GenomeNet

Database: Pfam
Entry: DUF3926
LinkDB: DUF3926
Original site: DUF3926 
#=GF ID   DUF3926
#=GF AC   PF13080.2
#=GF DE   Protein of unknown function (DUF3926)
#=GF AU   Mistry J, Aldam G
#=GF SE   Pfam-B_1663 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   66.40 66.10;
#=GF NC   20.90 18.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025076;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria and eukaryotes. Proteins
#=GF CC   in this family are typically between 46 and 63 amino acids in
#=GF CC   length. There is a single completely conserved residue P that
#=GF CC   may be functionally important.
#=GF SQ   197
#=GS C2PQF5_BACCE/1-43       AC C2PQF5.1
#=GS C2MVQ8_BACCE/1-43       AC C2MVQ8.1
#=GS Q6I499_BACAN/23-65      AC Q6I499.1
#=GS S3IPT7_BACCE/18-60      AC S3IPT7.1
#=GS J8GKE8_BACCE/18-60      AC J8GKE8.1
#=GS A0A015QBS7_BACTU/18-60  AC A0A015QBS7.1
#=GS C3BWW5_BACTU/1-43       AC C3BWW5.1
#=GS I0CWE6_BACAN/1-43       AC I0CWE6.1
#=GS C2VN86_BACCE/1-43       AC C2VN86.1
#=GS C1EV83_BACC3/18-60      AC C1EV83.1
#=GS B1GM47_BACAN/18-60      AC B1GM47.1
#=GS R8M9X7_BACCE/18-60      AC R8M9X7.1
#=GS J8J652_BACCE/18-60      AC J8J652.1
#=GS C3FXQ8_BACTU/1-43       AC C3FXQ8.1
#=GS F0PUE2_BACT0/18-60      AC F0PUE2.1
#=GS G8UFB3_BACCE/18-60      AC G8UFB3.1
#=GS C3IE00_BACTU/1-43       AC C3IE00.1
#=GS R8L4A0_BACCE/18-60      AC R8L4A0.1
#=GS C2XNN2_BACCE/1-43       AC C2XNN2.1
#=GS J8ZVN5_BACCE/18-60      AC J8ZVN5.1
#=GS C2Z2D5_BACCE/1-43       AC C2Z2D5.1
#=GS B5UHE7_BACCE/18-60      AC B5UHE7.1
#=GS C2TAW8_BACCE/1-43       AC C2TAW8.1
#=GS R8VQ37_BACCE/18-60      AC R8VQ37.1
#=GS C3A0L1_BACMY/1-43       AC C3A0L1.1
#=GS B0QIK4_BACAN/18-60      AC B0QIK4.1
#=GS J8GBT0_BACCE/18-60      AC J8GBT0.1
#=GS J8BVU1_BACCE/18-60      AC J8BVU1.1
#=GS C2W3C3_BACCE/10-53      AC C2W3C3.1
#=GS R8PS05_BACCE/18-60      AC R8PS05.1
#=GS C3AGR7_BACMY/1-44       AC C3AGR7.1
#=GS J8L283_BACCE/18-60      AC J8L283.1
#=GS W7H7K8_BACAN/18-60      AC W7H7K8.1
#=GS H0NL50_BACCE/18-60      AC H0NL50.1
#=GS M1Q9H8_BACTU/18-60      AC M1Q9H8.1
#=GS R8K600_BACCE/18-60      AC R8K600.1
#=GS A0A011RJD8_BACAN/18-60  AC A0A011RJD8.1
#=GS K4M591_BACTU/18-60      AC K4M591.1
#=GS R8E553_BACCE/18-60      AC R8E553.1
#=GS R8KKP8_BACCE/18-60      AC R8KKP8.1
#=GS J3UNP6_BACTU/18-60      AC J3UNP6.1
#=GS U1XGC1_BACTU/18-60      AC U1XGC1.1
#=GS W7HRP2_BACAN/18-60      AC W7HRP2.1
#=GS J8JBB5_BACCE/18-60      AC J8JBB5.1
#=GS J7WPM8_BACCE/18-60      AC J7WPM8.1
#=GS C3AYN3_BACMY/1-44       AC C3AYN3.1
#=GS C3CW82_BACTU/1-43       AC C3CW82.1
#=GS J7X8R4_BACCE/18-60      AC J7X8R4.1
#=GS J8HMY8_BACCE/18-60      AC J8HMY8.1
#=GS K0FPX1_BACTU/18-60      AC K0FPX1.1
#=GS J6E8B9_BACAN/18-60      AC J6E8B9.1
#=GS J8P8Z2_BACCE/18-60      AC J8P8Z2.1
#=GS R8DIN2_BACCE/18-60      AC R8DIN2.1
#=GS C3DEA1_BACTS/1-43       AC C3DEA1.1
#=GS W7XU73_BACAN/18-60      AC W7XU73.1
#=GS R8JJS7_BACCE/18-60      AC R8JJS7.1
#=GS J8JJ91_BACCE/18-60      AC J8JJ91.1
#=GS J7ZS65_BACCE/18-60      AC J7ZS65.1
#=GS J7ZZQ4_BACCE/18-60      AC J7ZZQ4.1
#=GS V8PUM2_BACTA/18-60      AC V8PUM2.1
#=GS B3YVG8_BACCE/18-60      AC B3YVG8.1
#=GS U5ZTB2_9BACI/18-60      AC U5ZTB2.1
#=GS J8XV50_BACCE/18-60      AC J8XV50.1
#=GS C3CD88_BACTU/1-43       AC C3CD88.1
