...G..G....A.A....L.A..G...-...L..YE..KNKANKE.Akkemv....................iedelNR.GR..H..RS...........R.......S..........RSR...SR........RPS.M.VA.Y......GD....-....-..........---.---...--..-.EPIEHG--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------drgyysdeepgry...............................................................................
M2TBE1_COCSN/587-741                   ...............................RSKSR........AR.A...VAETAA....V.A...G..V....A.G....L.A..A...H...E..AT..KRRDRKK.A..............................EK.EA..E..RR...........R.......E..........EDS...--........AYS.T.ST.Y......-D....S....P..........YGS.PT-...-A..S.TAYTNDSR.......YF.........PE..T.NYF...P........P.PPNA...........---.......PAI.DP....NAH..S..PYPP......YNP..AD...Y..PPP.....PNTA...yEP...NHP.S.Q.Yi............qPPhsdvhv...gnpyapPQPHDAYY...GQPRRTDGNV............................................................................................
A0A0F7TW88_9EURO/493-640               ...............................KHRSR........SR.D...LASAAL....G.A...T..G....L.G....Y.A..A...H...K..YS..QHRDRKK.S..............................ER.SRsrS..RT...........R.......Y..........END..aHR........DPY.E.ES.Y......DP....E....P..........YPI.SPQ..aAH..Q.QPTE---N.......YY.........PN..S.NYF...P........P.PPGS...........TPN.......---.--....-LN..A..TPQP......YNP..AD...Y..PHP.....PGAA....PP...PQP.Y.N.Yga.........gnpGP...............ETYPETYA...PRPRRADENV............................................................................................
A0A168JB54_MUCCL/525-568               .............................kr-----........--.-...--DAAL....G.A...G..A....A.G....L.A..G...H...E..LK..NHHDKE-.-..............................--.--..-..--...........-.......-..........---...--........---.-.--.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------sglegahhtsgnplhsgsg.........................................................................
W9WD84_9EURO/379-466                   .............................rhRSRSRses..pskLK.T...LGAVGL....G.A...A..A....L.A....A.A..A...T...I..AT..KRMNKKN.Gdd..........................ddRR.GR..S..HS...........R.......S..........RSR...RR........AES.V.SS.I......EN....D....P..........DAP.SD-...DA..R.NPKH----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------rrnt........................................................................................
A0A0N7Z0T5_ROSNE/395-458               .............................rhRSKSR........SR.L...ATGLAI....G.A...A..A....L.A....V.A..G..gL...K..YMqnNKIDKEE.D..............................HR.GR..A..RR...........R.......H..........SDD...--........-GY.S.A-.-......--....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsssrrg....................................................................................
A0A167AKY9_9HYPO/444-515               .............................rsRSKSR........LR.T...GAKIAG....A.A...A..A....A.G....V.A..G...K...L..YK..NHQEKKE.R..............................ER.SR..S..RA...........L.......S..........DED...--........DRY.Y.NR.R......GK....S....H..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------srsrsmarslhs................................................................................
A0A135U1E0_9PEZI/515-643               ...............................RSKSR........IR.T...GAEIAA....A.G...L..A....G.G....V.A..S...K...I..YK..NRKEKKD.Re............................lDR.EL..D..EQ...........D.......Y..........EEE..vRR........ERR.E.RR.R......SR....S....R..........SQA.-RS...LY..S.EPRSADPElg..lveYGt.......ePL..P.SDP...P........Y.PPDD...........GYE.......SAA.NE....RRR..R..RHRR......MSG..DD...Y..---.....----....--...---.-.-.-..............--...............--------...----------dghepak.....................................................................................
A0A0J8RJW6_COCIT/287-350               ..............................t-SRSR........AR.T...LAGLGL....G.A...A..A....I.A....G.A..V...A...L..AK..KHSEKSS.K..............................QR.SS..G..RR...........S.......R..........SHR...RR........SSS.A.SS.S......S-....-....-..........---.---...--..-.--------.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------dardpdh.....................................................................................
Q0C9I2_ASPTN/392-495                   ...........................rkhsRSHSR........LR.K...ALPVVA....A.G...L..G....T.A....A.A..T...G...L..YE..KHKDKKE.E..............................EE.SR..H..RG...........R.......R..........RSR..sRS........RAP.S.DI.Y......-P....D....P..........TRD.SAGlieYG..E.HPVAGS--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------ipaadyygrpasqqgyysdasd......................................................................
