GenomeNet

Database: Pfam
Entry: DUF3824
LinkDB: DUF3824
Original site: DUF3824 
#=GF ID   DUF3824
#=GF AC   PF12868.5
#=GF DE   Domain of unknwon function (DUF3824)
#=GF AU   Coggill P
#=GF SE   manual
#=GF GA   22.70 7.90;
#=GF TC   22.70 7.90;
#=GF NC   22.20 7.80;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024436;
#=GF CC   This is a repeating domain found in fungal proteins. It is
#=GF CC   proline-rich, and the function is not known.
#=GF SQ   273
#=GS J4UHD6_BEAB2/569-694        AC J4UHD6.1
#=GS J4UHD6_BEAB2/446-517        AC J4UHD6.1
#=GS D4AU90_ARTBC/558-692        AC D4AU90.1
#=GS A0A084G042_9PEZI/617-801    AC A0A084G042.1
#=GS W9XLQ4_9EURO/605-791        AC W9XLQ4.1
#=GS A0A093Y5R9_9PEZI/922-999    AC A0A093Y5R9.1
#=GS T0KDB4_COLGC/499-622        AC T0KDB4.1
#=GS C1GDB7_PARBD/373-477        AC C1GDB7.2
#=GS F2SD33_TRIRC/552-673        AC F2SD33.2
#=GS H1UXZ2_COLHI/641-824        AC H1UXZ2.1
#=GS J3KI03_COCIM/347-390        AC J3KI03.2
#=GS F0U958_AJEC8/417-526        AC F0U958.1
#=GS N4VHF5_COLOR/690-809        AC N4VHF5.1
#=GS A0A094GA47_9PEZI/514-670    AC A0A094GA47.1
#=GS C4JEK8_UNCRE/435-503        AC C4JEK8.1
#=GS A0A0D9MW47_ASPFL/304-375    AC A0A0D9MW47.1
#=GS W9Y839_9EURO/483-592        AC W9Y839.1
#=GS G2WRI8_VERDV/510-640        AC G2WRI8.1
#=GS B6HIZ7_PENRW/639-721        AC B6HIZ7.1
#=GS B5YNX9_THAPS/110-231        AC B5YNX9.1
#=GS W6PSX9_PENRO/493-646        AC W6PSX9.1
#=GS M7SU52_EUTLA/431-502        AC M7SU52.1
#=GS C8V000_EMENI/27-137         AC C8V000.1
#=GS B5YNX8_THAPS/64-186         AC B5YNX8.1
#=GS W3XH82_9PEZI/412-478        AC W3XH82.1
#=GS A0A063BU25_9HYPO/461-571    AC A0A063BU25.1
#=GS A0A0G2JAW1_9EURO/566-703    AC A0A0G2JAW1.1
#=GS M2ZPK6_PSEFD/581-658        AC M2ZPK6.1
#=GS C5G976_AJEDR/540-677        AC C5G976.1
#=GS S2JHI7_MUCC1/121-203        AC S2JHI7.1
#=GS E3QDR6_COLGM/476-517        AC E3QDR6.1
#=GS G3XV77_ASPNA/556-686        AC G3XV77.1
#=GS A0A066XKL1_COLSU/488-526    AC A0A066XKL1.1
#=GS A1CSM6_ASPCL/393-490        AC A1CSM6.1
#=GS R0K5Y5_SETT2/571-717        AC R0K5Y5.1
#=GS S9VEY3_9TRYP/92-148         AC S9VEY3.1
#=GS G2XR77_BOTF4/694-849        AC G2XR77.1
#=GS Q2TZD9_ASPOR/411-515        AC Q2TZD9.1
#=GS E9DDF0_COCPS/382-493        AC E9DDF0.1
#=GS A0A0D9MKW4_9EURO/545-695    AC A0A0D9MKW4.1
#=GS W9CAG8_9HELO/706-865        AC W9CAG8.1
#=GS A0A0K8LFQ8_9EURO/377-478    AC A0A0K8LFQ8.1
#=GS W9Y839_9EURO/635-791        AC W9Y839.1
#=GS J3KI03_COCIM/510-672        AC J3KI03.2
#=GS E9DDF0_COCPS/346-390        AC E9DDF0.1
#=GS F2TF46_AJEDA/468-605        AC F2TF46.2
#=GS N4VHF5_COLOR/631-705        AC N4VHF5.1
#=GS Q0C9I2_ASPTN/296-363        AC Q0C9I2.1
#=GS E3QDR6_COLGM/512-642        AC E3QDR6.1
#=GS U4LPE7_PYROM/313-369        AC U4LPE7.1
#=GS G2WRI8_VERDV/647-806        AC G2WRI8.1
#=GS W3XH82_9PEZI/344-396        AC W3XH82.1
#=GS Q0C9I2_ASPTN/537-583        AC Q0C9I2.1
#=GS A0A0A1TGS9_9HYPO/569-721    AC A0A0A1TGS9.1
#=GS G7XHH0_ASPKW/403-503        AC G7XHH0.1
#=GS S7ZET0_PENO1/261-338        AC S7ZET0.1
#=GS A0A0F0I0U5_ASPPA/563-702    AC A0A0F0I0U5.1
#=GS G7XHH0_ASPKW/302-375        AC G7XHH0.1
#=GS F2TF46_AJEDA/339-450        AC F2TF46.2
#=GS U1HT54_ENDPU/646-826        AC U1HT54.1
#=GS J3KI03_COCIM/382-492        AC J3KI03.2
#=GS A0A0G3A5Q5_9ACTN/4-80       AC A0A0G3A5Q5.1
#=GS B6HIZ7_PENRW/465-641        AC B6HIZ7.1
#=GS A0A0F4GXD0_9PEZI/617-791    AC A0A0F4GXD0.1
#=GS K9FWG0_PEND2/303-374        AC K9FWG0.1
#=GS F7W3Z0_SORMK/486-611        AC F7W3Z0.1
#=GS U4LPE7_PYROM/208-267        AC U4LPE7.1
#=GS B8M1D8_TALSN/257-313        AC B8M1D8.1
#=GS K2S5L1_MACPH/347-423        AC K2S5L1.1
#=GS A0A0A2K6U1_PENEN/544-693    AC A0A0A2K6U1.1
#=GS G9PCA8_HYPAI/433-520        AC G9PCA8.1
#=GS A0A066XKL1_COLSU/654-857    AC A0A066XKL1.1
#=GS S2K5A6_MUCC1/218-328        AC S2K5A6.1
#=GS U4LPE7_PYROM/365-409        AC U4LPE7.1
#=GS C4JEK8_UNCRE/210-277        AC C4JEK8.1
#=GS H0EK30_GLAL7/414-498        AC H0EK30.1
#=GS A0A0M8P4S7_9EURO/502-653    AC A0A0M8P4S7.1
#=GS A0A084G042_9PEZI/487-604    AC A0A084G042.1
#=GS S7ZET0_PENO1/503-650        AC S7ZET0.1
#=GS J3KI03_COCIM/287-350        AC J3KI03.2
#=GS C6HTC0_AJECH/453-591        AC C6HTC0.1
#=GS G3XV77_ASPNA/402-507        AC G3XV77.1
#=GS A0A074W448_9PEZI/322-398    AC A0A074W448.1
#=GS C1HCJ5_PARBA/372-479        AC C1HCJ5.2
#=GS W9XB18_9EURO/633-794        AC W9XB18.1
#=GS A1DGB5_NEOFI/393-493        AC A1DGB5.1
#=GS A0A074WG27_9PEZI/559-713    AC A0A074WG27.1
#=GS A0A093YVZ9_9PEZI/8-61       AC A0A093YVZ9.1
#=GS M7SU52_EUTLA/536-613        AC M7SU52.1
#=GS E5R2F7_ARTGP/552-689        AC E5R2F7.1
#=GS W9XLQ4_9EURO/374-456        AC W9XLQ4.1
#=GS A0A0A1TGS9_9HYPO/445-522    AC A0A0A1TGS9.1
#=GS M7SU52_EUTLA/643-784        AC M7SU52.1
#=GS C4JEK8_UNCRE/306-417        AC C4JEK8.1
#=GS N1PM89_DOTSN/650-820        AC N1PM89.1
#=GS W9XB18_9EURO/484-592        AC W9XB18.1
#=GS C8V000_EMENI/175-307        AC C8V000.1
#=GS A0A074YPM7_9PEZI/306-384    AC A0A074YPM7.1
#=GS A1CSM6_ASPCL/293-356        AC A1CSM6.1
#=GS S2JHI7_MUCC1/203-279        AC S2JHI7.1
#=GS A0A0F0I0U5_ASPPA/304-380    AC A0A0F0I0U5.1
#=GS A0A0F8UEJ4_9EURO/530-673    AC A0A0F8UEJ4.1
#=GS S3CWZ7_OPHP1/661-722        AC S3CWZ7.1
#=GS W3XH82_9PEZI/247-324        AC W3XH82.1
#=GS E3QDR6_COLGM/644-706        AC E3QDR6.1
#=GS A7EI77_SCLS1/616-786        AC A7EI77.1
#=GS F9XE98_ZYMTI/399-476        AC F9XE98.1
#=GS C5G976_AJEDR/400-520        AC C5G976.1
#=GS A0A0F2MLK1_SPOSC/496-647    AC A0A0F2MLK1.1
#=GS W2RLM0_9EURO/664-810        AC W2RLM0.1
#=GS A0A0L1J2N0_ASPNO/527-588    AC A0A0L1J2N0.1
#=GS A0A0F2MLK1_SPOSC/670-735    AC A0A0F2MLK1.1
#=GS Q0UZC8_PHANO/537-676        AC Q0UZC8.2
#=GS U4LPE7_PYROM/462-545        AC U4LPE7.1
#=GS M1W061_CLAP2/430-517        AC M1W061.1
#=GS M3CFH9_SPHMS/660-825        AC M3CFH9.1
#=GS C1GDB7_PARBD/522-661        AC C1GDB7.2
#=GS A0A0N0NRB6_9EURO/461-588    AC A0A0N0NRB6.1
#=GS G2QTJ0_THITE/500-544        AC G2QTJ0.1
#=GS G3JMF7_CORMM/459-600        AC G3JMF7.1
#=GS F7W3Z0_SORMK/764-824        AC F7W3Z0.1
#=GS G4N0D9_MAGO7/696-764        AC G4N0D9.1
#=GS U4LPE7_PYROM/400-461        AC U4LPE7.1
#=GS W9XB18_9EURO/369-457        AC W9XB18.1
#=GS Q2TZD9_ASPOR/304-373        AC Q2TZD9.1
#=GS W9Y839_9EURO/376-455        AC W9Y839.1
#=GS B8M1D8_TALSN/314-354        AC B8M1D8.1
#=GS B6Q8Z7_TALMQ/490-641        AC B6Q8Z7.1
#=GS C4JEK8_UNCRE/550-601        AC C4JEK8.1
#=GS A0A080WIC1_TRIRC/552-671    AC A0A080WIC1.1
#=GS G2QTJ0_THITE/700-864        AC G2QTJ0.1
#=GS E9DDF0_COCPS/510-672        AC E9DDF0.1
#=GS R8BUE6_TOGMI/691-751        AC R8BUE6.1
#=GS A0A084G042_9PEZI/442-486    AC A0A084G042.1
#=GS B6H242_PENRW/542-687        AC B6H242.1
#=GS A0A0A2V7C7_BEABA/446-516    AC A0A0A2V7C7.1
#=GS Q0UZC8_PHANO/361-439        AC Q0UZC8.2
#=GS B8NBW3_ASPFN/561-699        AC B8NBW3.1
#=GS E9DDF0_COCPS/287-350        AC E9DDF0.1
#=GS A0A093Y5R9_9PEZI/1015-1087  AC A0A093Y5R9.1
#=GS F9XE98_ZYMTI/303-348        AC F9XE98.1
#=GS A0A074WG27_9PEZI/325-402    AC A0A074WG27.1
#=GS B6Q8Z7_TALMQ/273-331        AC B6Q8Z7.1
#=GS A0A094DD18_9PEZI/421-500    AC A0A094DD18.1
#=GS A7EI77_SCLS1/520-620        AC A7EI77.1
#=GS B8NBW3_ASPFN/412-511        AC B8NBW3.1
#=GS A0A0G2JAW1_9EURO/312-379    AC A0A0G2JAW1.1
#=GS W9WD84_9EURO/496-602        AC W9WD84.1
#=GS S2JHI7_MUCC1/469-529        AC S2JHI7.1
#=GS N4VHF5_COLOR/499-605        AC N4VHF5.1
#=GS M2ZPK6_PSEFD/811-967        AC M2ZPK6.1
#=GS K2S5L1_MACPH/581-741        AC K2S5L1.1
#=GS W9Y839_9EURO/107-204        AC W9Y839.1
#=GS G3JMF7_CORMM/325-456        AC G3JMF7.1
#=GS A0A094JE74_9PEZI/550-621    AC A0A094JE74.1
#=GS M1W061_CLAP2/575-704        AC M1W061.1
#=GS W9WD84_9EURO/642-800        AC W9WD84.1
#=GS M7U351_BOTF1/694-842        AC M7U351.1
#=GS A0A0F8UEJ4_9EURO/277-347    AC A0A0F8UEJ4.1
#=GS S2JHI7_MUCC1/359-418        AC S2JHI7.1
#=GS F7W3Z0_SORMK/827-939        AC F7W3Z0.1
#=GS W2RLM0_9EURO/515-659        AC W2RLM0.1
#=GS G3XV77_ASPNA/301-373        AC G3XV77.1
#=GS W9W1E3_9EURO/534-675        AC W9W1E3.1
#=GS S3DTS4_GLAL2/454-536        AC S3DTS4.1
#=GS A0A0N0NRB6_9EURO/357-444    AC A0A0N0NRB6.1
#=GS A0A074W448_9PEZI/552-709    AC A0A074W448.1
#=GS A2QKM3_ASPNC/402-507        AC A2QKM3.1
#=GS A0A094JE74_9PEZI/310-371    AC A0A094JE74.1
#=GS A0A072PTE1_9EURO/632-778    AC A0A072PTE1.1
#=GS G4N0D9_MAGO7/539-644        AC G4N0D9.1
#=GS A0A080WGP9_TRIRC/489-608    AC A0A080WGP9.1
#=GS A0A0D9MW47_ASPFL/561-699    AC A0A0D9MW47.1
#=GS A0A074YPM7_9PEZI/540-696    AC A0A074YPM7.1
#=GS A0A080WQ72_TRIRC/489-609    AC A0A080WQ72.1
#=GS H6C6Y6_EXODN/487-594        AC H6C6Y6.1
#=GS G2QTJ0_THITE/535-639        AC G2QTJ0.1
#=GS E3QDR6_COLGM/691-852        AC E3QDR6.1
#=GS R8BUE6_TOGMI/744-875        AC R8BUE6.1
#=GS J4TVZ1_9PAST/65-121         AC J4TVZ1.1
#=GS A0A0G2JAW1_9EURO/416-525    AC A0A0G2JAW1.1
#=GS A0A094DD18_9PEZI/514-670    AC A0A094DD18.1
#=GS S3DTS4_GLAL2/755-874        AC S3DTS4.1
#=GS B4R4D9_DROSI/104-194        AC B4R4D9.1
#=GS A0A0G4LM95_9PEZI/553-711    AC A0A0G4LM95.1
#=GS B2WNY2_PYRTR/600-753        AC B2WNY2.1
#=GS A0A0F8UEJ4_9EURO/379-488    AC A0A0F8UEJ4.1
#=GS A2QKM3_ASPNC/301-374        AC A2QKM3.1
#=GS F0U958_AJEC8/562-700        AC F0U958.1
#=GS H0EK30_GLAL7/634-744        AC H0EK30.1
#=GS Q0C9I2_ASPTN/595-690        AC Q0C9I2.1
#=GS Q2TZD9_ASPOR/561-699        AC Q2TZD9.1
#=GS A0A068RLC2_9FUNG/147-258    AC A0A068RLC2.1
#=GS S9VEY3_9TRYP/208-326        AC S9VEY3.1
#=GS C0NM90_AJECG/420-519        AC C0NM90.1
#=GS A0A0F4GXD0_9PEZI/399-461    AC A0A0F4GXD0.1
#=GS R8BUE6_TOGMI/546-643        AC R8BUE6.1
#=GS A0A0G4LUP4_9PEZI/76-231     AC A0A0G4LUP4.1
#=GS A0A094EQ88_9PEZI/1075-1154  AC A0A094EQ88.1
#=GS A0A0A2KDD1_PENIT/540-687    AC A0A0A2KDD1.1
#=GS S3CWZ7_OPHP1/455-493        AC S3CWZ7.1
#=GS A0A0G4LM95_9PEZI/435-528    AC A0A0G4LM95.1
#=GS W9W1E3_9EURO/364-467        AC W9W1E3.1
#=GS A0A094GA47_9PEZI/421-500    AC A0A094GA47.1
#=GS F9XE98_ZYMTI/636-829        AC F9XE98.1
#=GS U4LPE7_PYROM/264-322        AC U4LPE7.1
#=GS S3CWZ7_OPHP1/711-834        AC S3CWZ7.1
#=GS A0A0D9MW47_ASPFL/412-511    AC A0A0D9MW47.1
#=GS M2MVN7_BAUCO/431-515        AC M2MVN7.1
#=GS R7YPI0_CONA1/593-724        AC R7YPI0.1
#=GS A0A0K8LFQ8_9EURO/522-657    AC A0A0K8LFQ8.1
#=GS V5G1I1_BYSSN/557-696        AC V5G1I1.1
#=GS A0A0N0NRB6_9EURO/594-748    AC A0A0N0NRB6.1
#=GS E3RIR8_PYRTT/543-696        AC E3RIR8.1
#=GS A0A066XKL1_COLSU/524-653    AC A0A066XKL1.1
#=GS L8G585_PSED2/503-624        AC L8G585.1
#=GS A2QKM3_ASPNC/556-695        AC A2QKM3.1
#=GS A6RCP1_AJECN/562-700        AC A6RCP1.1
#=GS A1DGB5_NEOFI/538-673        AC A1DGB5.1
#=GS K1WW28_MARBU/694-854        AC K1WW28.1
#=GS L8G585_PSED2/408-485        AC L8G585.1
#=GS B8M1D8_TALSN/481-624        AC B8M1D8.1
#=GS G4N0D9_MAGO7/767-894        AC G4N0D9.1
#=GS T0KDB4_COLGC/626-691        AC T0KDB4.1
#=GS F7W3Z0_SORMK/375-438        AC F7W3Z0.1
#=GS A0A0F4GXD0_9PEZI/303-349    AC A0A0F4GXD0.1
#=GS U7PSX9_SPOS1/496-647        AC U7PSX9.1
#=GS A0A0F2MLK1_SPOSC/726-838    AC A0A0F2MLK1.1
#=GS A6RCP1_AJECN/417-526        AC A6RCP1.1
#=GS U6KG47_9EIME/184-288        AC U6KG47.1
#=GS C0NM90_AJECG/562-700        AC C0NM90.1
#=GS C6HTC0_AJECH/382-462        AC C6HTC0.1
#=GS A0A010Q3X1_9PEZI/698-844    AC A0A010Q3X1.1
#=GS G3JMF7_CORMM/253-330        AC G3JMF7.1
#=GS U7PSX9_SPOS1/670-736        AC U7PSX9.1
#=GS S3DTS4_GLAL2/689-740        AC S3DTS4.1
#=GS A0A010Q3X1_9PEZI/515-646    AC A0A010Q3X1.1
#=GS A0A074YSE8_AURPU/553-710    AC A0A074YSE8.1
#=GS W6PSX9_PENRO/699-813        AC W6PSX9.1
#=GS R0K5Y5_SETT2/335-421        AC R0K5Y5.1
#=GS A0A072PTE1_9EURO/382-456    AC A0A072PTE1.1
#=GS A0A010Q3X1_9PEZI/647-698    AC A0A010Q3X1.1
#=GS S2JHI7_MUCC1/417-457        AC S2JHI7.1
#=GS A0A063BU25_9HYPO/416-462    AC A0A063BU25.1
#=GS A0A094JE74_9PEZI/406-485    AC A0A094JE74.1
#=GS A0A072PTE1_9EURO/475-588    AC A0A072PTE1.1
#=GS F7W3Z0_SORMK/439-491        AC F7W3Z0.1
#=GS C1HCJ5_PARBA/521-660        AC C1HCJ5.2
#=GS G7XHH0_ASPKW/557-696        AC G7XHH0.1
#=GS B8NBW3_ASPFN/304-375        AC B8NBW3.1
#=GS A0A0F0I0U5_ASPPA/414-514    AC A0A0F0I0U5.1
#=GS M2TBE1_COCSN/345-431        AC M2TBE1.1
#=GS K9FWG0_PEND2/544-691        AC K9FWG0.1
#=GS E5AFM9_LEPMJ/591-752        AC E5AFM9.1
#=GS A1CSM6_ASPCL/533-664        AC A1CSM6.1
#=GS S3CWZ7_OPHP1/493-635        AC S3CWZ7.1
#=GS V5G1I1_BYSSN/410-507        AC V5G1I1.1
#=GS H6C6Y6_EXODN/641-795        AC H6C6Y6.1
#=GS A0A0L1J2N0_ASPNO/306-377    AC A0A0L1J2N0.1
#=GS T0KDB4_COLGC/456-503        AC T0KDB4.1
#=GS K2S5L1_MACPH/454-536        AC K2S5L1.1
#=GS H1UXZ2_COLHI/511-639        AC H1UXZ2.1
#=GS A0A063BU25_9HYPO/577-739    AC A0A063BU25.1
#=GS M3CFH9_SPHMS/555-643        AC M3CFH9.1
#=GS M2TBE1_COCSN/587-741        AC M2TBE1.1
#=GS A0A0F7TW88_9EURO/493-640    AC A0A0F7TW88.1
#=GS W9WD84_9EURO/379-466        AC W9WD84.1
#=GS Q0C9I2_ASPTN/392-495        AC Q0C9I2.1
#=GS A0A074YSE8_AURPU/317-394    AC A0A074YSE8.1
#=GS U7PSX9_SPOS1/723-832        AC U7PSX9.1
#=GS A0A094EQ88_9PEZI/1172-1242  AC A0A094EQ88.1
#=GS M2MVN7_BAUCO/647-824        AC M2MVN7.1
#=GS Q4X209_ASPFU/555-690        AC Q4X209.1