#=GS R8NM89_BACCE/18-60      AC R8NM89.1
#=GS C2YLA0_BACCE/10-52      AC C2YLA0.1
#=GS J8LKV2_BACCE/18-60      AC J8LKV2.1
#=GS Q81ZF1_BACAN/18-60      AC Q81ZF1.1
#=GS C2R2Q2_BACCE/1-43       AC C2R2Q2.1
#=GS C3PBQ1_BACAA/18-60      AC C3PBQ1.1
#=GS J8H332_BACCE/18-60      AC J8H332.1
#=GS W8Y4S5_BACTU/18-60      AC W8Y4S5.1
#=GS C2ZJ14_BACCE/1-43       AC C2ZJ14.1
#=GS R8G095_BACCE/18-60      AC R8G095.1
#=GS R8GSD1_BACCE/18-60      AC R8GSD1.1
#=GS J8NFS0_BACCE/18-60      AC J8NFS0.1
#=GS J7ZFD5_BACCE/18-60      AC J7ZFD5.1
#=GS C3GDH1_BACTU/1-43       AC C3GDH1.1
#=GS B3ZPX3_BACCE/18-60      AC B3ZPX3.1
#=GS R8XR48_BACCE/18-60      AC R8XR48.1
#=GS R8QSC5_BACCE/18-60      AC R8QSC5.1
#=GS A0A024DI95_BACTK/18-60  AC A0A024DI95.1
#=GS J7ZRL1_BACCE/18-60      AC J7ZRL1.1
#=GS C2X6F1_BACCE/1-43       AC C2X6F1.1
#=GS R8UJF5_BACCE/18-60      AC R8UJF5.1
#=GS R8STZ9_BACCE/18-60      AC R8STZ9.1
#=GS J8PYB9_BACCE/18-60      AC J8PYB9.1
#=GS W4F2Y5_9BACI/18-60      AC W4F2Y5.1
#=GS C2RY66_BACCE/3-45       AC C2RY66.1
#=GS R8T706_BACCE/18-60      AC R8T706.1
#=GS J8EPM7_BACCE/18-60      AC J8EPM7.1
#=GS D8GYS3_BACAI/18-60      AC D8GYS3.1
#=GS C2UQ43_BACCE/1-43       AC C2UQ43.1
#=GS J8ANJ6_BACCE/18-60      AC J8ANJ6.1
#=GS J7VPJ0_BACCE/18-60      AC J7VPJ0.1
#=GS A0A023P0I6_9BACI/18-60  AC A0A023P0I6.1
#=GS J8GZ34_BACCE/18-60      AC J8GZ34.1
#=GS R8PRR6_BACCE/18-61      AC R8PRR6.1
#=GS J3UQJ4_BACTU/18-60      AC J3UQJ4.1
#=GS R8F1L3_BACCE/18-60      AC R8F1L3.1
#=GS J7VAE2_BACCE/18-60      AC J7VAE2.1
#=GS A9VRH2_BACWK/18-60      AC A9VRH2.1
#=GS J8QLM1_BACCE/18-60      AC J8QLM1.1
#=GS B7HSX5_BACC7/18-60      AC B7HSX5.1
#=GS J8LNS2_BACCE/18-60      AC J8LNS2.1
#=GS W0CB93_BACAN/18-60      AC W0CB93.1
#=GS B7H4V7_BACC4/18-60      AC B7H4V7.1
#=GS D5TMB6_BACT1/18-60      AC D5TMB6.1
#=GS R8UBJ2_BACCE/18-60      AC R8UBJ2.1
#=GS C3GVQ1_BACTU/1-43       AC C3GVQ1.1
#=GS A0R916_BACAH/23-65      AC A0R916.1
#=GS J6P4S0_BACAN/18-60      AC J6P4S0.1
#=GS J8WNK9_BACCE/18-60      AC J8WNK9.1
#=GS W0CSX9_BACAN/1-43       AC W0CSX9.1
#=GS J8DFR3_BACCE/18-60      AC J8DFR3.1
#=GS R8H071_BACCE/18-60      AC R8H071.1
#=GS R8C1C7_BACCE/18-60      AC R8C1C7.1
#=GS R8NKV3_BACCE/18-60      AC R8NKV3.1
#=GS C3HCZ0_BACTU/1-43       AC C3HCZ0.1
#=GS R8NGE4_BACCE/18-60      AC R8NGE4.1
#=GS Q3EL33_BACTI/18-60      AC Q3EL33.1
#=GS J8Z960_BACCE/18-60      AC J8Z960.1
#=GS J8FQV6_BACCE/18-60      AC J8FQV6.1
#=GS B7IUX4_BACC2/18-60      AC B7IUX4.1
#=GS R8UDK4_BACCE/18-61      AC R8UDK4.1
#=GS M4L6G3_BACTK/18-60      AC M4L6G3.1
#=GS W8HJL4_BACAN/1-43       AC W8HJL4.1
#=GS J8Q049_BACCE/18-60      AC J8Q049.1
#=GS F2H3W3_BACTU/18-60      AC F2H3W3.1
#=GS J8XYE4_BACCE/18-60      AC J8XYE4.1
#=GS R8MGU8_BACCE/18-60      AC R8MGU8.1
#=GS Q63GR5_BACCZ/23-65      AC Q63GR5.1
#=GS Q6HP86_BACHK/23-65      AC Q6HP86.1
#=GS B7JMA7_BACC0/18-60      AC B7JMA7.1
#=GS C2NTG2_BACCE/1-43       AC C2NTG2.1
#=GS C2QMS3_BACCE/1-42       AC C2QMS3.1
#=GS J7ZHZ9_BACCE/18-60      AC J7ZHZ9.1
#=GS C3L553_BACAC/18-60      AC C3L553.1
#=GS R8FHL2_BACCE/18-60      AC R8FHL2.1
#=GS C3BF35_9BACI/14-57      AC C3BF35.1
#=GS J7XD74_BACCE/18-60      AC J7XD74.1
#=GS C3FER8_BACTB/1-43       AC C3FER8.1
#=GS C3EW92_BACTU/1-43       AC C3EW92.1
#=GS J8NA95_BACCE/18-60      AC J8NA95.1
#=GS C2MFD6_BACCE/1-43       AC C2MFD6.1
