GenomeNet

Database: Pfam
Entry: DUF3926
LinkDB: DUF3926
Original site: DUF3926 
#=GF ID   DUF3926
#=GF AC   PF13080.1
#=GF DE   Protein of unknown function (DUF3926)
#=GF AU   Mistry J, Aldam G
#=GF SE   Pfam-B_1663 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   26.10 82.60;
#=GF NC   19.10 18.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025076;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria and eukaryotes. Proteins
#=GF CC   in this family are typically between 46 and 63 amino acids in
#=GF CC   length. There is a single completely conserved residue P that
#=GF CC   may be functionally important.
#=GF SQ   78
#=GS A0R916_BACAH/23-66  AC A0R916.1
#=GS C3IE00_BACTU/1-44   AC C3IE00.1
#=GS C3BWW5_BACTU/1-44   AC C3BWW5.1
#=GS C2P9L0_BACCE/1-44   AC C2P9L0.1
#=GS D5TMB6_BACT1/18-61  AC D5TMB6.1
#=GS C2XNN2_BACCE/1-44   AC C2XNN2.1
#=GS B3ZAF9_BACCE/18-61  AC B3ZAF9.1
#=GS F2H3W3_BACTU/18-61  AC F2H3W3.1
#=GS C2UQ43_BACCE/1-44   AC C2UQ43.1
#=GS Q6I499_BACAN/23-66  AC Q6I499.1
#=GS D7WK03_BACCE/18-61  AC D7WK03.1
#=GS B7IUX4_BACC2/18-61  AC B7IUX4.1
#=GS G9QE78_9BACI/18-61  AC G9QE78.1
#=GS B1GM47_BACAN/18-61  AC B1GM47.1
#=GS C3GVQ1_BACTU/1-44   AC C3GVQ1.1
#=GS C2TAW8_BACCE/1-44   AC C2TAW8.1
#=GS C2Z2D5_BACCE/1-44   AC C2Z2D5.1
#=GS B1F4S2_BACAN/18-61  AC B1F4S2.1
#=GS C1EV83_BACC3/18-61  AC C1EV83.1
#=GS B7HSX5_BACC7/18-61  AC B7HSX5.1
#=GS C2ZJ14_BACCE/1-44   AC C2ZJ14.1
#=GS G8UFB3_BACCE/18-61  AC G8UFB3.1
#=GS C3HCZ0_BACTU/1-44   AC C3HCZ0.1
#=GS C2W3C3_BACCE/10-53  AC C2W3C3.1
#=GS Q63GR5_BACCZ/23-66  AC Q63GR5.1
#=GS C3AGR7_BACMY/1-44   AC C3AGR7.1
#=GS B7JMA7_BACC0/18-61  AC B7JMA7.1
#=GS C3L553_BACAC/18-61  AC C3L553.1
#=GS B7H4V7_BACC4/18-61  AC B7H4V7.1
#=GS C2VN86_BACCE/1-44   AC C2VN86.1
#=GS C3CD88_BACTU/1-44   AC C3CD88.1
#=GS Q6HP86_BACHK/23-66  AC Q6HP86.1
#=GS H0NL50_BACCE/18-61  AC H0NL50.1
#=GS C3BF35_9BACI/14-57  AC C3BF35.1
#=GS B3YVG8_BACCE/18-61  AC B3YVG8.1
#=GS C3DEA1_BACTS/1-44   AC C3DEA1.1
#=GS A9VRH2_BACWK/18-61  AC A9VRH2.1
#=GS C3AYN3_BACMY/1-44   AC C3AYN3.1
#=GS C2R2Q2_BACCE/1-44   AC C2R2Q2.1
#=GS C2MFD6_BACCE/1-44   AC C2MFD6.1
#=GS B3ZPX3_BACCE/18-61  AC B3ZPX3.1
#=GS F0PUE2_BACT0/18-61  AC F0PUE2.1
#=GS Q4MIX5_BACCE/18-61  AC Q4MIX5.1
#=GS C3EFD6_BACTK/1-44   AC C3EFD6.1
#=GS C2PQF5_BACCE/1-44   AC C2PQF5.1
#=GS C2X6F1_BACCE/1-44   AC C2X6F1.1
#=GS B5V147_BACCE/18-61  AC B5V147.1
#=GS B9J1M5_BACCQ/18-61  AC B9J1M5.1
#=GS Q3EL33_BACTI/18-61  AC Q3EL33.1
#=GS C3HUW0_BACTU/1-44   AC C3HUW0.1
#=GS Q73EL3_BACC1/18-61  AC Q73EL3.1
#=GS Q81ZF1_BACAN/18-61  AC Q81ZF1.1
#=GS C3PBQ1_BACAA/18-61  AC C3PBQ1.1
#=GS C3GDH1_BACTU/1-44   AC C3GDH1.1
#=GS C3A0L1_BACMY/1-44   AC C3A0L1.1
#=GS B0QIK4_BACAN/18-61  AC B0QIK4.1
#=GS B0AT69_BACAN/18-61  AC B0AT69.1
#=GS C2RHP2_BACCE/1-44   AC C2RHP2.1
#=GS C2SEN7_BACCE/1-44   AC C2SEN7.1
#=GS C2MVQ8_BACCE/1-44   AC C2MVQ8.1
#=GS C3EW92_BACTU/1-44   AC C3EW92.1
#=GS C2QMS3_BACCE/1-43   AC C2QMS3.1
#=GS C2NC83_BACCE/1-44   AC C2NC83.1
#=GS C3FER8_BACTB/1-44   AC C3FER8.1
#=GS C2YLA0_BACCE/10-53  AC C2YLA0.1
#=GS C2NTG2_BACCE/1-44   AC C2NTG2.1
#=GS C2TRY8_BACCE/1-44   AC C2TRY8.1
#=GS B0Q512_BACAN/18-61  AC B0Q512.1
#=GS B1UUA9_BACAN/18-61  AC B1UUA9.1
#=GS I0CWE6_BACAN/1-44   AC I0CWE6.1
#=GS C2WHC3_BACCE/1-44   AC C2WHC3.1
#=GS B3J700_BACAN/18-61  AC B3J700.1
#=GS C3FXQ8_BACTU/1-44   AC C3FXQ8.1
#=GS B5UHE7_BACCE/18-61  AC B5UHE7.1
#=GS D8GYS3_BACAI/18-61  AC D8GYS3.1
#=GS C3CW82_BACTU/1-44   AC C3CW82.1
#=GS C2V6G8_BACCE/1-44   AC C2V6G8.1
#=GS C2RY66_BACCE/3-46   AC C2RY66.1
A0R916_BACAH/23-66             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3IE00_BACTU/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDVNLKNII
C3BWW5_BACTU/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNSNLKSIV
C2P9L0_BACCE/1-44              MNILEELPAPIQQSAKQMLNILQEELAAYVAEQPQPEINLKSII
D5TMB6_BACT1/18-61             MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEVNLKNII
C2XNN2_BACCE/1-44              MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPESNLKSII
B3ZAF9_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
F2H3W3_BACTU/18-61             MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHENNLKNII
C2UQ43_BACCE/1-44              MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHEDNLKSII
Q6I499_BACAN/23-66             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
D7WK03_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
B7IUX4_BACC2/18-61             MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDVNLKNII
G9QE78_9BACI/18-61             MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
B1GM47_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3GVQ1_BACTU/1-44              MHILEELPNPIQQSAKQILNILQEELAAYSIEREHHEVNLKNII
C2TAW8_BACCE/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C2Z2D5_BACCE/1-44              MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPESNLKSII
B1F4S2_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C1EV83_BACC3/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
B7HSX5_BACC7/18-61             MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKNNLKNII
C2ZJ14_BACCE/1-44              MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPESNLKSII
G8UFB3_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3HCZ0_BACTU/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C2W3C3_BACCE/10-53             MYIINELPTPIQQSARKVLNILQEELSSCMQETTHSTTSNLKNI
Q63GR5_BACCZ/23-66             MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNSNLKSIV
C3AGR7_BACMY/1-44              MCIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
B7JMA7_BACC0/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
C3L553_BACAC/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
B7H4V7_BACC4/18-61             MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEVNLKNII
C2VN86_BACCE/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3CD88_BACTU/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHENNLKNII
Q6HP86_BACHK/23-66             MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
H0NL50_BACCE/18-61             MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKNNLKNII
C3BF35_9BACI/14-57             MCIINELPTPIGQQAKKMIHILQEELSACIQEEKQPAEVNLKSI
B3YVG8_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
C3DEA1_BACTS/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDVNLKNII
A9VRH2_BACWK/18-61             MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPESNLKSII
C3AYN3_BACMY/1-44              MCIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
C2R2Q2_BACCE/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEVNLKNII
C2MFD6_BACCE/1-44              MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHREDNLKSII
B3ZPX3_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
F0PUE2_BACT0/18-61             MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHREDNLKSII
Q4MIX5_BACCE/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNSNLKSIV
C3EFD6_BACTK/1-44              MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
C2PQF5_BACCE/1-44              MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPESNLKSII
C2X6F1_BACCE/1-44              MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
B5V147_BACCE/18-61             MHILEELPTPIQQQTQQVLNILQEELSSYAPEQPQHNSNLKSIV
B9J1M5_BACCQ/18-61             MHILEELPTPIQQSAKQMLNILQEELAAYPKEQGHHEDNLKSII
Q3EL33_BACTI/18-61             MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDVNLKNII
C3HUW0_BACTU/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDVNLKNII
Q73EL3_BACC1/18-61             MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKNNLKNII
Q81ZF1_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3PBQ1_BACAA/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3GDH1_BACTU/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKNNLKNII
C3A0L1_BACMY/1-44              MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPESNLKSII
B0QIK4_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
B0AT69_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C2RHP2_BACCE/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEVNLKNII
C2SEN7_BACCE/1-44              MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPESNLKSII
C2MVQ8_BACCE/1-44              MHILEELPNPIQHSAKQILNILQEELAAYPKEQEHHEVNLKNII
C3EW92_BACTU/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C2QMS3_BACCE/1-43              MHILKELPAPIQQSAKQMLNILQEEL-SYATEQPQHNSNLKSIV
C2NC83_BACCE/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3FER8_BACTB/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHENNLKNII
C2YLA0_BACCE/10-53             MNILEELPAPIQQSAKQMLNILQEELAAYPQEQEHHKDTLKSII
C2NTG2_BACCE/1-44              MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
C2TRY8_BACCE/1-44              MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHEDNLKSII
B0Q512_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
B1UUA9_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
I0CWE6_BACAN/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C2WHC3_BACCE/1-44              MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
B3J700_BACAN/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3FXQ8_BACTU/1-44              MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
B5UHE7_BACCE/18-61             MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEVNLKNII
D8GYS3_BACAI/18-61             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKNNLKNII
C3CW82_BACTU/1-44              MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHENNLKNII
C2V6G8_BACCE/1-44              MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHEDNLKSII
C2RY66_BACCE/3-46              MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKNNLKNII
#=GC seq_cons                  MHILEELPsPIQQSAKQhLNILQEELuuYPpEQsHHcsNLKNII
//
DBGET integrated database retrieval system