J4UHD6_BEAB2/569-694                   .............................rkRSRSR........LRN...MPSAGA....--.-....-A.A....F.G..I..K...E..YK..DKKDREK.R..................................eRR.SR..E..RR..R.......SRDD...--........--Y.D.DG.Y..DR..R....D..........DRP.SS-...--..-.PLHASGGA................YY............PP---Y...P........T.TP.AAgg....pgdYNP......yNNP.AA.AQ..S..H.EYQP.....YVPQDymgY..APP.....PPPG....PP...P---.--..............--................------------------apvpgp...................................................................
J4UHD6_BEAB2/446-517                   ...............................RSKSR........LRT...GAKIAG....AA.A....AA.G....V.A..G..K...L..YK..NHQEKKE.R...................................ER.SR..S..RA..P.......SDDD...--........DRY.Y.DR.R..AR..S....H..........S--.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rsrsmarslhsda............................................................
D4AU90_ARTBC/558-692                   ...............................RSRSRhgn..gnlAAG...LAAAGL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......YDRD...YR........DPY.E.EE.Y..-P..S....P..........PGP.PPG..pAS..Y.QPPAAQE-................YYgvpp....psgpPGGRGY...P........P.PP.GP.........---.......---.--.--..-..-.---P.....--PGP..gY..FGG.....PGP-....--...----.GG..............PP................VYRGDENVPQPSRQHQN-g........................................................................
A0A084G042_9PEZI/617-801               ...............................RSRSR........LRE...MAAAAL....GT.G....AA.A....M.G..F..K...E..YK..DRKKSKS.Rdrdmps......................dreaesaDD.RR..E..RR..R.......RERE...RR........RYE.N.DD.Y.yDD..D....G..........YPP.SPR..hASggS.RPRMSGANsdp.........ndfsTY............PPQTYY...P........V.PP.DA.........TATypppgppPAD.AP.VY..T..S.YPPP.....QEPNA...Y..PGP.....PPP-....-P...GAVP.GY..............PP................PTA---------------pgpapgpapgpsnrpppigpehn..................................................
W9XLQ4_9EURO/605-791                   .rsrsrsvsrerggrrssrshsssserskhgR-RRS........SHD...AAKMAA....AA.G....AG.A....I.A..A..T...E..YE..KRKQEKR.-...................................ER.KA..R..RR..R.......EEEG..yAG........DPY.E.DN.Y.hPS..Q....P..........YPP.TPP..pPV..N.DPYAAQQG................FY............PQTSQF...P........P.PP.GS.........VPQq.....yPPQ.QP.PP..T..A.GPAAg...tSYPTQ..pY..PPP.....PPAG...gPP...PTTN.PY..............DA...............yGSGANPYPPRG-------penvsdep.................................................................
A0A093Y5R9_9PEZI/922-999               ...............................RSKSR........IRT...GAELAA....AG.L....AT.A....A.A..A..N...L..YE..RRKAKQE.G...................................DR.SR..S..VS..R.......SLSR...SR........SRS.R.GG.R..GL..D....E..........YER.P--...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------glveygaqplhsrg...........................................................
T0KDB4_COLGC/499-622                   ...............................RSKSR........LRT...GAEIAA....AG.L....AG.G....V.A..S..K...I..YK..NRKDKKE.R...................................EI.ER..E..LSdeE.......YEED..lRR........ERR.R.SR.R..RS..R....S..........RSQ.ARS...LY..S.EPRNADTElg............lvEYg.........taPLPSEP...P........Y.PP.DD.........G--.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------yesaanerrrrrhrdgrddpep...................................................
C1GDB7_PARBD/373-477                   ...............................RSRSR........IRQ..gLPIAAA....SL.G....SA.A....I.A..-..G...L..YE..KHKEKKE.N...................................ES.SE..R..HH..R.......HRSR..sRS........VAP.S.SA.Y..-S..D....P..........SGS.APQlieYG..D.DPVYGS--................-I............PTNHYY...G........R.PS.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srqsspraiessfrrr.........................................................
F2SD33_TRIRC/552-673                   ...............................RSRSRhgn..gnlAAG...LAAASL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......YDRD...YR........DPY.E.EE.Y..-P..S....P..........PGP.PPG..pAS..Y.QPPAAQE-................YYgvpp....ppgpPGGRGY...P........P.PP.GP.........PP-.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gpgyfggpgpggppvyrgd......................................................
H1UXZ2_COLHI/641-824                   ...............................RSKSR........LRD...MAAAAV....GT.G....AA.A....I.G..I..K...Q..YQ..KRKEKDE.D...................................RY.EE..S..V-..-.......----...RD........DGY.Y.DD.Y..--..-....S..........RPP.SP-...--..-.-PHASGGS................Y-............-----Y...P........P.PP.APta.....gfTQH.......PNIsTA.NL..R..D.QYPP.....-YPQD...Y..PPG.....PPPM....GP...SPPM.A-..............--................------------------tggaggyxppppaggpppsggpppgtrfgpdhvsdelsrsaspqdaqpveqqaeeearkqedppslseeqles
J3KI03_COCIM/347-390                   ...........................dpdh----R........NRR...MAEAGL...aGA.A....VA.G....L.V..E..H...V..RS..KSRSRKG.R...................................SR.SR..I..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tg.......................................................................
F0U958_AJEC8/417-526                   ...................kspgrirqgipi-----........---...-AVAGL....--.G....SA.A....-.I..A..N...L..YE..KHKEKKE.S...................................ES.-S..E..RK..E.......KNHR...RRsr...srsMAR.S.ST.Y..-P..D....P..........SRS.SPQlieYG..D.DPV-----................-Yg.........siPANNYY...G........R.PP.SR.........QSS.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------spraieasprrss............................................................
N4VHF5_COLOR/690-809                   ...................rdrgyprdrass-----........---...------....--.-....--.-....-.-..-..-...-..--..-RDRPIN.R...................................ER.ER..D..RR..R.......YDEA...PR........EGY.Y.DD.Y..--..-....S..........RPP.SP-...--..-.-PHASGGA................Y-............-----Y...P........P.PA.ATsa.....sfTQH.......PNI.STtNL..R..D.TYPP.....-YPQD...Y..PTP.....PMAT....GG...A--G.GY..............PP................PP----------------pggpppaggppsttrf.........................................................
A0A094GA47_9PEZI/514-670               ...............................RSRSR........ARE...MLGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RH..-.......-YSS...--........DSY.P.SS.R..RS..A....D..........YSP.SP-...--..-.-PHASGGA................YY............PNHPTQ...Q........Q.PP.TH........pYPT.......TPD.AH.PY..G..A.HPDP.....NAPTA...F..PPP.....PVP-....-P...SGAY.HP..............PPm..............gG-----------------yeaqsqggpssggppgpghvnpdyygetaggaga.......................................
C4JEK8_UNCRE/435-503                   ............................rsg--RSR........SRD...LATAGL...aAA.G....AA.G....I.A..A..H...E..YK..QRKERKK.N...................................ER.DR..G..MN..K.......RKR-...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ksrpvictmihmtlrplthpp....................................................
A0A0D9MW47_ASPFL/304-375               ......................rsrsrshsh-SHSR........ART...LAELGL....GA.A....AI.A....G.A..V..A...L..AR.nKSKDERR.-...................................SR.SR..H..RS..R.......SRHH...R-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sssvrsgkttdgekrs.........................................................
W9Y839_9EURO/483-592                   .............................keRSRSR........IRQ..aLPIVAA....GL.G....SA.A....L.A..G..-...L..YE..KNKAKKE.Aee..............................iakEQ.RR..A..RS..R.......SRSR..aKS.......dGYY.D.GP.R..-D..A....A..........LSD.PGLi.eYG..T.GPMYGNN-................FG............PDYYGR...P........P.PP.EG.........Y--.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ygasdavvp................................................................
G2WRI8_VERDV/510-640                   ...........................rsrsRSKSR........IRQ...GAEVVA....-A.G....LA.G....G.A..A..S...K..LW.hSRKDKKE.Akere...........................lsdeEY.EE..E..QR..R.......R---...--........DRA.A.RR.R..SR..S....R..........SQA.RS-...LY..S.EPRTDGPIgl............veY-............-GTD--...P........L.PP.SQ.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ppyptndygyesassqrrrrrsrgrgaddyspsg.......................................
B6HIZ7_PENRW/639-721                   ............................rgd--RSR........SRE...ISSAAL....GA.T....GL.G....Y.A..A..H...K..YS..QQKVRRR.S...................................-E.ER..E..LL..W.......KKEK..kEE........VSR.K.RS.R..SC..S....D..........NDD.APR..gRT..R.TPYNQ---................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dlispav..................................................................
B5YNX9_THAPS/110-231                   .......................rnggedde-----........---...------....--.-....--.-....-.-..-..-...-..YE..ME--RRR.-...................................QM.EE..E..RY..R.......LQDE..iRH........QMD.D.DN.Y..SD..H....H..........SRQ.LSR...RS..R.DPESDEAS................RR............SNMSGV...P........P.PP.RS.........VRS.......--G.HS.QS..H..Q.SRSR.....YDPDG...M..SHD.....FGAD....DP...-DGR.HY..............AP................GLN---------------nhggvpsvhtg..............................................................
W6PSX9_PENRO/493-646                   ...............................RHRSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSR-.-...................................ER.DR..E..HS..T.......HDDN..vHR........DPY.E.ES.Y..NP..E....P..........YPL.SPQ..aAP..S.APPMPDPH................YYpsnp...npnpnPNPNYY...P........P.PP.GD.........STY.......---.--.NL..N..S.TPAS.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........aaPP................GPGPEQYTHRPRRAEDNV.........................................................................
M7SU52_EUTLA/431-502                   ..............................r-HRSK........SRS...RLKTGL....AI.G....AA.A....L.A..V..AgglK..YMqdNKVEKEE.A...................................NR.GR..A..RR..R.......YSSG...--........---.-.-S.Y..SR..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------spsyghskshskshsk.........................................................
C8V000_EMENI/27-137                    ...........................rsrsRSKSR........IRK...ALPVVA....AG.L....GS.A....V.A..A..N...I..WD..KKKDKEA.E...................................EE.PR..R..KD..R.......HRSR..sRG........RAP.S.DI.Y..PD..S....T..........RDS.AGLi.eYG..D.HPVHGS--................-I............PAANYY...G........R.PP.SS.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pgyhtdasdrvardag.........................................................
B5YNX8_THAPS/64-186                    ......................trnggedde-----........---...------....--.-....--.-....-.-..-..-...-..YE..ME--RRR.-...................................QM.EE..E..RY..R.......LQDE..iRH........QMD.D.DN.Y..SD..H....H..........SRQ.LSR...RS..R.DPESDEAS................RR............SNMSGV...P........P.PP.RS.........VRS.......--G.HS.QS..H..Q.SRSR.....YDPDG...M..SHD.....FGAD....DP...-DGR.HY..............AP................GLN---------------nhggvpsvhtg..............................................................
W3XH82_9PEZI/412-478                   ..............................d-HRSR........DAA...LG-AGA....AT.G....VA.A....Y.G..M..H...E..YN..KYKEPSA.-...................................SR.KP..V..GS..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gvdsthldsrtspsgdhrdpqsasrdh..............................................
A0A063BU25_9HYPO/461-571               ...............................RSKSR........LRR...AAEIGG....VA.A....AA.G....V.A..N..K...L..WN..DHKEKK-.-...................................DR.SR..D..LS..E.......SGDD...--........DYY.R.RR.R..ST..S....G..........RRR.SPS...GS..L.VEYGTD-P................LY............PASRVA...P........A.PR.DL.........DPE.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------aedrraerrrrrrrdpsvssgs...................................................
A0A0G2JAW1_9EURO/566-703               ...............................RSRSR........TRE...FATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKK.A...................................EK.DR..R..KY..D.......HDHD...YQ........ESF.E.EG.Y..DP..A....P..........YAP.SP-...--..-.-PPNSSN-................YY............TQGNQF...P........P.AP.GL.........TPI.......P--.--.-P..N..V.QPGP.....YNPAD...Y..PPP.....PGAP...pQA...QSNY.PY..............PP................PTGMDPYGPRSARGDES-v........................................................................
M2ZPK6_PSEFD/581-658                   .......................khrsrsrsKSLSR........IQQ...VGGLAA....VA.G....IA.A....L.A..G..Y...A..LN..KNKNKET.Iivn............................dghrRR.SR..S..RR..R.......RHSV...--........DTY.I.SD.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------eerehrnpeh...............................................................
C5G976_AJEDR/540-677                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKK.A...................................EK.ER..R..TY..P.......HDHD...YL........QSF.E.EE.Y..EP..S....T..........YVA.SP-...--..-.-PLNSP--................YY............PQENRF...P........L.PP.GS.........TPI.......PP-.-P.PP..N..V.QPGP.....YNPAD...Y..PPP.....PAAA....QP...PPNH.PY..............PP................PPGGDSSAPRT-RADENV.........................................................................