#=GS J7T1S3_BACCE/18-60      AC J7T1S3.1
#=GS J8BTC2_BACCE/18-60      AC J8BTC2.1
#=GS J8BGE7_BACCE/18-60      AC J8BGE7.1
#=GS J8N8Z6_BACCE/18-60      AC J8N8Z6.1
#=GS R8CPX7_BACCE/18-60      AC R8CPX7.1
#=GS B3ZAF9_BACCE/18-60      AC B3ZAF9.1
#=GS M4H9C9_BACCE/18-60      AC M4H9C9.1
#=GS J8K8Q0_BACCE/18-60      AC J8K8Q0.1
#=GS J9BN86_BACCE/18-60      AC J9BN86.1
#=GS J8NZM4_BACCE/18-60      AC J8NZM4.1
#=GS G9QE78_9BACI/18-60      AC G9QE78.1
#=GS J7XTT9_BACCE/18-60      AC J7XTT9.1
#=GS C2TRY8_BACCE/1-43       AC C2TRY8.1
#=GS C3EFD6_BACTK/1-43       AC C3EFD6.1
#=GS C3HUW0_BACTU/1-43       AC C3HUW0.1
#=GS V8Q610_BACTA/18-60      AC V8Q610.1
#=GS B0AT69_BACAN/18-60      AC B0AT69.1
#=GS R8QZJ5_BACCE/18-61      AC R8QZJ5.1
#=GS B0Q512_BACAN/18-60      AC B0Q512.1
#=GS D7WK03_BACCE/18-60      AC D7WK03.1
#=GS W4RDB3_9BACI/18-60      AC W4RDB3.1
#=GS B5V147_BACCE/18-60      AC B5V147.1
#=GS J8RD62_BACCE/18-60      AC J8RD62.1
#=GS R8R8E3_BACCE/18-60      AC R8R8E3.1
#=GS R8IC56_BACCE/18-60      AC R8IC56.1
#=GS R8RID2_BACCE/18-60      AC R8RID2.1
#=GS C2RHP2_BACCE/1-43       AC C2RHP2.1
#=GS J8VSZ5_BACCE/18-60      AC J8VSZ5.1
#=GS R8J106_BACCE/18-60      AC R8J106.1
#=GS R8QZE9_BACCE/18-60      AC R8QZE9.1
#=GS Q73EL3_BACC1/18-60      AC Q73EL3.1
#=GS R8CL25_BACCE/18-60      AC R8CL25.1
#=GS J8ER24_BACCE/18-60      AC J8ER24.1
#=GS W7H5G7_BACAN/18-60      AC W7H5G7.1
#=GS J8YL42_BACCE/18-60      AC J8YL42.1
#=GS C2WHC3_BACCE/1-43       AC C2WHC3.1
#=GS V5M4G2_BACTU/18-60      AC V5M4G2.1
#=GS B9J1M5_BACCQ/18-60      AC B9J1M5.1
#=GS Q4MIX5_BACCE/18-60      AC Q4MIX5.1
#=GS R8I7A9_BACCE/18-60      AC R8I7A9.1
#=GS B1UUA9_BACAN/18-60      AC B1UUA9.1
#=GS C2P9L0_BACCE/1-43       AC C2P9L0.1
#=GS B3J700_BACAN/18-60      AC B3J700.1
#=GS C2SEN7_BACCE/1-43       AC C2SEN7.1
#=GS J7XII9_BACCE/18-60      AC J7XII9.1
#=GS C2NC83_BACCE/1-43       AC C2NC83.1
#=GS S3I4Y9_BACCE/18-60      AC S3I4Y9.1
#=GS B1F4S2_BACAN/18-60      AC B1F4S2.1
#=GS J8FKJ1_BACCE/18-60      AC J8FKJ1.1
#=GS J7ZEZ6_BACCE/18-60      AC J7ZEZ6.1
#=GS C2V6G8_BACCE/1-43       AC C2V6G8.1
#=GS A0A011VEK8_BACTI/18-60  AC A0A011VEK8.1
C2PQF5_BACCE/1-43                  MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C2MVQ8_BACCE/1-43                  MHILEELPNPIQHSAKQILNILQEELAAYPKEQEHHEV-NLKNI
Q6I499_BACAN/23-65                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
S3IPT7_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHYEN-NLKNI
J8GKE8_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELASYPKEREHHED-NLKRI
A0A015QBS7_BACTU/18-60             MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C3BWW5_BACTU/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNS-NLKSI
I0CWE6_BACAN/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C2VN86_BACCE/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C1EV83_BACC3/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
B1GM47_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8M9X7_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J8J652_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHRED-NLKSI
C3FXQ8_BACTU/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
F0PUE2_BACT0/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHRED-NLKSI