U7PSX9_SPOS1/723-832                   ........................dfdrdhd-----........--.-...------....-.-...-..-....-.-....-.-..-...-...-..--..RQRDYDH.-..............................DE.DV..N..HH...........R.......D..........DEE...AY........DGY.Y.DD.Y......-D....N....S..........RPP.SP-...--..-.-PHASGGA.......FY.........P-..-.---...P........A.PPGGapig..ttgglMQH......pNTA.TT....NLN..D..SYAP......YNP..VDysgY..PPP.....PGP-....PP...---.-.-.-..............--...............--------...----------trgaadvq....................................................................................
R8BUE6_TOGMI/546-644                   .............................ksRSRSR........LR.T...GAEIVA....-.A...G..L....A.G....A.A..G...K...K..LY.dRHKDKKE.D..............................QR.ER..-..-E...........L.......E..........ED-...--........EYY.D.RE.R......RR....S....R..........SRS.-RS...VA..R.APYPNP--.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------gtadpelglveygaqplyteppypeyay................................................................
A0A135M0D6_PENPA/537-678               ...............................KHRSR........SR.D...LAGAAL....G.A...T..G....L.G....Y.A..A...H...K..YN..ERRKSK-.-..............................ER.ER..E..YK...........H.......D..........DNV...HR........DPY.E.ES.Y......DP....E....P..........YPL.SPQ..aAP..G.APPMADP-.......HY.........PN..-.NYF...P........P.GDST...........YNL.......---.--....-NG..G..TPAP......YNP..AD...Y..PPP.....PCAA....PP...-QP.Y.A.Yga..........vpGP...............GPGPEQYA...PRPRRAEDNV............................................................................................
A0A094EQ88_9PEZI/1172-1242             ...............................RSRSR........AR.D...VLGGAA....A.A...T..A....A.A....V.G..V...R...K..YK..ARRKRRE.E..............................EA.AR..E..RR...........A.......Y..........TPA...-I........TLS.S.TH.L......-P....T....P..........PIS.PP-...--..-.TPF-----.......--.........--..-.---...-........-.----...........---.......---.--....---..-..----......---..--...-..---.....----....--...---.-.-.-..............--...............--------...----------tstht.......................................................................................
A0A0N7Z0T5_ROSNE/613-787               .............................kkRSRST........LR.D...VAAAGL....G.T...A..A....A.A....I.G..I...K...K..YS..DHQKNKE.Rgersregseaqs.....rsrdrsdrardrrSR.DR..Q..RR...........Rg.....gY..........EEE..aAG........NSY.Y.PS.Y......DV....N....A..........PPP.SP-...--..-.-PNASGG-.......-F.........PP..A.NQG...P........P.PPPPvgp.....ggfTHH......sNQS.TT....NLN..N..PYPP......YNP..QD...Y..VNIp...pPPPG....PP...PAP.G.S.Y.............fPP...............-P------...----------gvpghgtgpen.................................................................................
M2MVN7_BAUCO/647-824                   ...............................RRRSR........SR.H...LAETGA....A.A...G..A....A.A....V.A..A...H...E..MG..KRRERSR.-..............................QR.DE..Q..QR...........H.......G..........QEG...YQ........DQY.G.YG.H.....dQD...yP....D..........YHS.AQQ..pGG..Y.LPADNAQ-.......QY.........PN..S.HYF...P........P.PPTGe........yaT-A......rGEP.AA....AEQ..S..PYPA......YNP..AD...Y..AQS....gPQPH....QP...YGQ.L.H.Ga...........ynESdan.........lgaPYPNDTFA...GD--------trydappaaahhergrgreppenv....................................................................
Q4X209_ASPFU/555-690                   ...............................KHRSR........SR.E...LAEAAL....A.A...T..G....V.G....Y.A..A...H...K..YK..QSRDRKK.-..............................-E.ER..E..RS...........K.......Y..........DD-...--........DSY.P.SS.Y.....pSD....L....P..........YPP.SPL...PP..T.QPGEHP--.......YY.........PN..S.NYF...P........P.PPGS...........TPA.......---.--....-PP..A..PAAP......YNP..AD...Y..PPP.....PGAV....PP...AQP.Y.G.Y..............PP...............EPGPDRYA...PRPRRADENV............................................................................................
#=GC seq_cons                          ...............................+S+SR........hR.p...hAtsuh....u.A...u..u....u.u....h.A..u...p...p..hp..c++c+cc.t..............................c+.pR..p..Rp...........c.......p..........cpp.............t...t.p..h.................................................................................................................................................................................................................................................ttt.........................................................................................
//
DBGET integrated database retrieval system