S2JHI7_MUCC1/121-203                   ...........................hhkr-----........---...--DAAL....GA.G....AA.G....L.A..G..H...E..LK..NHHDQQS.-...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gldnhhassnplqpglghnshegvkssplhseaglgnhytsasnplrptsndhhy..................
E3QDR6_COLGM/476-517                   ...............................KSKSR........SRS...VAKAAA....AT.A....AA.A....G.L..V..K...H..FR..DRSKSKS.R...................................SR.SR..S..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ks.......................................................................
G3XV77_ASPNA/556-686                   ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..LS..QRNERKK.A...................................DR.DR..D..RP..-.......---G...KP........CSY.K.NP.L..--..-....P..........YPA.TPA...AA..P.RPIDDHQ-................YY............PNGNYF...P........P.PP.AT.........GPR.......---.--.--..-..P.EPAP.....YSPAD...Y..PHP.....PGPV....PP...-QSY.DY..............PS................GPGPDPYAPRPRRADENV.........................................................................
A0A066XKL1_COLSU/488-526               ...............................KSKSR........SRS...VAKAAA....ATaA....AA.G....L.V..Q..H...F..RD..KSKSRSR.-...................................--.--..S..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sk.......................................................................
A1CSM6_ASPCL/393-490                   ...............................RSHSR........LRH...ALPVVA....AG.L....GT.A....V.A..T..G...L..YE..KHKMKEG.E..................................eGK.HR..E..RR..R.......ARSR...SRa.....psEIY.P.DP.N..RD..SagliE..........YGD.HPV...AG..S.IPSA---H................YY............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------grpasqqgyyhsda...........................................................
R0K5Y5_SETT2/571-717                   ...............................RSKSR........VRT...VAETAA....VA.G....VA.G....L.A..A..H...E..AT..KRRDRKK.A...................................EK.EA..E..RR..R.......EEDS...--........TYS.T.GT.Y..--..S....P..........YDS.PS-...-P..S.TAHAEDSR................YF............PETNYF...P........P.PP.NA.........S--.......--A.DP.NI..H..N.PYPP.....YNPAD...Y..PPG.....PNHS...sQ-...----.-YvnvprdeshignpyVP................PQHQDHYYGPPRRMDGNV.........................................................................
S9VEY3_9TRYP/92-148                    .......................mliacltp-----........---...------....--.-....--.-....I.C..I..Q...C..CE..AREEKKQ.A...................................KK.DE..K..KR..K.......KEEK...KV........QKQ.Q.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------eetxxxavqltdggqp.........................................................
G2XR77_BOTF4/694-849                   ...............................RSRSR........VRD...LAAGAL....GT.G....AA.A....I.G..I..N...E..YR..KRKEKKE.Kkekk..........................daekhER.ER..E..RR..R.......YEDE...AP........ESY.Y.TN.F..RD..E....T..........YSP.SP-...--..-.-PHASGGS................YY............PENNAF...P........P.PP.TSnpet.ftnhGNKs.....tPFV.NE.IP..-..-.PIPP.....YNPQD...Y..ASQ....rPTTH....DP...---H.HY..............PPs.............srV-----------------pgdnvsthqssn.............................................................
Q2TZD9_ASPOR/411-515                   ..............................sRSHSR........LRK...ALPVVA....AG.L....GT.A....A.A..T..G...L..YE..KHKEKQE.Eg................................eaSR.RR..E..RS..R.......SRSR...--........-AP.S.EI.Y..-P..D....P..........TRD.SAGlieYG..Q.DPVHGRI-................--............PTADYY...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------grptsqqayysdasdpavsd.....................................................
E9DDF0_COCPS/382-493                   ...............................RSRSR........IRTgipIAAAGL....GS.A....AI.A....A.A..Y..E...K..NK..AKKEDKKeK...................................ET.RR..A..RS..R.......SRSK...--........-SR.A.RS.S..SE..S....Q..........VGV.PPHlieYG..D.DPVYGR--................-I............PASNYY...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------graespyhtprnhthsrsrrspstds...............................................
A0A0D9MKW4_9EURO/545-695               ...............................KHRSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSKE.R...................................ER.EH..S..KR..D.......DHHV...HR........DPY.E.EA.Y..DP..E....P..........YPL.SPQ..tAP..G.APPMADPH................YY............PNNNYF...P........P.PP.GD.........STY.......---.-N.LN..S..G.TPMP.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........aaPPgp............gpGPGPEQYAPRPRRADDNV.........................................................................
W9CAG8_9HELO/706-865                   ...............................RSRSR........VRD...LAAGAL....GT.G....AA.A....I.G..I..N...E..YR..KRKDKKE.Kkekk..........................daekhER.ER..E..RR..R.......YEDE..sSP........ESY.Y.TN.F..RD..E....G..........YSP.SP-...--..-.-PHASGGS................YY............PDNIQF...P........P.PP.ASapeg.fthhGNHs.....tPFI.NE.TP..-..-.PIPP.....YNPQD...Y..AGQ.....RAAV....-Q...DPHV.NY..............PPs.............srAP----------------gdnvsayqssnse............................................................
A0A0K8LFQ8_9EURO/377-478               ..............................sRSHSR........LRQ...A--LPV....VA.A....GL.G....T.A..A..V...TglYE..KNKEKKE.E...................................EG.KR..R..ER..R.......RSRS...RS........RAP.S.EA.Y..-P..D....P..........ARD.SAGlieYG..E.HPVTGS--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ipaahyygrpasqqgyysdasdrv.................................................
W9Y839_9EURO/635-791                   .............................hgRRRS-........SHD...AVKTAA....AA.G....AG.A....I.A..A..S...E..YE..RHKQEKR.-...................................ER.KA..R..RR..R.......EEEG..yGH........DPY.E.DN.Y.nPA..Q....P..........YPP.TPP..pPA..N.DPYASQQG................FY............PQTSQF...P........P.PP.GS.........VPQq.....yPPQ.QT.TP..T..A.GPAAg...tSYPAQ..pY..PPP.....PPASg..pPP...PTTT.PY..............DA...............yGSGANPYAPRG-------penvs....................................................................
J3KI03_COCIM/510-672                   ...............................RERSR........SRD...LATAGL...aAA.G....AA.G....L.A..A..H...K..YA..QRKERKK.N...................................ER.DR..R..RD..E.......EEA-...RQ........DSY.D.DT.Y..ST..I....P..........YPP.SPP...PP..S.ASSYPQDN................YY............PQTNQFaqsPnq...ttgP.PP.GH.........YQY......pPSN.YP.PPgtA..S.MPPPnh.vsHNPAD...Y..PPP.....PGAP....PP...AQHY.NY..............PV................PPAQDPYAHLQPRGDENV.........................................................................
E9DDF0_COCPS/346-390                   ..........................rdpdh----R........NRR...MAEAGL...aGA.A....VA.G....L.V..D..H...V..RS..KSRSRKG.R...................................SR.SR..I..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tg.......................................................................
F2TF46_AJEDA/468-605                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKK.A...................................EK.ER..R..TY..P.......HDHD...YL........QSF.E.EE.Y..EP..S....T..........YVA.SP-...--..-.-PLNSP--................YY............PQENRF...P........L.PP.GS.........TPI.......PP-.-P.PP..N..V.QPGP.....YNPAD...Y..PPP.....PAAA....QP...PPNH.PY..............PP................PPGGDSSAPRT-RADEN-k........................................................................
N4VHF5_COLOR/631-705                   ...............................RSKSR........LRE...MAAAAV....GT.G....AA.A....I.G..I..K...Q..YQ..KGKDKEE.D...................................LR.ER..E..RS..R.......DRER...RA........RSI.S.RD.R..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sisrdrgyprdrassrdrp......................................................
Q0C9I2_ASPTN/296-363                   ........................rsrsrsh-SHSR........ART...FAEIGL....GA.AaiagAV.A....L.A..R..N...K..SK.sDRRSRSR.H...................................RR.SA..S..VK..S.......T---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------regdekrsesqrr............................................................
E3QDR6_COLGM/512-642                   .............................rsRSKSR........LRT...GAEVVA....AG.L....AG.G....V.A..S..K...I..YK..NRKDKKE.R...................................EL.DR..E..LSddE.......YEEE..aRR........ERR.E.HR.R..-S..R....S..........RSQ.ARS...LH..P.EPHSADSElg...........lveYGt..........sPLPTDP...P........Y.PP.DD.........GYE.......SAA.NE.GR..R..R.RHRR.....-----...-..---.....----....--...----.--..............--................------------------msaddyddrepak............................................................
U4LPE7_PYROM/313-369                   .........................rsrsrsRSRSRpr...shtGRH...IAAAAL....GA.T....AA.G....L.A..A..H...K..MR..HRRDSYS.S...................................-Y.S-..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sddeghhhr................................................................
G2WRI8_VERDV/647-806                   ...............................RSRSR........IRD...MAAAAV....GT.G....AA.A....I.G..I..K...E..YK..KKKDAEK.Eredeaarr...................arerslsrDY.SR..D..RS..R.......RRDE...GR........RRY.E.EE.S..NP..N....P.........hYDD.YSR...PP..S.PPHASGGA................Y-............-----Y...P........T.PT.GS.........GFS.......--Q.NQ.SV..N..D.PYPP.....YSPHA...YtgFPP.....PQPG...gPP...TA--.--..............--................------------------sgaaggfptptpggpplsyqggpp.................................................
W3XH82_9PEZI/344-396                   .............................dh--RSR........--D...-AALAF....GA.G....AA.A....Y.G..T..H...E..HE..QHNKRSE.T...................................SA.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sqpigsgtdpthadprtav......................................................
Q0C9I2_ASPTN/537-583                   ...............................RHRSK........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YS..QHKDRKK.A...................................DK.EA..E..RS..R.......E---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------yip......................................................................
A0A0A1TGS9_9HYPO/569-721               ...............................RSRSR........LRN...MAAAGA....AA.G....AA.A....M.G..I..K...E..YK..NRKDRKK.Rde..............................drhSR.ER..S..QE..R.......YEDE...--........RRH.E.RR.Y.dEH..D....E..........RPQ.S--...--..-.PPTASGGA................YY............PP---Y...P........P.TP.GA.........-PY......gSPS.AA.QS..Y..D.NQQY.....YVPQDm.gY..APP.....PPPGpppaPN...TGPA.NYg............pPP................PPGP--------------ppgpppgsnqapehg..........................................................
G7XHH0_ASPKW/403-503                   ...............................RRESR........SHS...AIRKALp..vVA.A....GL.G....T.A..A..A...TglYE..KNKEKKE.E...................................EE.SR..R..RE..R.......RRSR..sRS........RAP.S.EV.Y..-P..D....P..........TRD.SPG..lIE..Y.G-------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dhpvhgsippnyygrpvsphgyysda...............................................
S7ZET0_PENO1/261-338                   ......................rsrsrsrsq-SHSR........AKT...LLELGL....GA.Aa..vAA.G....V.A..A..L...K..SK..SDNDRRS.R...................................SR.NR..S..HS..R.......SGSR...LR........ALS.R.SR.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sekdkdgegkdne............................................................
A0A0F0I0U5_ASPPA/563-702               ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YS..QRREGKK.A...................................EQ.ER..E..RP..R.......FDED..aRQ........DSY.G.EP.Y..SP..E....P..........YHH.TA-...--..L.PPQSSEHQ................YY............PNTNYF...P........P.PP.GS.........APR.......---.--.-P..A..G.STAP.....YNPAD...Y..PPP.....PGAV....PP...SQQY.GY..............PP................PPGPESFVSRPRRADENV.........................................................................
G7XHH0_ASPKW/302-375                   ......................rsrsrsrsh-SHSR........ARH...LAELGLgaaaIA.G....AV.A....L.A..R..S...K..SN..SNKDRRS.R...................................SR.HR..R..AS..S.......SRRS...LK........DSH.E.ET.R..SQ..S....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------qrr......................................................................
F2TF46_AJEDA/339-450                   ......................grikqglpi-----........---...-AAAGL....--.G....TA.A....I.-..A..N...L..YE..KHKEKKE.S...................................ESsER..G..HR..R.......RSRS...KS........VAR.S.ST.Y..-P..D....A..........SRS.APQlveYG..D.DPIYGS--................-I............PADNYY...R........R.PP.SR.........QPS.......--R.NR.RA..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrtryrddgpgsgt.........................................................
U1HT54_ENDPU/646-826                   .............................rh-NRSR........SRD...IATPAL....AA.I....GG.G....I.A..A..T...E..YA..KRKEKKK.A...................................EK.AR..R..RY..E.......EEYG...HGhg...qgqDPY.E.DE.Y..DPvqR....R..........YTP.TPP...SS..A.DPYGNPNQ................YY............RSDDQL...P........P.PP.GSapa..plypP-Qqp...paGYQ.QQ.GP..-..Y.PAQP....sYNPAA...Y..AQQ.....PGA-....PP...PINP.AY..............PP................QNSA--------------ssagfppatpfasggngdprlprgrgdenv...........................................
J3KI03_COCIM/382-492                   ...............................RSRSR........IRTgipIAAAGL....GS.A....AI.A....A.A..Y..E...K..NK.aKNEDKKE.K...................................ET.RR..A..RS..R.......SQSK...SR........---.A.RS.S..SE..S....Q..........VGV.PPHlieYG..D.DPVYGR--................-I............PASNYY...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------graespyhtprkhthsrsrrspstd................................................
A0A0G3A5Q5_9ACTN/4-80                  .............................ll-----........-RG...IARTAV....VA.G....TA.T....A.V..S..N...H..VS..RRQAGRW.A...................................QQ.DY..E..RQ..Q.......QYEQ...--........QYA.Q.PE.Y..AQ..P....Q..........QPP.PPP...PA..A.PPPAA---................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pddmtqkid................................................................
B6HIZ7_PENRW/465-641                   ............................srs--RSRshs..harAKT...LRELGLg..aQA.M....AA.G....T.A..A..L...R..SK.aNTGDRKS.R...................................SH.SR..S..RS..R.......VGER...--........TSS.E.SR.L..KQ..D....L..........PTV.S--...-S..G.FPTAAAATglsedsesqedekdgiSRghrs....rsrsPAASQF...Y........P.DP.SR.........SSA.......GLI.EY.GV..-..H.PVTD.....SIPAK..hY..RPPv...sPGVS...dDA...SDTY.GR..............RP................T--R--------------sryssssgsdrgd............................................................
A0A0F4GXD0_9PEZI/617-791               ...............................RNHSR........SRN...AAIGGA....AL.G....GA.A....L.A..A..H...E..MG..KRRERSK.V...................................AK.EN..R..RE..R.......RDDH...QD........DYY.D.DR.R..HD..D....RhhddrdnnmgYND.YP-...QP..N.APYGGQPS................TY............PTSHYF...P........P.PP.TG.........EDA.......ARN.DP.YG..AhpQ.TYPA.....YNPAD...Y..AGQ.....PAQQ...hPP...YDQA.QYgg..........geISygesa.....dpninqPYPGDAYAGDQRY-----gaehe....................................................................
K9FWG0_PEND2/303-374                   .......................srsrsrsh-SHSR........VKT...LIELGV....GA.Aa..vAA.G....V.A..A..L...H..SK.sKAEERKD.R...................................SR.SR..T..RT..R.......--SR...S-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rafsrgrsekdgdhge.........................................................
F7W3Z0_SORMK/486-611                   ..............................g-HHSK........LKT...GAEIVA....AG.V....AA.G....V.A..K..K...A..YD..KHKEKK-.-...................................ER.SR..S..RH..A.......ADDR...DR........EFY.D.DDgY.dRD..R....D..........YRS.HSR...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrsqhrsalpssqnnhasqrtvaddpeslglveygmnpvpvdsprddeqrqqqqshsk.............
U4LPE7_PYROM/208-267                   ............................grsRSSHR........VRH...LAEAGL....AA.G....GA.K....I.L..Y..D...R..HR..AHQQGAH.S...................................AH.SS..H..HS..H.......HSAH...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sshshsdphh...............................................................
B8M1D8_TALSN/257-313                   ........................rsrsrss-SHSR........AKT...LAGIGL....GA.A....AI.A....G.A..V..A...L..AR..NKSQDDR.R...................................SR.SR..H..RR..R.......SQSR...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sgda.....................................................................
K2S5L1_MACPH/347-423                   ...............................RSHSK........GRK...VAGVAA....LA.A....VG.A....L.A..Y..A...A..GR..GQKANTT.Vi.................................eRR.SR..S..RR..R.......-RHS...VS........GAS.G.DE.Y..SP..S....P..........SRS.RSR..sKH..R.DPE-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------hrn......................................................................
A0A0A2K6U1_PENEN/544-693               ...............................KHHSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSK-.-...................................ER.ER..E..HS..K.......HDDN..vHR........DPY.E.ES.Y..DP..E....P..........YPL.SPQ..tAP..G.APPMADPH................YY............PNNNYF...P........P.PP.GD.........STY.......---.-N.LN..G..G.TPAP.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........aaQPgp............gpGPGPEQYAPRPRRADENV.........................................................................
G9PCA8_HYPAI/433-520                   .............................rsRSKST........LRR...GAELAA....GA.A....AV.G....V.A..G..K...M..WK..DHHDKKK.-...................................ER.ERgeS..TS..R......gYSDE...-D........REY.D.GH.NshSL..I....E..........YGH.DP-...LP..P.DPRS----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ptgqgyeseae..............................................................