G8UFB3_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C3IE00_BACTU/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8L4A0_BACCE/18-60                 MLILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKRI
C2XNN2_BACCE/1-43                  MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J8ZVN5_BACCE/18-60                 MLILEELPNPIQQSAKQALNILQEELAAYPKEQEHPED-NLKSI
C2Z2D5_BACCE/1-43                  MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
B5UHE7_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C2TAW8_BACCE/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8VQ37_BACCE/18-60                 MNILEELPTPIQQSAKQILNILQEELATYPKEQEHHED-NLKSI
C3A0L1_BACMY/1-43                  MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
B0QIK4_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8GBT0_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHRED-NLKSI
J8BVU1_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C2W3C3_BACCE/10-53                 MYIINELPTPIQQSARKVLNILQEELSSCMQETTHSTTSNLKNI
R8PS05_BACCE/18-60                 MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
C3AGR7_BACMY/1-44                  MCIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
J8L283_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
W7H7K8_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
H0NL50_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
M1Q9H8_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
R8K600_BACCE/18-60                 MNILEELPTPIQQSAKQILNILQEELATYPKEQEHHED-NLKSI
A0A011RJD8_BACAN/18-60             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
K4M591_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
R8E553_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
R8KKP8_BACCE/18-60                 MHILEELPNPIQQSAKQILNILREELAAYPKEREHHEN-NLKNI
J3UNP6_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
U1XGC1_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
W7HRP2_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8JBB5_BACCE/18-60                 MRILEELPNPIQQSAKQALNILQEELSSYTEEQPHPEG-NLKSI
J7WPM8_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
C3AYN3_BACMY/1-44                  MCIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
C3CW82_BACTU/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
J7X8R4_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
J8HMY8_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYSIEREHHEV-NLKNI
K0FPX1_BACTU/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J6E8B9_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8P8Z2_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
R8DIN2_BACCE/18-60                 MHILEELPNPIQQSAKQILNILREELAAYPKEREHHEN-NLKNI
C3DEA1_BACTS/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
W7XU73_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8JJS7_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
J8JJ91_BACCE/18-60                 MHILDELPNPIQQSAKQILNILQEELTAYPKERDHHEV-NLKNI
J7ZS65_BACCE/18-60                 MRILEELPNPIQQHAKQALNILQEGLSSYAEEQPQPES-NLKSI
J7ZZQ4_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
V8PUM2_BACTA/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
B3YVG8_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
U5ZTB2_9BACI/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J8XV50_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C3CD88_BACTU/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
R8NM89_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
C2YLA0_BACCE/10-52                 MNILEELPAPIQQSAKQMLNILQEELAAYPQEQEHHKD-TLKSI
J8LKV2_BACCE/18-60                 MHILDELPNPIQQSAKQILNILQEELTAYPKERDHHEV-NLKNI
Q81ZF1_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C2R2Q2_BACCE/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
C3PBQ1_BACAA/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8H332_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
W8Y4S5_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C2ZJ14_BACCE/1-43                  MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
R8G095_BACCE/18-60                 MHILEELPNPIQQSAKQILNILREELAAYPKEREHHEN-NLKNI
R8GSD1_BACCE/18-60                 MHILEELPNPIQQSAKQILNILREELAAYPKEREHHEN-NLKNI
J8NFS0_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J7ZFD5_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C3GDH1_BACTU/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
B3ZPX3_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8XR48_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8QSC5_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
A0A024DI95_BACTK/18-60             MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
J7ZRL1_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C2X6F1_BACCE/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
R8UJF5_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
R8STZ9_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
J8PYB9_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
W4F2Y5_9BACI/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C2RY66_BACCE/3-45                  MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
R8T706_BACCE/18-60                 MHILEELPNPIQHSAKQILNILQEELAAYPKEQEHHEV-NLKNI
J8EPM7_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
D8GYS3_BACAI/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C2UQ43_BACCE/1-43                  MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J8ANJ6_BACCE/18-60                 MLILEELPNPIQQSAKKILNILQEELSSYAEEQPQPES-NLKSI
J7VPJ0_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
A0A023P0I6_9BACI/18-60             MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
J8GZ34_BACCE/18-60                 MRILEELPNPIQQHAKQTLNILQEELAAYPKEQEHPED-NLKSI
R8PRR6_BACCE/18-61                 MYIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
J3UQJ4_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8F1L3_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J7VAE2_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
A9VRH2_BACWK/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J8QLM1_BACCE/18-60                 MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
B7HSX5_BACC7/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
J8LNS2_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYSIEREHHEV-NLKNI
W0CB93_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
B7H4V7_BACC4/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
D5TMB6_BACT1/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
R8UBJ2_BACCE/18-60                 MNILEELPTPIQQSAKQILNILQEELATYPKEQEHHED-NLKSI