A0A066XKL1_COLSU/654-857               ...............................RSKSR........LRD...MAAAAV....GT.G....AA.A....I.G..L..K...Q..YQ..KKKEKEK.DededrrsrersprsrsrdrsisrsraysrdrayssER.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...ST..E.RPRNMDRErdrr........ryeeYYddysrppspphaSGGSYY...P........P.PP.AAaa.....gfTQH.......PNIsTA.NL..R..D.QYPP.....-YPQD...Y..PPG.....PPPM....GP...SPPM.ATgga........ggyPP................------------------ppaggppppgglppgtrfgpehvsddksrsasrqdaqp...................................
S2K5A6_MUCC1/218-328                   .........................sgmssg-----........-MK...MAGAAA....VG.V....AG.G....L.A..I..G...S..IM..HHEEEQS.-...................................--.DR..I..ER..L.......EQEQ...RQ........LEQ.Q.QQ.Y..NQ..Q....P.........sYSA.PP-...--..-.-PPQEQ--................Y-............----NA...P........P.PP.ME.........-QQ.......P--.--.-Y..D..G.GYGN.....YNPGD...Y..QQQ.....DGGG....--...----.--..............--................------------------dtqttiiredg..............................................................
U4LPE7_PYROM/365-409                   ..............................g-HHHR........GRK...VAAGIA....GA.T....AA.G....L.A..A..R...H..YS..RRRDSST.S...................................ST.SS..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------negshk...................................................................
C4JEK8_UNCRE/210-277                   ..............................s-SRSR........ART...LAGLGL....GA.A....AI.A....G.A..V..A...L..AK..KHSEKNE.Krek.............................sstRR.SR..S..RR..R.......RSSS...-T........SSS.S.DA.R..DP..E....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------hrnk.....................................................................
H0EK30_GLAL7/414-498                   .............................rs--RSRsssrhshtK--...-VKTALg.laVA.G....LA.A....A.A..A..A...K..YV..SNRNQNK.Ee.................................lGR.GR..S..RT..R.......SRGR..gRS........SSY.S.SD.Y..GS..R....A..........RSK.SV-...-H..T.DPKH----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rna......................................................................
A0A0M8P4S7_9EURO/502-653               ...............................KHRSH........SKD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSK-.-...................................ER.ER..E..HS..K.......RDDH..vHR........DPY.E.ES.Y..DP..E....P..........YPL.SPQ..tAP..G.APPMADPH................YY............PNNNYF...P........P.PP.GD.........STY.......---.-N.LN..S..G.TPVS.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg............aAPrgp.........gpgpGLGPEQYAPRPRRADDNV.........................................................................
A0A084G042_9PEZI/487-604               ...............................RSRSR........LRT...GAEIAA....AA.V....AG.G....A.A..G..K...L..YQ..RHKEKKE.-...................................ER.ER..S..RS..R.......SSDS...HY........EPR.H.GS.R..SR..S....R..........SRS.TTR..sFH..P.EPGSADRElg............lvEY............GHDPLR...P........E.PP.YP.........DDE.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sdraarrrrrrrnrsrntgd.....................................................
S7ZET0_PENO1/503-650                   ...............................RRHSR........SRE...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YS..EHRDRKK.Aers.............................rsrSR.SR..S..RN..R.......YDDD..aHR........DPY.E.ES.Y..DP..V....P..........YPP.SP-...--..-.-PSTHQHQa.............dpYY............PNNNYF...P........P.PP.GS.........TTN.......---.--.-L..N..S.TPQP.....YNPAN...Y..PPP.....PGAA....PP...SQPY.SY.............gAP................PAGADPYAARPRRADEN-k........................................................................
J3KI03_COCIM/287-350                   ..............................t-SRSR........ART...LAGLGL....GA.A....AI.A....G.A..V..A...L..AK..KHSEKSS.K...................................QR.SS..G..RR..S.......RSHR...RR........SSS.A.SS.S..S-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dardpdh..................................................................
C6HTC0_AJECH/453-591                   erssrrashsrsrtrshhyrddgsrsgssfs-----........---...------....--.-....--.-....-.-..-..-...-..--..---DRGH.S...................................HK.NR..T..YA..-.......HDHD...YS........DSY.E.DG.Y..EP..A....P..........YPP.SP-...--..-.-PSNGPN-................YY............AQGSQF...P........P.PP.GA.........APV.......P--.--.PP..N..V.QPGP.....YNPAD...Y..PPP.....PGAA...pQP...PSNY.PY..............PP................PPGVDAYAPRSARGDENV.........................................................................
G3XV77_ASPNA/402-507                   ...............................RRESR........SHS...AIRKALp..vVA.A....GL.G....T.A..A..A...TglYE..KNKEKKE.E...................................EE.SR..R..RE..R.......RRSR..sRS........RAP.S.EV.Y..-P..D....P..........TRD.SPG..lIE..Y.GDH-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pvhgsippnyygrpvsphgyysdasdpva............................................
A0A074W448_9PEZI/322-398               ...............................RSRSR........VRT...LAKVGT....VA.A....VG.A....L.A..A..Y...A..LR..NRGNKET.Vivnn..........................evpppRR.SR..S..RR..R.......RS--...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------svgsappppldarsrseskhrdp..................................................
C1HCJ5_PARBA/372-479                   ...............................RSRSR........IRQ..gLPIAAA....SL.G....SA.A....I.A..G..-...L..YE..KHKEKKE.N...................................ES.SQ..R..HH..R.......RRSR..sRS........VVP.S.SA.Y..-S..D....P..........SGS.APQlieYG..D.DPVYGS--................-I............PTNHYY...G........R.PS.S-.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rqsspraiessfrrrsrh.......................................................
W9XB18_9EURO/633-794                   ..............................r-SRRR.......hSRD...AAKMTA....AA.A....AG.A....I.G..A..A...E..YE..KRKQEKR.-...................................ER.RA..R..RR..R.......EEEG..yGR........DPY.E.DN.Y..NP.gA....Q..........YAP.TPPpppPV..N.DPYANQQG................FY............PQTSQF...P........P.PP.GA.........APQq....ypPQA.GPgTA..P..A.GGAQ.....YPPQN...Y..PPPpppppPPGA....PP...APAQ.PY..............DA...............yASGANPYAPRG-------penvsa...................................................................
A1DGB5_NEOFI/393-493                   ..............................sRSHSR........LRQ...A--LPV....VA.A....GL.G....T.A..A..V...TglYE..KNKEKKE.E...................................DG.KR..R..ER..R.......RSRS...RS........RAP.S.EA.Y..-P..D....P..........ARD.SAGlieYG..Q.HPVTGS--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ipaahyygrpasqqgyysdasdr..................................................
A0A074WG27_9PEZI/559-713               ...............................RSRSR........TRG...LAEGAA....AA.G....VA.A....I.A..A..H...E..LG..KQNERRR.Sd.................................rDR.DR..E..RR..R.......REEE...-D........EMY.A.HD.R..--..-....P..........YSP.PPMganAA..Y.PPTPQSHE................FY............PATNSF...P........P.PP.TD.........---.......-NY.GH.QA..D..Y.PYQP.....YNPAD...Y..PPP.....PAAGg.atRG...RHDE.RY..............PSpep.........nlgyPPANETFAGDARYAGD--dr.......................................................................
A0A093YVZ9_9PEZI/8-61                  ........................srsrsrsRSRSR........ARD...VLGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RR..A.......Y---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tpt......................................................................
M7SU52_EUTLA/536-613                   ...............................RSHSR........IRT...GAEIAA....-A.G....LT.G....A.A..A..S...K..LW..ERHKNKK.-...................................EH.KK..D..KE..V.......DDD-...--........SYY.S.DD.R..SR..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srglvpvavpgveygsqpidlhdgy................................................
E5R2F7_ARTGP/552-689                   ..............................p-SRSRhgn..gnlAAG...LAAAGL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......HDRD...YR........DPY.E.DE.Y..-P..S....P..........PGP.PPG..pSS..Y.QPPAAQE-................YYgvpp...phpgpPGGRGY...P........P.PP.GP.........---.......---.--.--..-..-.---P.....--PGP..gY..FAG.....PGPG....P-...----.GG..............PP................VYRGDENVPQPSHQNQN-g........................................................................
W9XLQ4_9EURO/374-456                   .........................rsrsrrRSRSRses..pskLKT...LGAVGL....GA.A....AL.A....A.A..A..A...I..AS..KRMNKDK.E...................................EP.RR..S..RS..R.......HRTQ...--........--S.V.SS.L..EN..D....P..........SAP.SD-...DA..R.NPKH----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rnk......................................................................
A0A0A1TGS9_9HYPO/445-522               ...............................RSKSK........LRR...GAEIAG....AA.A....AA.G....I.A..G..K...M..WK..NHQEKKE.R...................................SR.SQ..S..RA..A.......SRDV..dDR........DHYgR.RD.Y..SR..S....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rsrsrsiarshqsdrda........................................................
M7SU52_EUTLA/643-784                   ...............................RSRSR........LRE...VAAGVL....GT.G....AA.A....I.G..L..K...K..YQ..DRQKSKD.R...................................DR.DR..D..RD..R.......KRDE...-K........PRY.E.DE.A..QP..D....P..........YYS.DY-...DV..E.APPSP--H................YA............SGGAYY...P........P.PP.GP.........APPp.....aTMP.TP.PP..T..G.PAGP....gAAPGD...F..VQH.....PNQS....-T...MNLN.AY..............PP................PPPLNTYNPQD-------ytn......................................................................
C4JEK8_UNCRE/306-417                   ...............................RSRSR........IRTgipIAAAGL....--.G....SA.A....I.A..A..-...M..YE..KTKAKKE.E...................................NK.EK..E..AR..R.......ARSR..sRS........KSR.A.RS.Y..PD..A....P..........AGV.PTHlieYG..E.DPVYGR--................-I............PASDYY...G........R.P-.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------esphyvarrhsrssrsrrrspst..................................................
N1PM89_DOTSN/650-820                   ..............................rRSRSR........GKE...FATAGV....AA.A....AG.A....A.A..A..H...Q..YG..KSRERSR.S..................................rAA.SR..E..RG..H.......NDRR...GS........GYY.D.DG.Y..GN..E....P..........YSP.PPD..dHY..I.QGNQQNAGyg...........qqqSY............PSSNYF...P........P.PP.TG.........DQAy....geHAY.AQ.QP..Q..Q.SYPA.....YNPAD...Y..ANQ.....PPQQ...hPY...ENTRgAYgdsd......anlgQ-................PYPGETYAGDAR------ygtpdhnrg................................................................
W9XB18_9EURO/484-592                   .............................keRSRSR........VRQ..aLPVVAA....GL.G....SA.A....V.A..-..G...L..YE..KHKAKKE.Aee..............................ivdER.RR..A..RS..R.......SRSRarsEH........AYY.D.GP.N..QG..A....I..........NDP.GLI..eYG..N.APMYGNN-................YG............PDYYGR...P........P.PQ.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dgyysnavvp...............................................................
C8V000_EMENI/175-307                   ...............................RHRSR........SRD...LAGAAL....AA.T....GV.G....Y.A..A..H...K..YS..QHRKE--.-...................................DK.ER..D..RQ..R.......YDSD...GP........SLF.E.QP.F..SP..G....P..........YPP.SP-...-G..T.GPVDSSQ-................YR............PN-NYY...P........P.PP.GP.........APA.......---.--.-P..A..P.GPAH.....YNPAD...Y..PPP.....PNAV....PP...-QQY.SY..............PP................-PAADAYAPRPRRADENV.........................................................................
A0A074YPM7_9PEZI/306-384               ...............................RSRSR........ART...LAKVGT....VA.A....VG.A....L.A..A..Y...A..LR..NRGNKET.Vivnn..........................evpppRR.SR..S..RR..R.......R---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------asvgsvpppldardrsrseskhrdpe...............................................
A1CSM6_ASPCL/293-356                   ........................rsrsrsh-SHSR........AKT...LAEIGL....GA.A....AI.A....G.A..V..A...L..AR..KKSKNDR.R...................................SR.SR..H..RR..A.......SSSS...R-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pekdaksekg...............................................................
S2JHI7_MUCC1/203-279                   ............................ykr-----........---...--DAAL....GA.G....TA.G....L.A..G..H...E..MK..NHHDHQS.G...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------lnnhhassnplqpglghnnyegaidnplqsetdklhqsskdndhhykrd........................
A0A0F0I0U5_ASPPA/304-380               ....................rsrsrsrshsh-SHSR........ART...LAELGL....GA.A....AI.A....G.A..V..A...L..AR.nKSKDERR.-...................................SR.SR..H..RS..R.......SRHH...RS........SS-.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------vrsgrttdgekrsesq.........................................................
A0A0F8UEJ4_9EURO/530-673               ...............................RHRSR........SHD...LAGAAL....AA.T....GV.G....Y.A..A..H...R..YS..QHKDRQA.A...................................EN.ER..E..RQ..R.......FKDE..gRP........APY.D.EP.Y..NS..E....P..........YPP.SP-...AP..G.QPVDSSQ-................Y-............KPGNYY...P........P.PP.GS.........APA.......---.--.LV..A..S.GPAP.....YIPAD...Y..APPp..nvPAPA....PP...QQ--.QYy............pPP................PAGPNTYAPQSRAVDEN-s........................................................................
S3CWZ7_OPHP1/661-722                   ...............................RSQSR........LRN...LAAGGA....AA.A....AA.A....I.G..I..K...K..YE..DKKKRDD.S...................................KR.RE..E..ER..S.......RDDG...--........SVY.N.DD.Y..DH..E....R..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------hqsh.....................................................................
W3XH82_9PEZI/247-324                   ..........................agsht-----........ARD...GAGMAT....AG.A....VA.A....Y.A..A..H...H..HN..QHDSRSS.T...................................SK.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ptgsgidptdsdpragqtsidrngsrqchqnerddssalhh................................
E3QDR6_COLGM/644-706                   ...............................RSKSR........LRD...MAAAAV....GT.G....AA.A....I.G..L..K...Q..YQ..KKKEREE.D...................................EE.EN..L..RS..R.......ERSA...RS........RS-.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rdrsvsrprahs.............................................................
A7EI77_SCLS1/616-786                   ......................ydrtnehds-----........---...--AVAA....AA.A....GA.A....Y.G..A..S...R..RS..RSRSRQR.Krdsssdd.....................ekrprsrS-.-R..S..QS..RvrdlaagYEDE..aSP........ESY.Y.TN.F..RD..D....T..........YSP.SP-...--..-.-PHASGSS................YY............PDNNQF...P........P.PP.TSvpqg.ftrhGNQs.....sPFV.NE.IP..-..-.PIPP.....YNPQD...Y..AGR....rPSTH....EP...--HV.NY..............PP................------YPPSS-------ripgdnvnrlnnstp..........................................................
F9XE98_ZYMTI/399-476                   .............................rsRSRSRsf....nrTQK...LGGLAA....VA.A....VA.A....L.G..A..Y...A..LK..NRNNKET.Vivk............................eqppRR.SR..S..RR..R.......RSS-...--........--Y.D.S-.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------apssvrpgsehrspdh.........................................................
C5G976_AJEDR/400-520                   .............ksrsrkgekspgrikqgl-----........---...-PIAAA....GL.G....TA.A....I.-..A..N...L..YE..KHKEKKE.S...................................ESsER..G..HR..R.......RSRS...KS........VAR.S.ST.Y..-P..D....A..........SRS.APQlveYG..D.DPIYGS--................-I............PADNYY...R........R.PP.SR.........QPS.......--R.NR.RA..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrtryrddgpgs...........................................................
A0A0F2MLK1_SPOSC/496-647               ...............................RSHSR........LRT...GAEIAG....AA.L....AG.A....A.A..K..K...L..YD..KHKDKKQ.L...................................ER.EQ..K..EA..A.......YYSD...DP........YSE.D.DR.Y..SR..Hg.rgS..........RSH.SRN...RS..A.APSQSPPP................L-............SGATRT...P........Y.PP.SG.........A--.......---.--.DP..E..L.GLVE.....YGDQP..lY..ADP.....----....--...----.--..............--................------------------gapardgaivghrgsydsaadaserddrrarrrhrhsrng.................................
W2RLM0_9EURO/664-810                   ...............................RRRSS........RRR...VAEAGA....AA.A....AG.A....A.G..A..S...M..YE..RSKQEKR.-...................................ER.KA..R..KR..R.......EQEQ...YG........DPY.E.EG.Y..NP..Q....A..........SHA.PP-...-P..S.DPYGAPPQp..............gYY............PESGAF...P........P.PP.GA.........GQY.......---.AP.DP..A.aQ.QAGN.....YMQQG...Y..PPP....pPGGPg..mPP...PPGV.GY..............EP...............yASGANPYAPPR-------gadnv....................................................................
A0A0L1J2N0_ASPNO/527-588               ...............................KHRSR........SRD...LTEAAL....AA.T....GV.G....Y.A..A..H...K..YS..QRRERKK.A...................................EQ.ER..E..RP..R.......FDED..tRQ........DSY.G.EP.F..S-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------lnhi.....................................................................
A0A0F2MLK1_SPOSC/670-735               ...............................RSRSR........LRN...LATAGA....GA.A....AA.A....I.G..I..K...K..YS..DSKKKKE.E...................................EA.NR..R..DR..R.......DHER...-D........RDH.D.RD.F..D-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rdhdrqrdyd...............................................................
Q0UZC8_PHANO/537-676                   .....rrlrrnaindvslptanietsctess-----........---...------....--.-....--.-....-.-..-..-...-..--..-------.-...................................--.--..-..--..-.......PGDE...DS........AYS.T.GS.Y..SP..Y....D..........SPR.PST..tST..S.HPNDSR--................FF............PESNYF...P........P.PP.TA.........---.......P-I.DH.Q-..-..A.PYPP.....YNPAD...Y..PPP.....PSTT...fEP...SHPS.TYv............hPPhddinh...gnpyappQHQSNYYYGQPRRPDDNV.........................................................................
U4LPE7_PYROM/462-545                   .............................rn-RSSR........SGT...LAKAAA....VT.M....AG.A....L.A..E..R...Q..LH..NHRSRSA.D...................................AA.AR..R..RQ..R.......HAEG..eKR........VHY.R.NR.E.qGD..G....N..........YES.SIH...--..-.-PE-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ssvsnnphrrrgs............................................................
M1W061_CLAP2/430-517                   ...............................RSKSR........LRR...VAEIGG....VA.A....AA.G....V.A..N..K...L..WK..SHNDKKE.R...................................AR.SR..S..VG..G.......VDDD...N-........YPR.H.D-.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrgryrslsrsrhrsrsrsivpspysqagadpe......................................
M3CFH9_SPHMS/660-825                   ...........................sksrRSRSR........-RG...LASAGAl..gAA.G....VG.A....V.A..A..H...E..WS..KRRERSR.-...................................SR.SR..S..RS..R.......HGDR...RRd......dDDY.Y.DD.R..RD..D....H..........YGA.PPM...NS..S.DPYNNNPYqq...........ggqQY............PSSNYF...P........P.PP.NAd.......yT-Qp.....rGNI.EP.QP..E..Y.AHAHa...pYNPAE...Y..ANQ.....PATQ...qPY...DPQY.GGy............gEP................-YPSDPYAGDQRYPHD--ph.......................................................................
C1GDB7_PARBD/522-661                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKK.A...................................EK.GR..R..KY..A.......RDHD...YT........DSY.E.EG.Y..DP..V....P..........HVP.SP-...--..-.-PPNGAN-................YY............PHSNHF...P........P.PP.GS.........TPV.......P--.--.-P..N..H.QGGP.....YNPAD...Y..PPS.....PGAP...pMT...QANY.SYp............pPP................PPAADPYSPRSINGEENV.........................................................................
A0A0N0NRB6_9EURO/461-588               .......................rsksrgrdRSRSR........VRQ...AAPV--....VA.A....GL.G....S.A..A..-...-..LA..GLYERNK.A...................................KK.EA..E..VI..R.......KEEK...GR........CFS.D.PN.L..--..I....E..........YGD.GPMh.gNN..Y.GPDYYGRNlp...........qenFY............ANQTAV...V........P.AP.GQ.........SPG.......APA.QY.AQ..R..D.L---.....-----...-..---.....----....--...----.--..............--................------------------speysnrrsrsrsrs..........................................................
G2QTJ0_THITE/500-544                   ...............................RSRSR........ASS...LAKAGL....GA.A....AL.T....G.L..V..Q...H..YR.hKSKSRDG.K...................................SR.SR..S..RL..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rt.......................................................................
G3JMF7_CORMM/459-600                   ............................ggg-----........---...VAKGIL....GG.L....GM.G....W.I..A..K...K..LA..DRRNKKQ.E...................................ER.LR..E..--..-.......EDDM...RS........GTN.V.SR.F..TG..D....G..........YPS.PTR...DS..R.RPPPVRRQt..............gY-............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gasygtdtalsemtessidhpprvgarsdniqpvpmplrpprssgppvsepvsmpsmpadphgvlhsgae...
F7W3Z0_SORMK/764-824                   ...............................RSKSR........LGR...LAAGAA....AA.G....AA.A....I.G..I..K...K..LG..DNKDKKD.N..................................kEK.ER..E..RE..R.......EREK...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ggdkeiereerdi............................................................
G4N0D9_MAGO7/696-764                   ...............................RSKSR........LRE...MAAAGA....GA.A....AA.A....I.G..L..K...G..IQ..KRREKSK.E...................................RD.EE..E..ER..R.......HEDE...MR........ERD.R.DR.D..RD..R....P..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rnrsrvgfd................................................................
U4LPE7_PYROM/400-461                   ........................stssneg-----........SHK...LRNAAL....GI.G....AA.G....L.A..A..H...H..HR..KKKEREA.-...................................EE.RR..T..RS..R.......SR--...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srpgilrrlsrsysap.........................................................
W9XB18_9EURO/369-457                   ............................rhr-SRSRsss..pskLKT...LGAVGL....GA.A....AL.A....A.A..A..T...I..AS..KRMNKSN.Ddg...............................drGR.SR..S..RS..R.......SRSR...RR........RES.V.SS.L..ED..D....P..........NAP.SD-...DA..R.NPKHR---................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rnti.....................................................................
Q2TZD9_ASPOR/304-373                   ......................rsrsrshsh-SHSR........ART...LAELGL....GA.A....AI.A....G.A..V..A...L..AR.nKSKDERR.-...................................SR.SR..H..RS..R.......SRHH...R-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sssvrsgkttdgek...........................................................
W9Y839_9EURO/376-455                   .............................rrRSRSRsgs..pskFKT...LGAVGL....GA.A....AL.A....A.A..A..T...I..AA..KRMNKNK.E...................................EP.RR..S..RS..Q.......HRRE...SL........SSL.E.ND.A.sAP..S....D..........---.---...TA..R.NPK-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------hrnkr....................................................................
B8M1D8_TALSN/314-354                   ...............................RSKSR........NRH...IAAAGL....-A.G....AA.A....A.G..I..I...E..KV..RSRSRPR.-...................................SK.SR..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------irqg.....................................................................
B6Q8Z7_TALMQ/490-641                   ......................rhrrrekkeRSSSR........IRD...LAEAGL....AA.A....GL.G....Y.A..A..S...K..IS.gNKKDKSR.H...................................SR.ER..E..SR..R.......HDHD...-N........DSY.E.EP.Y..DP..A....P..........YMP.TPS..pGA..P.GPPTEN--................YY............PYTNSF...P........P.PP.GS.........TPN.......---.--.--..-..L.PPTS.....YHPGE...Y..PPPp...aPGAV....PP...MHEY.PH..............PPg..............aPPGNEPYAPQPRRADENV.........................................................................
C4JEK8_UNCRE/550-601                   .......................lhqcrrqi-----........---...------....--.-....--.-....-.-..-..-...-..--..-------.-...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.-KSH.....ITPAD...Y..PPP.....PGAP....PP...PQHY.HY..............AP................PTAQDPYAPRQPRGDENV.........................................................................
A0A080WIC1_TRIRC/552-671               ...............................RSRSRhgn..gnlAAG...LAAASL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......YDRD...YR........DPY.E.EE.Y..-P..S....P..........PGP.PPG..pAS..Y.QPPAAQE-................YYgvpp....ppgpPGGRGY...P........P.PP.GP.........PP-.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gpgyfggpgpggppvyr........................................................
G2QTJ0_THITE/700-864                   ...............................RSGSR........LRD...LAAGAA....AA.G....AA.A....I.G..I..K...K..FN..ERRAKEK.Ereekaea....................erekdrerNR.ER..E..RD..K.......GKER...DR........RRY.D.AE.A..SA..D....E..........YDG.YGR..rGA..S.PPNASGGF................YN............PPPPAP...P........A.PP.AGmn.....gfTQH.......P--.NV.AT..T..N.LHQQ.....YTP--...Y..PGP.....-GNV....DF...TA--.--..............--................------------------mpapppnsagvpdgapppfnpkdpeh...............................................
E9DDF0_COCPS/510-672                   ...............................RERSR........SRD...LATAGL...aAA.G....AA.G....L.A..A..H...K..YA..QRKERKK.N...................................ER.DR..R..RD..E.......GEA-...RQ........DSY.D.DT.Y..ST..T....P..........YPP.SPP...RP..S.ASLYPQGN................YY............PQTTQF...PqspnqttgP.PP.GH.........YQY......pPSN.YP.PPgtA..S.MP-PpnhvsHNPAD...Y..PPP.....PGAP....PP...AQHY.NY..............PV................PPAQDPYAHLQPRGDENV.........................................................................
R8BUE6_TOGMI/691-751                   ...............................RSRSR........LRD...LATGAA....AA.G....AA.A....I.G..L..K...K..YG..ESKEKKG.R...................................ER.ER..E..SR..E.......RDDR...DR........ER-.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------drdrerdrdr...............................................................
A0A084G042_9PEZI/442-486               ...............................RKRSR........SRS...IAKAAL....AT.A....AT.A....G.V..L..K...H..LR..NRSKSKS.R...................................SR.SR..S..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------vksqs....................................................................
B6H242_PENRW/542-687                   ...............................KHRSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSK-.-...................................ER.ER..E..HS..K.......HDDV...HR........DPY.E.ES.Y..DP..E....P..........YPP.SPQ..rAP..G.APPMADPH................YY............PNSNYF...P........P.PP.GD.........STY.......---.-N.LG..G..G.TPVS.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........avPP...............gGPGPDQYAPRPRRAEDNV.........................................................................
A0A0A2V7C7_BEABA/446-516               ...............................RSKSR........LRT...GAKIAG....AA.A....AA.G....V.A..G..K...L..YK..NHQEKKE.R...................................ER.SR..S..RA..P.......SDED...--........DRF.Y.DR.R..AR..S....H..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrsmarslhsd............................................................
Q0UZC8_PHANO/361-439                   ...............................RSKSR........VRE...IGALAA....IA.G....VG.A....L.A..Y..A...A..GR..KNKDKGV.Tt................................vvEE.HR..H..RS..R.......SRKS...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rskrghsrrgrsrsvtvietdggpsrsrs............................................
B8NBW3_ASPFN/561-699                   ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YT..QRRERKK.A...................................EQ.ER..E..RP..R.......FDED..aRQ........DSY.G.EP.Y..SP..E....P..........YQH.TA-...--..L.PPQSSEHQ................YY............PNTNYF...P........P.PP.GS.........APR.......---.--.-P..A..G.STAP.....YNPAD...Y..PPP.....PVAV....PP...SQQY.GY..............PP................-PGPESFVSRPRRADENV.........................................................................
E9DDF0_COCPS/287-350                   ..............................t-SRSR........ART...LAGLGL....GA.A....AI.A....G.A..V..A...L..AK..KHSEKSS.Q...................................QR.SS..C..RR..S.......RSHR...RR........SSS.A.SS.S..S-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dardpdh..................................................................
A0A093Y5R9_9PEZI/1015-1087             ...............................RSRSR........VRD...VVGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RR..Y.......SS--...--........DSY.P.SS.R..RS..A....D..........YSP.SP-...--..-.-PHASGGA................YY............PH----...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------p........................................................................
F9XE98_ZYMTI/303-348                   ...........................rsrsRSQSR........KRS...LATGAL....--.A....GA.G....A.A..A..I...L..GQ..HRKKQGH.E...................................ES.HR..G..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------nvl......................................................................
A0A074WG27_9PEZI/325-402               ...............................RSRSR........ART...LAKVGT....VA.A....VG.A....L.A..A..Y...A..LR..NRGNKET.Vivnn..........................elpppRR.SR..S..RR..R.......RS--...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------svgsapppldarnrsrseskhrdp.................................................
B6Q8Z7_TALMQ/273-331                   ........................rsrsrss-SHSR........AKT...LAGIGL....GA.A....AL.A....G.A..V..A...L..AR..NRTQDDR.R...................................SR.SR..H..RR..R.......SQSR...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ggdaas...................................................................
A0A094DD18_9PEZI/421-500               .............................rsRSKSR........IRT...GAELAA....AG.L....AS.A....A.A..A..G...L..YE..RRKAKQE.G...................................DR.SV..S..RS..L.......SRSK...SR........SRS.R.GV.R..GY..D....E..........YER.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pglveygaqplhsrg..........................................................
A7EI77_SCLS1/520-620                   ...............................RSQSR........VRT...AAEIAG...sGL.A....GA.A....V.-..A..G...L..YE..NRKAKKE.A...................................EE.DE..E..HV..R.......RERV...RV........RSR.T.RS.R..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------trsrsrarstgvysdpgvdpelgmvqygtepvhthqqpapydrtn............................
B8NBW3_ASPFN/412-511                   ...............................RSHSR........LRK...ALPVVA....AG.L....GT.A....A.A..T..G...L..YE..KHKEKQE.Eg................................eaSR.RR..E..RS..R.......SRSR...--........-AP.S.EI.Y..-P..D....P..........TRD.SAGlieYG..Q.DPVHGRI-................--............PTAD--...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------yygrptsqqayysdasdp.......................................................
A0A0G2JAW1_9EURO/312-379               ........................rhrsrss-SDSR........VKT...LASLGL....GA.A....AI.AgavaL.A..R..K...Q..SQ..KNAEKSN.N...................................-N.SR..S..RR..S.......R---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srhrrgsesssgegk..........................................................
W9WD84_9EURO/496-602                   ...............................RSRSR........IRQ..aLPVIAA....GL.G....SA.A....V.A..G..-...V..YE..KHKAKKE.Aeeivd........................knrrarSR.SR..S..RA..R.......SEHS...--........AYY.D.GP.P..PP..Q....N..........DQS.LVE...YG..N.TPMYGNNFg.............adYY............-----G...R........P.PP.QE.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gyyssavvp................................................................
S2JHI7_MUCC1/469-529                   ..........................ndhhy-----........KRD...AAIGAG....AA.G....AA.G....V.A..G..H...E..MK..EHHDKEA.-...................................SS.NR..T..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------svssagsgekkgaavhdkplnt...................................................
N4VHF5_COLOR/499-605                   .............................rsRSKSR........IRT...GAEIAA....AG.L....AG.G....V.A..S..K...I..YK..NRKDKKE.R...................................EI.ER..E..LS..-.......-DEE..yEE........DLR.R.ER.R..-A..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rrrsrsrsqarsiyseprsadpelglveygtsplprdppyplddgyasa........................
M2ZPK6_PSEFD/811-967                   ...............................RSRSR........RRN...LAEAGA....AA.G....VA.A....V.A..A..H...E..IG..KRRERSR.A...................................SR.SR..E..RR..R.......PED-...--........DYY.D.DR.R..AD..D....P..........YAP.PPM..gNS..Y.PPYQNNDPya............qqAY............PGANYF...P........P.PP.NG.........ETS.......GYV.EP.QP..A..Y.AHAQ.....YNPAD...Y..AGQ.....PATQ...aPY...DHQQ.AYdg..........ygEPy..............pGQSHHNYARDTQY-----gdegr....................................................................
K2S5L1_MACPH/581-741                   ...............................RSRSR........SRA...VAEAAA....LA.G....VA.G....V.A..A..H...E..AA..KRRERKK.A...................................EK.KE..K..KR..V.......EEER...--........PFS.E.DG.Y.gSP..P....P..........QGY.PPE..pYP..P.GPYQPDNG...............rYY............PESNQF...P........P.PP.QG.........YDPa.....mQQN.VY.EP..A..H.YGGPa...pYNPAD...Y..GPN.....PGPT...qPA...YAHQ.QQap..........yfPPp.............prEPQQEYYDDRGHHHGDD-n........................................................................
W9Y839_9EURO/107-204                   ...................paaerelvirrt-----........---...------....--.-....--.-....-.-..-..-...-..-T..ERDDPRR.-...................................-D.EV..S..VA..R.......YEDR...GRd......vRIA.E.TR.Y..RD..D....Y..........EIV.APS...RS..F.DDRDLQR-................YS............RTAEYF...T........P.PP.QP.........TTI.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------virqepiiirervrdddyq......................................................
G3JMF7_CORMM/325-456                   .......................rkssgggf-----........MKT...LATVAA....AV.G....AG.G....L.A..A..N...F..MK..KRNNREE.Eys...............................avST.DT..P..RR..N.......RSGR..gQP........SDY.G.SE.Y..-T..D....D..........YTA.TQT...SL..L.PPSANPAT................TYtt........rtTGDTGR...P........T.TP.RS.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sypsrrdhdesdyssyvspshrrpaensgg...........................................
A0A094JE74_9PEZI/550-621               ...............................RSRSR........ARD...VIGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RR..A.......YTPE...-I........TLS.S.AH.L..-P..T....P..........P-I.SPS...TP..F.SP------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ahtn.....................................................................
M1W061_CLAP2/575-704                   .............................rkRSKSR........LRD...MAAAGA....--.-....-A.A....I.G..I..K...D..FK..DRHDRKG.Kd................................rrDS.RS..S..RS..R.......DDDD...RRh.....heGAS.R.RD.Y..--..-....F..........DDA.GPR...PH..S.PPTASGGA................YY............PP---Y...P........P.TP.GDhpmasganyTPYp....ggQGG.RS.MS..G..A.EFQP.....YVPQD...Y..TG-.....----....--...----.--..............--................------------------yappp....................................................................
W9WD84_9EURO/642-800                   ............................rgg--RRH........SRD...AARVTA....AA.A....AG.A....A.G..A..S...E..AE..RRRQERR.-...................................ER.RA..R..RR..Q.......HEEG..yGR........DPY.E.DNnY.aPG..G....Q..........YAP.TPP..pPA..H.DPYATQQG................FY............PQSSQF...P........P.PP.GS.........IPQq.....yPP-.QA.GP..G..M.APPPpgsapYGQQG...Y..PPPp...pPPGA....PP...APAQ.PY..............DA...............yASGANPYAPRG-------penvs....................................................................
M7U351_BOTF1/694-842                   ...............................RSRSR........VRD...LAAGAL....GT.G....AA.A....I.G..I..N...E..YR..KRKEKKE.Kkekk..........................daekhER.ER..E..RR..R.......YEDE...AP........ESY.Y.TN.F..RD..E....T..........YSP.SP-...--..-.-PHASGGS................YY............PENNAF...P........P.PP.TSnpet.ftnhGNKs.....tPFV.NE.IP..-..-.PIPP.....YNPQD...Y..ASQ....rPTTH....DP...---H.HY..............PP................S-----------------srvpgdni.................................................................