C3GVQ1_BACTU/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYSIEREHHEV-NLKNI
A0R916_BACAH/23-65                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J6P4S0_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8WNK9_BACCE/18-60                 MNILEELPPPIQQSAKQILNILQEELSSYVAEQPQPES-NLKSI
W0CSX9_BACAN/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8DFR3_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
R8H071_BACCE/18-60                 MLILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
R8C1C7_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8NKV3_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C3HCZ0_BACTU/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8NGE4_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
Q3EL33_BACTI/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
J8Z960_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J8FQV6_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
B7IUX4_BACC2/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8UDK4_BACCE/18-61                 MYIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
M4L6G3_BACTK/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
W8HJL4_BACAN/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8Q049_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHYEN-NLKNI
F2H3W3_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
J8XYE4_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
R8MGU8_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
Q63GR5_BACCZ/23-65                 MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNS-NLKSI
Q6HP86_BACHK/23-65                 MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
B7JMA7_BACC0/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
C2NTG2_BACCE/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C2QMS3_BACCE/1-42                  MHILKELPAPIQQSAKQMLNILQEELS-YATEQPQHNS-NLKSI
J7ZHZ9_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C3L553_BACAC/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8FHL2_BACCE/18-60                 MHILEELPNPIQQSAKQILNILREELAAYPKEREHHEN-NLKNI
C3BF35_9BACI/14-57                 MCIINELPTPIGQQAKKMIHILQEELSACIQEEKQPAEVNLKSI
J7XD74_BACCE/18-60                 MHILEELPTPIQQSAKQMLNILQEELAAYPKEQGHHED-NLKSI
C3FER8_BACTB/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHEN-NLKNI
C3EW92_BACTU/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8NA95_BACCE/18-60                 MNILEELPPPIQQSAKQILNILQEELSSYVAEQPQPES-NLKSI
C2MFD6_BACCE/1-43                  MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHRED-NLKSI
J7T1S3_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J8BTC2_BACCE/18-60                 MHILEELPDPIQQSAKQMLNILQEELATYPKEQEHHEG-NLKSI
J8BGE7_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J8N8Z6_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
R8CPX7_BACCE/18-60                 MRILEELPNPIRQSAKHALNILQEELSSYAEDQPQPES-NLKSI
B3ZAF9_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
M4H9C9_BACCE/18-60                 MHILEELPTPIQQQAQQILNILQEELAAYPKEQGHHKN-NFKNI
J8K8Q0_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
J9BN86_BACCE/18-60                 MRILEELPNPIRQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J8NZM4_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEQTQHKD-NLKSI