A0A0F8UEJ4_9EURO/277-347               ......................rsrsrsrsh-SHSR........AKT...FAEIGL....GA.A....AI.V....G.A..I..A...L..AR..KQSSRSR.R...................................SH.SR..H..RR..G.......TSSSr.sVK........DSS.D.NK.R..SQ..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sqr......................................................................
S2JHI7_MUCC1/359-418                   .............................kr-----........---...--DAAL....GA.G....AA.G....L.A..G..H...E..LK..DHHGKES.-...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------glenhhttsgnplhsgsnnvnhsvndnndhhykr.......................................
F7W3Z0_SORMK/827-939                   ....................verrnsrdsdr-----........---...------....--.-....--.-....-.-..-..-...-..--..ERMERQR.-...................................ER.ER..E..RR..R.......YEEQ...-S........APS.D.PF.Y..KQ..Q....R..........RPA.SP-...--..-.-PHASGG-................YA............PV---P...P........T.PP.AV.........A--.......PAI.AP.VP..T..V.TTTP.....PQPAQ...A..PPP.....PQLQ....SH...----.--..............--................------------------rsstagftqlpnmtftdpnq.....................................................
W2RLM0_9EURO/515-659                   .............................rdRSRSR........IRT...AAPVVA....--.A....GL.G....S.AalA..G...L..YE..RNKAKKE.Aev..............................iqkDE.RR..N..RS..R.......SRSR...AR........SEY.T.EG.Y..RD..G....P..........LND.PGLi.eYG..D.GPMHGNN-................-Y............GEGYYG...R........P.AP.QE.........GYY.......---.AN.QT..A..V.VPAPg...tAAPAP...Y..GAT.....----....--...----.--..............--................------------------rdfrdpspgygrerrsrsrstss..................................................
G3XV77_ASPNA/301-373                   ......................rsrsrsrsh-SHSR........ARH...LAELGLgaaaIA.G....AV.A....L.A..R..S...K..SN..SNKDRRS.R...................................SR.HR..R..AS..S.......SRRS...LR........DTH.E.EK.R..SQ..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sqr......................................................................
W9W1E3_9EURO/534-675                   ..............................k-NKNR........LQD...VASIGI....AA.L....GL.K....G.A..Y..S...E..WQ..ETREAQR.E...................................QK.EE..K..EK..R.......ERHK..aKRa.....arRRK.M.SM.I..AA..H....N..........YVD.SGF...TG..S.MPNLASYPq.............qqYP............PQQPTF...P........P.PP.GA.........FAY.......---.--.--..-..-.--GT.....GSPVH...Y..ADD....nPYG-....AI...SQQQ.AY..............VP................APHHEPQVGVPRA-----eth......................................................................
S3DTS4_GLAL2/454-536                   .............................rs--RSS........SRHshtKVKTALg.laVA.G....LA.A....A.A..A..A...K..YV..SNRNQNK.Ee.................................lGR.GR..S..RT..R.......SRGR..gRS........SSY.S.SD.Y..GS..R....A..........RSK.SV-...-H..T.DPKH----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rna......................................................................
A0A0N0NRB6_9EURO/357-444               ......................rsrsrsrsq-SRSR........LKN...LGLLGL....GA.A....GL.A....A.A..A..V...V..AT..KKMKQNN.E..................................dKA.DE..N..RG..R.......SQSR...VR........TDR.V.ET.I..EE..L....A..........NDP.TAE...DA..R.NPKHRN--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------krma.....................................................................
A0A074W448_9PEZI/552-709               ...............................RSRSR........TRG...LAEGAA....AA.G....VA.A....V.A..A..H...E..LG..KRNERRR.Ad.................................rER.DR..D..RR..R.......HEEE...-D........DMY.A.HD.R..--..-....P..........YSP.PPMganAA..Y.PPTPQSHE................FY............PATNTF...P........P.PP.TD.........NYR.......-HQ.AD.YP..P..Q.EYRP.....YNPAD...Y..PPP.....PAAT...sAPr.gRQDE.RY..............PSpdp.........nlgyPPANETFAGDPRYAGDN-r........................................................................
A2QKM3_ASPNC/402-507                   ...............................RRESR........SHS...AIRKALp..vVA.A....GL.G....T.A..A..A...TglYE..KNKEKKE.E...................................EE.SR..R..RE..R.......RRSR..sRS........RAP.S.EV.Y..-P..D....P..........TRD.SPG..lIE..Y.GDH-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pvhgsippnyygrpvsphgyysdasdpva............................................
A0A094JE74_9PEZI/310-371               .......................hsklkmgl-----........---...---GAA....AL.S....VA.A....L.A..A..G...K..YF.kDRHDTKR.A...................................EE.GR..G..RS..R.......TRSP...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sragrassegrhsdpkk........................................................
A0A072PTE1_9EURO/632-778               ..............................h-SRRR........SRD...AAKYAA....AA.A....AG.A....I.G..T..S...E..YN..RRKEEKR.-...................................ER.KA..R..RQ..E.......EEAAy.rAH........DPY.E.DS.Y.nTG..A....P..........YAA.TP-...--..-.DPYAAQQG................FY............PQTSQF...P........P.PP.GG.........MPG.......-QY.NP.QP..A..A.TQMPga.apYGGQV...Y..PPP.....PAG-....PP...PVTN.NY..............DA...............yASGANPYAPRG-------penvs....................................................................
G4N0D9_MAGO7/539-644                   .............................rhRSRSR........LRT...GAEIVA....-A.G....LA.G....G.A..A..K...K.iYD..KHQEKKE.R...................................ER.SR..S..VA..A.......GKRRsrsRS........LSS.D.WS.Y..DD..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rdrrrrsrshsrsnararlpplphndssradselgmveygnnp..............................
A0A080WGP9_TRIRC/489-608               ...............................RSRSRhgn..gnlAAG...LAAASL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......YDRD...YR........DPY.E.EE.Y..-P..S....P..........PGP.PPG..pAS..Y.QPPAAQE-................YYgvpp....ppgpPGGRGY...P........P.PP.GP.........PP-.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gpgyfggpgpggppvyr........................................................
A0A0D9MW47_ASPFL/561-699               ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YT..QRRERKK.A...................................EQ.ER..E..RP..R.......FDED..aRQ........DSY.G.EP.Y..SP..E....P..........YQH.TA-...--..L.PPQSSEHQ................YY............PNTNYF...P........P.PP.GS.........APR.......---.--.-P..A..G.STAP.....YNPAD...Y..PPP.....PGAV....PP...SQQY.GY..............PP................-PGPESFVSRPRRADENV.........................................................................
A0A074YPM7_9PEZI/540-696               ...............................RSRSR........TRG...LAEGAA....AA.G....VA.A....V.A..A..H...E..LG..KRDERRR.Sd.................................rDR.DR..E..RR..R.......RDED...-E........DMY.A.RD.R..--..-....P..........YSP.PPMganAA..Y.PPTPQNQD................FY............PATNSF...P........P.PP.TD.........-NY.......GRE.AD.YP..P..H.EYPP.....YNPAD...Y..PPP.....PGAA....PAprgRHND.RY..............SPdpn..........lgyPPANETFAGDTRYAG---dtr......................................................................
A0A080WQ72_TRIRC/489-609               ...............................RSRSRhgn..gnlAAG...LAAASL....-A.A....GA.G....Y.A..G..H...E..YA.kHHRDQKH.-...................................--.SN..G..RA..E.......YDRD...YR........DPY.E.EE.Y..-P..S....P..........PGP.PPG..pAS..Y.QPPAAQE-................YYgvpp....ppgpPGGRGY...P........P.PP.GP.........PP-.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gpgyfggpgpggppvyrg.......................................................
H6C6Y6_EXODN/487-594                   ...............................RSRSR........VRQ..aLPVVAA....GL.G....SA.A....L.A..G..-...L..YE..KNKARKE.Akq..............................iaeEQ.RR..A..RS..R.......SRSR..aRS.......dGYY.D.GP.R..-D..A....A..........LSD.PGLi.eYG..N.GPMYGNN-................FG............PDYYGR...P........P.PA.EG.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------yygasnavvp...............................................................
G2QTJ0_THITE/535-639                   .............................ksRSRSR........LRT...GAEMLA....-A.G....LA.G....A.G..A..K...K..LY.dRHKEKKE.A...................................ER.DR..D..RG..Y.......SDDE...--........-YY.E.DD.A..RD..-....-..........YNR.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rsrsrslsrsgptypdgdpsaadpelgmveygahplyanpaypad............................
E3QDR6_COLGM/691-852                   ...............................RSRSR........DRS...VSRPRA....HS.R....DR.A....Y.S..R..E...R..ST..DRPINR-.-...................................DR.ER..D..RR..R.......YEEG..vRD........DEY.Y.TD.Y..--..-....S..........RPP.SP-...--..-.-PHASGG-................--............---SYY...P........P.PP.AAaa.....gfTQY.......PNIsTA.NL..R..E.QYPP.....-YPQD...Y..PPG.....PPPM....GP...SPPM.ATgga........ggyPP................------------------ppaggpppsgglppgtrfgpdhvsddisrsaspqdaq....................................
R8BUE6_TOGMI/744-875                   ........................drerdrd-----........---...------....--.-....--.-....-.-..-..-...-..--..RERDRER.R...................................DR.DR..E..RR..R.......YEEE...TA........ADY.D.DA.Y..-D..A....Q..........RPP.SP-...--..-.-PHASGGA................YY............PPPPAA...P........AaPP.AAaapy.gagfTQH......pNIA.TT.NL..N..E.GYQP.....YHPADytgY..PPP.....PPGP....PP...SHPQ.TPt...........gfPP................PPTGG-------------haagdnm..................................................................
J4TVZ1_9PAST/65-121                    .............................na-----........---...------....--.-....--.-....-.-..-..-...-..--..-HKEEKK.Hr.................................aER.ER..E..HR..H.......HHEG..fRP........ARY.EyDD.F..DD..R....H..........HKPhRPK..hHK..H.KPHHH---................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ddd......................................................................
A0A0G2JAW1_9EURO/416-525               ......................kspsrikqg-----........---...LPIAAA....SL.G....SA.A....I.-..A..N...L..YE..KHKEKKE.S...................................ES.SE..R..QD..K.......RHRR...QS........SRS.R.SV.R..RS..A....T..........YSD.PSR...SS..P.QLIEYGDD...............pVYg.........siPANNYY...G........R.PP.SR.........QSS.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------spraieasprrs.............................................................
A0A094DD18_9PEZI/514-670               ...............................RSRSR........ARE...MLGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RH..-.......-YSS...--........DSY.P.SS.R..RS..A....D..........YSP.SP-...--..-.-PHASGGA................YY............PNHPTQ...Q........Q.PP.TH........pYPT.......TPD.AH.PY..G..A.HPDP.....NAPTA...F..PPP.....PVP-....-P...SGAY.HP..............PPm..............gG-----------------yeaqsqggpssggppgpghvnpdyygetaggaga.......................................
S3DTS4_GLAL2/755-874                   .............................sg-----........---...------....--.-....--.-....-.-..-..-...-..--..-------.-...................................--.--..-..--..-.......YEEE..pPD........DYY.S.RD.Y..VD..D....G..........YSP.SP-...--..-.-PHASGGS................FY............PDHNQF...Q........P.PQ.QPayt...pgfTQH.......-PN.LS.TP..N..V.GQSPl..ptYNPAD...Y..APGt...gPAPQ....PP...HDPY.GY..............PPt..............vPRSGDNVSPRTT------thqyppdpanp..............................................................
B4R4D9_DROSI/104-194                   ...................rssllvnsaltn-----........--T...VAA-AA....AA.A....AA.A....V.A..S..N...T..LQ..QHQQHHQ.Q...................................QQ.QQ..Q..QQ..Q.......QQQQ..qQQ........QQQ.Q.QQ.H..SP..Q....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------qhliraipvsrfisarnvtrvannrhp..............................................
A0A0G4LM95_9PEZI/553-711               ...............................RSRSR........IRD...MAAAAV....GT.G....AA.A....I.G..I..K...E..YK..KKKDAEK.Eredeaarra.................rerslsrdySR.DR..S..RR..R.......DEDR...--........RRY.E.EE.S..NP..N....P.........hYDD.YSR...PP..S.PPHASGG-................--............---AYY...P........P.PT.GS.........GFS.......--Q.NQ.SV..N..D.PYPP.....YSPHA...Y..TGF.....PPPQ....P-...----.--..............--................------------------ggpstasgaaggfptptpggpplsypggp............................................
B2WNY2_PYRTR/600-753                   ...............................RSKSR........ART...VAETAA....VA.G....VA.G....L.A..A..H...E..AA..KRRDRKK.A...................................EK.EA..E..RR..R.......EEDT...--........AYS.T.ST.Y..--..S....P..........YDS.PTS...ST..A.HPDDSR--................YF............PETNYF...P........P.PP.SA.........---.......-PV.DH.NP..N..N.PYPP.....YNPAD...Y..PPG.....PQST...yEP...NHPS.QFv............nPPhndlhp...gnpyappQQQQDFYYGQPRHPDDNV.........................................................................
A0A0F8UEJ4_9EURO/379-488               ...............................RSRSR........SKS...TFRKALp..vVA.A....GL.Gt..aV.A..T..G...L..YE..KNKEKRE.Se................................eeSR.RR..E..RR..R.......SRSR...-S........RPP.S.EI.Y..-P..D....P..........TRD.SAG..lIE..Y.GEHPVPG-................II............PAANYY...G........R.PA.SS.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------qgyisdasdkvssg...........................................................
A2QKM3_ASPNC/301-374                   ......................rsrsrsrsh-SHSR........ARH...LAELGLgaaaIA.G....AV.A....L.A..R..S...K..SN..SNKDRRS.R...................................SR.HR..R..AS..S.......SRRS...LR........DTH.E.EK.R..SQ..S....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------qrr......................................................................
F0U958_AJEC8/562-700                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKR.A...................................EK.DR..R..TY..A.......HDHD...YS........DSY.E.DG.Y..EP..A....P..........YPP.SP-...--..-.-PSNGPN-................YY............AQGSQF...P........P.PP.GA.........APV.......P--.--.PP..N..V.QPGP.....YNPAD...Y..PPP.....PGAA...pQP...PSNY.PY..............PP................PPGVDAYAPRSARGDENV.........................................................................
H0EK30_GLAL7/634-744                   ...............................RSRSR........VRD...IAGAAA....GT.A....AA.A....I.G..I..N...Q..YK..KRKEKKE.A...................................QR.ER..E..RR..R.......YEEE..pPD........DYY.S.RD.Y..VD..D....G..........YSP.SP-...--..-.-PHASGGS................FY............PDHNQF...Q........P.PQ.QP.........AYT.......PGF.TQ.HP..N..-.----.....-----...-..---.....----....--...----.--..............--................------------------lstpnrhnllmtp............................................................
Q0C9I2_ASPTN/595-690                   ........................htvgpgy-----........---...------....--.-....--.-....-.-..-..-...-..--..-------.-...................................--.--..-..--..-.......-DD-...RR........EPY.E.DP.Y..AP..E....P..........YAN.SP-...--..-.--HDNQ--................YY............PNSNYF...P........P.PP.GS.........APR.......---.--.-V..A..G.TGPA.....YNPAD...Y..PPP.....PGAV....PP...AQPY.SY..............AT................PPAPEPYAPRPRRADENV.........................................................................
Q2TZD9_ASPOR/561-699                   ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YT..QRRERKK.A...................................EQ.ER..E..RP..R.......FDED..aRQ........DSY.G.EP.Y..SP..E....P..........YQH.TA-...--..L.PPQSSEHQ................YY............PNTNYF...P........P.PP.GS.........APR.......---.--.-P..A..G.STAP.....YNPAD...Y..PPP.....PVAV....PP...SQQY.GY..............PP................-PGPESFVSRPRRADEN-g........................................................................
A0A068RLC2_9FUNG/147-258               ..........................gmstg-----........-MK...VAAGAA....VA.G....LA.G....Y.G..I..A...E..FV.eHEHEQSE.Rld...............................dlER.EN.qE..LQ..R.......QQDE..lER........EQQ.Q.QE.Y..YQ..Q....P..........PPP.PPP...AE..S.YPPAGED-................-Yga........ppPPPSEY...P........P.PP.EE.........QGT.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tttiinedgg...............................................................
S9VEY3_9TRYP/208-326                   ..................liacltpiciqcc-----........---...------....--.-....--.-....-.-..-..-...-..-E..AREEKKQ.A...................................KK.DE..K..KR..K.......KEEK..kVQ........KQQ.E.ET.Q..NS..N....Q..........YYN.YYD...TQ..Q.QPQQGATYga...........ppvYY............GNTVTY...G........A.PP.AN.........VGYgv...plNNE.VH.AP..T..YgQPTP.....SKPVD...-..---.....----....--...----.--..............--................------------------thpvttptp................................................................
C0NM90_AJECG/420-519                   ......................grirqgipi-----........---...-AVAGL....--.G....SA.A....I.-..A..N...L..YE..KHKEKKE.S...................................ES.-S..E..RK..E.......KNHR...RRsr...srsMAR.S.ST.Y..-P..D....P..........SRS.SPQlieYG..D.DPV-----................-Yg.........siPANNYY...G........R.PP.SR.........QS-.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sspraie..................................................................
A0A0F4GXD0_9PEZI/399-461               .............................rsRSRSRsf....nrTQK...LGGLAA....VA.A....VA.A....L.G..A..Y...A..LK..NRNNKET.Vi.................................vKE.QP..P..RR..R.......SEHR...SP........D--.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------hrnrr....................................................................
R8BUE6_TOGMI/546-643                   .............................ksRSRSR........LRT...GAEIVA....-A.G....LA.G....A.A..G..K...K..LY.dRHKDKKE.D...................................QR.E-..-..RE..L.......EED-...--........EYY.D.RE.R..RR..S....R..........SRS.-RS...VA..R.APYPNP--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gtadpelglveygaqplyteppypeya..............................................
A0A0G4LUP4_9PEZI/76-231                ...............................RSRSR........IRD...MAAAAV....GT.G....AA.A....I.G..I..K...E..YK..KKKDAEK.Eredeaarr...................arerslsrDY.SR..D..RS..R.......RRDE...GR........RRY.E.EE.S.nSN..P....H..........YDD.YSR...PP..S.PPHASGGA................Y-............-----Y...P........T.PT.GS.........GFS.......--Q.NQ.SV..N..D.PYPP.....YSPHA...YtgFPP.....PQPG...gPP...T---.--..............--................------------------asgaaggfptptpggpplsyq....................................................
A0A094EQ88_9PEZI/1075-1154             ...............................RSKSR........IRT...GAELAA....AG.L....AT.A....A.A..A..G...L..YE..RRKAKQE.Gergvs.........................rslsrSK.SR..S..RS..R.......GGRR...--........---.-.--.R..LD..D....D..........YER.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pglveygaqplhsrg..........................................................
A0A0A2KDD1_PENIT/540-687               ...............................KHHSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSK-.-...................................ER.ER..E..HS..K.......HDDN..vHR........DPY.E.ES.Y..DP..E....P..........YPL.SPQ..tAP..G.APPMVDSH................YY............PNNNYF...P........P.PP.GD.........STH.......---.-N.LN..G..G.TPAP.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........aaPPg..............pGPGPEQYASRPRRADENV.........................................................................
S3CWZ7_OPHP1/455-493                   .............................rp-KKSR........SRS...VAKVAA...gTA.A....VA.G....I.V..H..H...F..RS..KSRQRD-.-...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gkar.....................................................................
A0A0G4LM95_9PEZI/435-528               ...........................rsrsRSKSR........IRQ...GAEVVA....-A.G....LA.G....G.A..A..S...K..LW.hSRKDKKE.A..................................kER.EL..S..DE..E.......YEEEq.rRR........DRA.A.RR.R.sRL..V....E..........YGT.DPL..pPS..Q.PPYPTND-................Y-............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------gyksassq.................................................................
W9W1E3_9EURO/364-467                   ..............................s-KRSR........SRS...IAARGL....AA.L....GL.K....D.A..A..D...K..VD..PGRERD-.-...................................-R.RR..N..YD..N.......YDDD...GR........SSR.Y.GG.Y..--..-....G..........YND.S--...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rdvgtiqpqydyanggprslsvprgapsgyeldygprhtgdpetds...........................
A0A094GA47_9PEZI/421-500               .............................rsRSKSR........IRT...GAELAA....AG.L....AS.A....A.A..A..G...L..YE..RRKAKQE.G...................................DR.SV..S..RS..L.......SRSK...SR........SRS.R.GV.R..GY..D....E..........YER.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pglveygaqplhsrg..........................................................
F9XE98_ZYMTI/636-829                   ...............................RNHSR........SRN...AAIGGA....AL.G....GA.A....L.A..A..H...E..MG..KRRERSK.Vakenrrerecrqsad.....dedlltqipgrddhqED.YY..D..DR..R.......HDDR...RH........DDR.D.NN.-..--..M....G..........YND.YP-...QS..N.APYGGQPS................TY............PTSHYF...P........P.PP.TG.........EDA.......ARN.DP.YG..AqpQ.TYPA.....YNPAD...Y..AGQ.....PAQQ...hPP...YDQG.QYgg..........geIPygesa.....dpninqPYPGDAYAGDQR------ygaeheps.................................................................
U4LPE7_PYROM/264-322                   ............................dph---HR........ARH...LAEAGL....GA.A....AL.V....G.A..D..K...L..YS..RRRSQVR.Srpgsrp......................gsrssssDR.SR..S..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srsrs....................................................................
S3CWZ7_OPHP1/711-834                   .............................nd-----........---...------....--.-....--.-....-.-..-..-...D..YD..HERHQSH.-...................................DR.HR..R..RD..K.......HHDR..dDA........HGY.N.GG.Y..YD..H....D..........DSR.PP-...--..S.PPHVSGGA................YY............P-----...P........A.PPmGS.........TDEl.....mQHP.NS.NI..S..D.GYMS.....YNPHDqtnY..PPP.....PGP-....PP...SHQG.--..............--................------------------savdrlygefapgtapgvpspha..................................................
A0A0D9MW47_ASPFL/412-511               ...............................RSHSR........LRK...ALPVVA....AG.L....GT.A....A.A..T..G...L..YE..KHKEKQE.Eg................................eaSR.RR..E..RS..R.......SRSR...--........-AP.S.EI.Y..-P..D....P..........TRD.SAGlieYG..Q.DPVHGRI-................--............PTAD--...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------yygrptsqqayysdasdp.......................................................
M2MVN7_BAUCO/431-515                   .......................rkrsrsrsKSLSR........AQQ...LGGLAA....VA.A....VG.A....L.A..G..Y...A..LT..RNKNKET.Vvv..............................eppHR.SR..S..RR..R.......RASV...-D........SYY.T.DD.R..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tvlsdgggramdpnhrn........................................................
R7YPI0_CONA1/593-724                   ...............................RSKSR........TRR...VAEAAA....LA.G....VA.G....V.A..A..N...R..AS..KRRRSKD.Rgsr.............................ergSR.ER..G..SR..E.......RNDG..dRQ........RRM.E.EG.T.sAS..D....N..........YGT.PPP..qAG..YpIPPYQGGR................YY............PETNEF...P........P.PP.TI.........ASE.......DYA.MH.PP..M..N.GYPP.....NPPMN..gY..PPP.....PMS-....--...----.--..............--................------------------ay.......................................................................
A0A0K8LFQ8_9EURO/522-657               ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YK..QSRDRKK.E...................................EK.ER..S..K-..-.......YDD-...--........DSY.P.SS.Y.pSD..L....P..........YPP.SPL...PP..T.HPVENQH-................-Y............PNSNYF...P........P.PP.GS.........TPA.......---.--.-P..A..A.PPAP.....YNPAD...Y..PPP.....PGAV....PP...AQSY.GY..............PP................EPGPDRYAPRPRRADENV.........................................................................
V5G1I1_BYSSN/557-696                   ..............................g-SRSR........SRH...LAEAAL....TA.A....AG.G....F.A..A..D...K..YA..KKKERKK.A...................................EK.ER..R..RH..E.......SDED...-Y........DPY.E.DQ.Y..DP..E....P..........YTP.PPP..pAG..A.APYD---H................YY............PQTNSF...P........P.PP.AS.........APA.......P--.--.-P..Q..S.QPAP.....YNPGE...Y..PPP.....PGAA....PP...PQPY.GY..............QP................PPGPDPYAPRPRRADENV.........................................................................
A0A0N0NRB6_9EURO/594-748               ...............................RRRSS........RRR...AADAAA....AA.G....GG.A....A.A..A..S...A..YE..RSKAEKR.A...................................RK.EA..K..RR..E.......REG-...YA........DQY.E.DP.Y.nAP..Q....Q..........GYQ.PPV...DP..Y.APNAQQP-................YY............QQPGAF...P........P.PP.GA.........EQY.......---.-A.QP..G..A.FPPP.....-PPGGp.pM..PPP.....PGA-....PG...YEPY.AYg............aNPn.............apT-----------------rgadnvsvplqnsipdgvntsrsm.................................................
E3RIR8_PYRTT/543-696                   ...............................RSKSR........ART...VAETAA....VA.G....VA.G....L.A..A..H...E..AA..KRRDRKK.A...................................EK.EA..E..RR..R.......EDDS...--........AYS.T.GT.Y..--..S....P..........YDS.PT-...-P..S.TAHTNDSR................YF............PETNYF...P........P.PP.SA.........---.......-PV.DH.NP..N..N.PYPP.....YNPAD...Y..PPG.....PQST...yEP...NHPS.QFv............nPPhndlhp...gnpyappQQQQDFYYGQPRHPDDNV.........................................................................
A0A066XKL1_COLSU/524-653               ...............................RSKSR........IRT...GAEVVA....AG.L....AG.G....V.A..S..K...I..YK..NRKEKKD.R...................................E-.-L..D..RE..L.......SDDE...YE........EEL.R.RE.R..RE..H....R..........RSR.SRSq.aRS..L.HPEPRNADsel.........glveYGa..........sPLPTDP...P........Y.PP.DD.........GYE.......SAA.NE.RR..R..R.RHRR.....MSPDD...Y..DDR....eP---....--...----.--..............--................------------------akk......................................................................
L8G585_PSED2/503-624                   ...............................RSKSR........TRD...VLGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RR..-.......YSS-...--........GSY.P.SS.H..RS..A....D..........YSP.SPP..tPP..A.APTTPTT-................--............P--PNL...P........P.TP.TP.........TRT.......HTQ.T-.--..-..-.QTTA.....HTPTP...T..PQP.....P---....--...----.--..............--................------------------shhllsrhrartmprrwg.......................................................
A2QKM3_ASPNC/556-695                   ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..LS..QRNERKK.A...................................DR.DR..D..RP..E.......SDED..aRR........EPY.D.SS.Y.kNP..L....P..........YPA.TPA...AA..P.RPIDDHQ-................YY............PNGNYF...P........P.PP.AT.........GPR.......---.--.--..-..P.EPAP.....YSPAD...Y..PHP.....PGPV....PP...-QSY.DY..............PS................GPGPDPYAPRPRRADENV.........................................................................
A6RCP1_AJECN/562-700                   ...............................RSKSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRKERKR.A...................................EK.DR..R..TY..A.......HDHD...YS........DSY.E.DG.Y..EP..A....P..........YPP.SP-...--..-.-PSNGPN-................YY............AQGSQF...P........P.PP.GA.........APV.......P--.--.PP..N..V.QPGP.....YNPAD...Y..PPP.....PGAA...pQP...PSNY.PY..............PP................PPGVDAYAPRSARGDENV.........................................................................
A1DGB5_NEOFI/538-673                   ...............................KHRSR........SRD...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YK..QSRDRKK.-...................................-E.DR..E..RS..K.......YDD-...--........DSY.P.SS.Y.pSD..L....P..........YPP.SPL...PP..T.QPGENP--................YY............PNSNYF...P........P.PP.GS.........TPA.......---.--.-P..P..A.PAAP.....YNPAD...Y..PPP.....PGAV....PP...AQPY.GY..............PP................EPRPDRYAPRPRRADENV.........................................................................
K1WW28_MARBU/694-854                   ...............rsrsrrrrhsssssgg--RRR........SRS...VAKVAA....GT.A....AA.A....I.G..M..N...Q..YQ..KRKGRKE.A...................................DR.ER..E..RR..R.......YEEE...EQp.....peNYY.A.RD.Y..-Q..D....D..........YSP.SP-...--..-.-PHASGGS................YY............PQNNAF...P........P.PP.QPg.......fTQHt.....tTST.TH.VT..R..D.GIPP.....YNPAD...W..ANP.....PPPP....LH...HDPY.VY..............SG...............hHAGENPYFPPP-------pvap.....................................................................
L8G585_PSED2/408-485                   ...............................RSKSR........VRT...GAELAA....AG.L....AT.A....A.A..A..G...L..YE..RRKAKQE.Gergv..........................sslsrSK.SR..S..RS..R.......GGR-...--........-RY.D.DD.Y..E-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rpglveygaqplhsrg.........................................................
B8M1D8_TALSN/481-624                   ...............................RSSSR........IRD...FAEAGL....AA.A....GL.G....Y.A..A..S...K..IS.gNKKEKSH.R...................................SR.ER..E..SR..R.......HDHD...-T........DSY.E.EP.Y..DP..A....P..........YMQ.PP-...PP..G.APVPPTES................YY............PYTNSF...P........P.PP.GS.........TPN.......---.--.--..-..P.PPAP.....YNPTE...Y..PPPp...pPGAV....PP...-PVH.GY..............PPpp............gaPPGNEPYAPQPRRADENV.........................................................................
G4N0D9_MAGO7/767-894                   .........................hmsper-----........---...------....--.-....--.-....-.-..-..-...-..-D..RNREREE.R...................................AR.DR..E..RR..R.......YEDE..iDDg......yDSY.D.DR.Y..HG..H....S..........HPP.SP-...--..-.-PHASGGA................YI............RPAMSG...A........A.GP.GF.........TSH.......PNI.AS.TN..L..N.DYGG.....YHPAD...Y..GGY....pPNSA....PT...PTGM.PP..............PPa.............gmPPAAPPYPMDP-------rppnn....................................................................
T0KDB4_COLGC/626-691                   ...............................RSKSR........LRD...MAAAAV....GT.G....AA.A....I.G..I..K...Q..YQ..KKKEKEE.Dd................................rrS-.-R..E..RS..A.......RSRS...RD........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rsisrdraysrdrasr.........................................................
F7W3Z0_SORMK/375-438                   .............................rsRSRSR........SHS...RIKTGL....GI.A....AV.A....L.A..A..A...G..AA..KYYESKK.Iek..............................eeaER.GR..A..PR..R.......YSES...--........DYY.S.R-.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------spsrk....................................................................
A0A0F4GXD0_9PEZI/303-349               ...........................rsrsRSQSR........KRS...LATGAL....--.A....GA.G....A.A..A..I...L..GQ..HRKKQGH.E...................................ES.HR..G..R-..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------nvlg.....................................................................
U7PSX9_SPOS1/496-647                   ...............................RSHSR........LRT...GAEIAG....AA.L....AG.A....A.A..K..K...L..YD..KHKDKKQ.L...................................ER.EQ..K..EA..A.......YYSD...DP........YSE.D.DR.Y..SR..Hg.rgS..........RSH.SRN...RS..A.APSQSPPP................L-............SGATRT...P........Y.PP.SG.........A--.......---.--.DP..E..L.GLVE.....YGDQP..lY..ADP.....----....--...----.--..............--................------------------gapardgaivghrgsydsaadaserddrrarrrhrhsrng.................................
A0A0F2MLK1_SPOSC/726-838               .....................rdhdrqrdyd-----........---...------....--.-....--.-....-.-..-..-...-..--..--RDEDV.N...................................RR.HR..H..RH..H.......RDDE..eAY........DGY.Y.DD.Y..-D..N....S..........RPP.SP-...--..-.-PHASGGA................FY............P-----...P........A.PP.GGapigttgglMQH......pNTA.TT.NL..N..D.SYAP.....YNPVDysgY..PPP.....PGP-....PP...----.--..............--................------------------trgaadvq.................................................................
A6RCP1_AJECN/417-526                   ...................kspgrirqgipi-----........---...-AVAGL....--.G....SA.A....-.I..A..N...L..YE..KHKEKKE.S...................................ES.-S..E..RK..E.......KNHR...RRsr...srsMAR.S.ST.Y..-P..D....P..........SRS.SPQlieYG..D.DPV-----................-Yg.........siPANNYY...G........R.PP.SR.........QSS.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------spraieasprrss............................................................
U6KG47_9EIME/184-288                   ........................gtaevpa-----........---...-AAAAA....AA.T....AA.A....A.A..A..A...A..AQ..QHQQQQQ.H...................................QQ.QQ..Q..QQ..Q.......QQQ-...--........DLS.L.FL.L..QQ..Q....Q..........QKQ.TPS..lLL..Q.HPQHPQQ-................QH............PQQQQH...P........Q.HP.HQ.........HPQ.......QQQ.QQ.QQ..Q..Q.Q---.....-----...-..---.....----....--...----.--..............--................------------------qamkst...................................................................
C0NM90_AJECG/562-700                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKR.A...................................EK.DR..R..TY..A.......HDHD...YS........DSY.E.DG.Y..EP..A....P..........YPP.SP-...--..-.-PSNGPN-................YY............AQGSQF...P........P.PP.GA.........APV.......P--.--.PP..N..V.QPGP.....YNPAD...Y..PPP.....PGAA...pQP...PSNY.PY..............PP................PPGVDAYAPRSARGDENV.........................................................................
C6HTC0_AJECH/382-462                   ...................kspgrirqgipi-----........---...-AVAGL....--.G....SA.A....-.I..A..N...L..YE..KHKEKKE.S...................................ES.-S..E..RK..E.......KNHR...RRsr...srsMAR.S.ST.Y..-P..D....P..........SRS.SPQ...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------lierssrrashs.............................................................
A0A010Q3X1_9PEZI/698-844               ...............................RSRSR........DRS...VTRERT....YS.R....ER.A....Y.S..R..E...R..ST..DDRMRNR.-...................................ER.ER..D..RR..R.......YEED..aRD........DGY.Y.DN.Y..--..-....S..........RPP.SP-...--..-.-PHASGGS................F-............-----Y...P........P.PP.AAaa.....gfTQH......pNIS.TA.NL..R..D.QYPP.....YPSSDs.vY..PPG.....PPPM....GP...SPPM.ATgga........ggyPP................PP----------------pagghpppgggppgtr.........................................................
G3JMF7_CORMM/253-330                   ....................ekssnlkwlgp-----........---...------....LA.A....GA.G....LwA..L..L...R..NG..KKKQNRE.R...................................SR.SR..S..RS..R.......SPSS...YRtnpevlssRGY.S.ER.F..YD..D....K..........YSE.PPQ..rKS..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sgg......................................................................