G9QE78_9BACI/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
J7XTT9_BACCE/18-60                 MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
C2TRY8_BACCE/1-43                  MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
C3EFD6_BACTK/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C3HUW0_BACTU/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
V8Q610_BACTA/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
B0AT69_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
R8QZJ5_BACCE/18-61                 MYIINELPTPFRQQAKKMINILQEELSSCMQEKKQPTDKSLKNI
B0Q512_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
D7WK03_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPKEQGHHKN-NLKNI
W4RDB3_9BACI/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
B5V147_BACCE/18-60                 MHILEELPTPIQQQTQQVLNILQEELSSYAPEQPQHNS-NLKSI
J8RD62_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEQTQHKD-NLKSI
R8R8E3_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
R8IC56_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
R8RID2_BACCE/18-60                 MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
C2RHP2_BACCE/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYPKERDHHEV-NLKNI
J8VSZ5_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
R8J106_BACCE/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
R8QZE9_BACCE/18-60                 MLILEELPNPIQQSAKRALNILQEELSSYAEEQPQPES-NLKSI
Q73EL3_BACC1/18-60                 MHILEELPAPIQQSAKQILNILQEELAAYPKEQGHHKN-NLKNI
R8CL25_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J8ER24_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
W7H5G7_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8YL42_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
C2WHC3_BACCE/1-43                  MHILEELPNPIQQSAKQILNILQEELAAYLKEREHHEV-NLKNI
V5M4G2_BACTU/18-60                 MHILEELPNPIQQSAKQILNILQDELAAYPKEREHHEN-NLKNI
B9J1M5_BACCQ/18-60                 MHILEELPTPIQQSAKQMLNILQEELAAYPKEQGHHED-NLKSI
Q4MIX5_BACCE/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYATEQPQHNS-NLKSI
R8I7A9_BACCE/18-60                 MRILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKSI
B1UUA9_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C2P9L0_BACCE/1-43                  MNILEELPAPIQQSAKQMLNILQEELAAYVAEQPQPEI-NLKSI
B3J700_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
C2SEN7_BACCE/1-43                  MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
J7XII9_BACCE/18-60                 MNILEELPTPIQQSAKQILNILQEELAAYPKEQEHHED-NLKSI
C2NC83_BACCE/1-43                  MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
S3I4Y9_BACCE/18-60                 MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
B1F4S2_BACAN/18-60                 MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHHKN-NLKNI
J8FKJ1_BACCE/18-60                 MLILEELPNPIQQSAKQALNILQEELSSYAEEQPQPES-NLKRI
J7ZEZ6_BACCE/18-60                 MRILEELPNPIQQSAKHALNILQEELSSYAEEQPQPES-NLKSI
C2V6G8_BACCE/1-43                  MRILEELPTPIQQSAKQMLSILQEELAAYPKEREHHED-NLKSI
A0A011VEK8_BACTI/18-60             MHILEELPNPIQQSAKQILNILQEELAAYPKEREHHDV-NLKNI
#=GC seq_cons                      MHILEELPsPIQQSAKQhLNILQEELuuYPcEptHHEs.NLKNI
//
DBGET integrated database retrieval system