U7PSX9_SPOS1/670-736                   ...............................RSRSR........LRN...LATAGA....GA.A....AA.A....I.G..I..K...K..YS..DSKKKKE.E...................................EA.NR..R..DR..R.......DHER...-D........RDH.D.RD.F..D-..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rdhdrqrdydh..............................................................
S3DTS4_GLAL2/689-740                   ...............................RSRSR........VRD...IAGAAA....GT.A....AA.A....I.G..I..N...Q..YK..KRKEKKE.A...................................QR.ER..E..RR..R.......EDPS...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tldlv....................................................................
A0A010Q3X1_9PEZI/515-646               .............................rsRSKSR........IRT...GAEIAA....AG.L....AG.G....V.A..S..K...I..YK..NRKEKKD.Re.................................vDR.EL..E..EQ..D.......YEEE..vRR........ERR.E.RR.R..SR..S....R..........SQA.-RS...LY..S.EPRSADPElg...........lveYGt..........ePLPTDP...P........Y.PP.DD.........GYE.......SAA.NE.RQ..R..R.RHRR.....MSGDD...Y..DG-.....----....--...----.--..............--................------------------hepakk...................................................................
A0A074YSE8_AURPU/553-710               ...............................RSRSR........TRG...LAEGAA....AA.G....VA.A....V.A..A..H...E..LG..KRDERRR.S...................................DR.DR..D..RD..R.......DRRE..eEE........DMY.A.HD.R..--..-....P..........YSP.PPMganAA..Y.PPTPQSQD................YY............PATNSF...P........P.PP.TD.........-NY.......GRQ.PD.YP..P..H.EYPP.....YNPAD...Y..PPP.....PGAAg.vpRG...RHDE.RY.............aSPdpn..........lgyPPANETFAGDTRYAGDN-r........................................................................
W6PSX9_PENRO/699-813                   .................dstvgsgssshrgg-----........---...------....--.-....--.-....-.-..-..-...-..--..--RDHRH.-...................................DR.DR..D..RD..R.......DRDR..dSR........HHH.H.RR.S..SS..V....P..........YPP.MPP...PS..S.TASD-RHN................FY............PDSSHHrhhP........S.AP.KH.........HEE.......RDQ.NK.AP..E..-.----.....-----...-..---.....----....--...----.--..............--................------------------adsdstidlpsrfdgqgrplperdpa...............................................
R0K5Y5_SETT2/335-421                   .............................rhRSRSR........AKE...IGTLAA....IA.G....VG.A....L.A..Y..A...A..GQ.rNKKVNKE.Etvt.............................iieDR.HR..S..RS..R.......HGRS...H-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------htrgrrrsrsvsivesdrslsrssskhmdp...........................................
A0A072PTE1_9EURO/382-456               ............................rsh-SRSR........LKT...LGAVGL....GA.A....AL.A....A.A..A..T...I..AT..KRLGKKE.Tee...............................ppRR.SR..S..RR..R.......REET...LS........ELE.N.DP.T..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------addarnpkhrnkr............................................................
A0A010Q3X1_9PEZI/647-698               ...............................RSKSR........LRD...MAAAAV....GT.G....AA.A....I.G..L..K...Q..YQ..KKKEKEE.-...................................-E.RR..E..ER..R.......EERR...SR........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ersar....................................................................
S2JHI7_MUCC1/417-457                   .............................kr-----........---...--DAAL....GA.G....AA.G....L.A..G..H...E..LK..NHHNRES.S...................................--.--..-..--..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------adghhsssgnplhp...........................................................
A0A063BU25_9HYPO/416-462               .............................rsRSRSK........RRS...LSTVAK....AA.L....GT.A....A.T..A..G...I..IK..HIRDKSK.S..................................kSR.DR..S..RS..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rs.......................................................................
A0A094JE74_9PEZI/406-485               ...............................RSKSR........IRT...GAELAA....AG.L....AT.A....A.A..A..G...L..YE..RRKAKQE.Gergvs.........................rslsrSK.SR..S..RS..R.......GGRR..kLD........DDY.E.R-.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------pglveygaqplhsrg..........................................................
A0A072PTE1_9EURO/475-588               .........................rsksrnRSQSK........VR-...---QALp..vVA.A....GL.G....S.A..AlaG...L..YE..KNKAKKE.Aevv............................qkeeRR.AR..S..RS..R.......SRAR...TD........AYY.D.GP.R..-D..A....A..........VSD.PGLi.eYG..N.GPMHGNNFg.............pdYYgr........paPVDNYY...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ntsnavvp.................................................................
F7W3Z0_SORMK/439-491                   ...............................RSKSR........AGS...VAKAAL....GT.A....AA.V....G.V..V..Q...H..IR..HKRSKSR.H...................................-G.SR..S..SS..S.......SSD-...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rsghhskl.................................................................
C1HCJ5_PARBA/521-660                   ...............................RSRSR........TRD...LATAGL....AA.A....GA.G....L.A..A..R...E..YT..QRQERKK.A...................................EK.DR..R..KY..A.......RDHD...YT........DSY.E.EG.Y..DP..V....P..........RVP.SP-...--..-.-PPNGAN-................YY............PHSNHF...P........P.PP.GS.........TPV.......P--.--.-P..N..H.QGGP.....YNPAD...Y..PPS.....PGAP...pMT...QANY.SYp............pPP................PPAADPYSPRSIKGEENV.........................................................................
G7XHH0_ASPKW/557-696                   ...............................KHRSR........SRE...IAEAAL....AA.T....GV.G....Y.A..A..H...K..LS..QRNERKK.A...................................DR.DR..D..RP..E.......SDED..aRR........EPY.D.NP.Y.kTP..L....P..........YPA.TPA...AA..P.RPVDDHQ-................YY............PNGNYF...P........P.PP.AT.........GPR.......---.--.--..-..P.ELAP.....YSPAD...Y..PHP.....PGPV....PP...-QSY.EY..............PS................GPGPDPYAPRPRRADENV.........................................................................
B8NBW3_ASPFN/304-375                   ......................rsrsrshsh-SHSR........ART...LAELGL....GA.A....AI.A....G.A..V..A...L..AR.nKSKDERR.-...................................SR.SR..H..RS..R.......SRHH...R-........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------sssvrsgkttdgekrs.........................................................
A0A0F0I0U5_ASPPA/414-514               ...............................RSHSR........LRK...ALPVIA....AG.L....GT.A....A.A..T..G...L..YE..KHKEKQE.Eg................................eaSR.RR..E..RS..R.......SRSR...--........-AP.S.EI.Y..-P..D....P..........TRD.SAGlieYG..Q.DPVHGRI-................--............PTADY-...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ygrptsqqayysdasdpa.......................................................
M2TBE1_COCSN/345-431                   ...............................RSKSR........ARE...LGTLAA....LA.G....VG.A....L.A..Y..A...A..GQ..RNKAKTK.Eetv............................tiieDR.HR..S..RS..R.......HRSK...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------srhrrgrrksrsvsvvsdrsrsrstskhmdpeh........................................
K9FWG0_PEND2/544-691                   ...............................KHRSR........SRD...LAGAAL....GA.T....GL.G....Y.A..A..H...K..YN..ERRKSK-.-...................................ER.ER..E..HS..K.......HDDN..vHR........DPY.E.ES.Y..DP..E....P..........YPL.SPQ..tAP..G.APPMADTH................YY............PNSNYF...P........P.PP.GD.........STY.......---.-N.LN..G..G.TPVS.....YNPAD...Y..PPP.....PGAA....PP...-QPY.AYg...........aaPPg..............pGPRPEQHAPRPRRADDNV.........................................................................
E5AFM9_LEPMJ/591-752                   ...............................RSKSR........ARS...VAETAA....VA.G....VA.G....L.A..A..H...E..AA..KRRDKKK.A...................................EK.ER..E..RR..R.......EDDS...--........AYS.T.GT.Y..SP..G....S..........YDS.PRS...ST..V.HPNDSR--................FF............PETNYF...P........P.PP.SA.........---.......-PV.DH.AT..T..T.PYPP.....YNPAD...Y..PPP.....PQTA...yEP...QHPS.HFv...........nhPPppphdmnygnpyapppA-----------------pphdpyynharrghpddnv......................................................
A1CSM6_ASPCL/533-664                   ...............................KHRSR........SRE...IAEAAL....AA.T....GV.G....Y.A..A..H...K..LK..QHRDHKK.-...................................-E.ER..E..RS..K.......YEDD...--........---.-.-S.F..SE..P....P..........YPP.SPL..pPA..Q.QPAETQ--................FY............PNTNYF...P........P.PP.GP.........TPV.......---.--.-P..I..A.NNMP.....YNPAD...Y..PPP.....PGAV....PP...AQGY.GY..............PP................ESGPNRYAPRPRRADENV.........................................................................
S3CWZ7_OPHP1/493-635                   ...............................RSHSR........IRT...GAEIAA....-A.G....LA.G....A.A..A..K...K..IY.dKHQDKKE.V...................................ER.DR..E..LN..R.......ELD-...YS........DEY.E.DD.R..GH..H....S..........ARH.STR...SL..S.RSQSR---................SR............SAHPRA...P........Y.PP.ST.........ADA.......---.--.-D..E..L.GLVE.....YGSQP..lY..ADP.....ANSN...aAT...YNRS.SY..............DSa.............adAVDQDDRH----------rrhrrhrsrr...............................................................
V5G1I1_BYSSN/410-507                   ............................ersRSRSR........IRQ...ALPIVA....AG.L....GS.A....A.A..A..G...L..YE..KNKAKKE.N...................................EE.GR..Q..RR..S.......RSRS...R-........SRS.G.TN.-..PD..A....P..........R--.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------dsaglieygdrpvygnipeadyygrptspdgyysda.....................................
H6C6Y6_EXODN/641-795                   .............................ss-RRRS........SRD...AANMAA....AA.G....AG.A....I.A..A..S...E..YE..RRKQEKR.-...................................ER.KA..R..RR..R.......EEEG..yGR........DPY.E.DN.Y.nPA..Q....P..........YPP.TPP..pPA..S.DPYASQQG................FY............PQTSQF...P........P.PP.GS.........VPQq.....yPPQ.QS.TP..S..A.GPPPa...aSYPAQ..sY..PPP.....PPPG....GP...PTTT.PY..............DA...............yGSGANPYAPRG-------penvs....................................................................
A0A0L1J2N0_ASPNO/306-377               ......................rsrsrsrsh-SHSR........ART...LAELGL....GA.A....AI.A....G.A..V..A...L..AR.nKSKDERR.-...................................SR.SR..H..RS..R.......SRHH...RS........S--.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------svrsgrttdgekrs...........................................................
T0KDB4_COLGC/456-503                   .........................rsrsrs-RKSR........SRS...VAKAAA....AT.A....AAaG....L.V..K..H...F..RD..KSKSKSR.-...................................SR.SR..S..KS..-.......----...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------r........................................................................
K2S5L1_MACPH/454-536                   .............................ksRSRSR........IRTgipVAAAGL....G-.-....GA.A....L.AglY..E...K..NA..AKKEDKE.E...................................RK.SR..S..RS..R.......SRSR...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------svpsgsrrasasdpalvvyggdpiyveptas..........................................
H1UXZ2_COLHI/511-639                   ...............................RSKSR........IRT...GAEVVA....AG.L....AG.G....V.A..S..K...I..YK..NRKDKKD.R...................................EV.DR..ElsDQ..E.......YEEE..lRR........ERR.E.RR.R..SR..S....R..........SQA.R-S...LY..P.EPRSADPElg...........lveYGt..........sPLPTDP...P........Y.PP.DD.........GYE.......SAA.NE.RR..R..R.RHRR.....-----...-..---.....----....--...----.--..............--................------------------msgddyddaepak............................................................
A0A063BU25_9HYPO/577-739               ............................rrsRSRSR........LRG...MAEAGA....--.-....-A.A....I.G..I..K...E..FK..DRHDTKH.Kerrer.........................rsrsrSI.DH..H..RR..G.......HDEG...--........SRI.G.DS.R..RD..Y....F..........DDA.VPR...PH..S.PPTASGGA................YY............PPYSPT...P.......gG.PP.MApad..nyvpYPE.......SHG.SA.PL..R..K.EYKP.....YVPQD...Y..TGG.....----....--...----.--..............--................------------------lsawtgsawtspaarrpapdwwesstrsygvn.........................................
M3CFH9_SPHMS/555-643                   .............................rdRSKSR........VRT..gVPIAAA....GL.G....GA.A....L.A..G..-...L..YE..KNKANKE.Akkemv.........................iedelNR.GR..H..RS..R.......SRSR...SR........RPS.M.VA.Y..GD..-....-..........---.---...--..-.EPIEHG--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------drgyysdeepgry............................................................
M2TBE1_COCSN/587-741                   ...............................RSKSR........ARA...VAETAA....VA.G....VA.G....L.A..A..H...E..AT..KRRDRKK.A...................................EK.EA..E..RR..R.......EEDS...--........AYS.T.ST.Y..-D..S....P..........YGS.PT-...-A..S.TAYTNDSR................YF............PETNYF...P........P.PP.NA.........---.......PAI.DP.NA..H..S.PYPP.....YNPAD...Y..PPP.....PNTA...yEP...NHPS.QYi............qPPhsdvhv....gnpyapPQPHDAYYGQPRRTDGNV.........................................................................
A0A0F7TW88_9EURO/493-640               ...............................KHRSR........SRD...LASAAL....GA.T....GL.G....Y.A..A..H...K..YS..QHRDRKK.S...................................ER.SRsrS..RT..R.......YEND..aHR........DPY.E.ES.Y..DP..E....P..........YPI.SPQ..aAH..Q.QPTE---N................YY............PNSNYF...P........P.PP.GS.........TPN.......---.--.-L..N..A.TPQP.....YNPAD...Y..PHP.....PGAA....PP...PQPY.NYga.........gnpGP................ETYPETYAPRPRRADENV.........................................................................
W9WD84_9EURO/379-466                   .............................rhRSRSRses..pskLKT...LGAVGL....GA.A....AL.A....A.A..A..T...I..AT..KRMNKKN.Gdd...............................ddRR.GR..S..HS..R.......SRSR...RR........AES.V.SS.I..EN..D....P..........DAP.SD-...DA..R.NPKH----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------rrnt.....................................................................
Q0C9I2_ASPTN/392-495                   ...........................rkhsRSHSR........LRK...ALPVVA....AG.L....GT.A....A.A..T..G...L..YE..KHKDKKE.E...................................EE.SR..H..RG..R.......RRSR..sRS........RAP.S.DI.Y..-P..D....P..........TRD.SAGlieYG..E.HPVAGS--................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------ipaadyygrpasqqgyysdasd...................................................
A0A074YSE8_AURPU/317-394               ...............................RSRSR........ART...LAKVGT....VA.A....VG.A....L.A..A..Y...A..LR..NRGNKET.Vivnn..........................evpptRR.SR..S..RR..R.......R---...--........---.-.--.-..--..-....-..........---.---...--..-.--------................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------asvgsvpppldarprsrseskhrdp................................................
U7PSX9_SPOS1/723-832                   ........................dfdrdhd-----........---...------....--.-....--.-....-.-..-..-...-..--..RQRDYDH.-...................................DE.DV..N..HH..R.......DDEE...AY........DGY.Y.DD.Y..-D..N....S..........RPP.SP-...--..-.-PHASGGA................FY............P-----...P........A.PP.GGapigttgglMQH......pNTA.TT.NL..N..D.SYAP.....YNPVDysgY..PPP.....PGP-....PP...----.--..............--................------------------trgaadvq.................................................................
A0A094EQ88_9PEZI/1172-1242             ...............................RSRSR........ARD...VLGGAA....AA.T....AA.A....V.G..V..R...K..YK..ARRKRRE.E...................................EA.AR..E..RR..A.......YTPA...-I........TLS.S.TH.L..-P..T....P..........PIS.PP-...--..-.TPF-----................--............------...-........-.--.--.........---.......---.--.--..-..-.----.....-----...-..---.....----....--...----.--..............--................------------------tstht....................................................................
M2MVN7_BAUCO/647-824                   ...............................RRRSR........SRH...LAETGA....AA.G....AA.A....V.A..A..H...E..MG..KRRERSR.-...................................QR.DE..Q..QR..H.......GQEG...YQ........DQY.G.YG.H.dQD.yP....D..........YHS.AQQ..pGG..Y.LPADNAQ-................QY............PNSHYF...P........P.PP.TGe......yaT-A......rGEP.AA.AE..Q..S.PYPA.....YNPAD...Y..AQS....gPQPH....QP...YGQL.HGa...........ynESdan..........lgaPYPNDTFAGD--------trydappaaahhergrgreppenv.................................................
Q4X209_ASPFU/555-690                   ...............................KHRSR........SRE...LAEAAL....AA.T....GV.G....Y.A..A..H...K..YK..QSRDRKK.-...................................-E.ER..E..RS..K.......YDD-...--........DSY.P.SS.Y.pSD..L....P..........YPP.SPL...PP..T.QPGEHP--................YY............PNSNYF...P........P.PP.GS.........TPA.......---.--.-P..P..A.PAAP.....YNPAD...Y..PPP.....PGAV....PP...AQPY.GY..............PP................EPGPDRYAPRPRRADENV.........................................................................
#=GC seq_cons                          ...............................+S+SR........hRs...hAtsuh....uA.u....uu.u....h.A..s..p...t..hp..c++-++c.t...................................c+.pR..p..Rp..c.......pccp.............p...t.pt.h.......................................s..................................................................................................................................................................................................ttt......................................................................
//
DBGET integrated database retrieval system