GenomeNet

Database: Pfam
Entry: DUF3926
LinkDB: DUF3926
Original site: DUF3926 
#=GF ID   DUF3926
#=GF AC   PF13080.4
#=GF DE   Protein of unknown function (DUF3926)
#=GF AU   Mistry J, Aldam G
#=GF SE   Pfam-B_1663 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   35.40 61.40;
#=GF NC   18.10 16.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025076;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria and eukaryotes. Proteins
#=GF CC   in this family are typically between 46 and 63 amino acids in
#=GF CC   length. There is a single completely conserved residue P that
#=GF CC   may be functionally important.
#=GF SQ   2
#=GS Q81ZF1_BACAN/18-60  AC Q81ZF1.1
#=GS C2W3C3_BACCE/10-53  AC C2W3C3.1
Q81ZF1_BACAN/18-60             MHILEELPAPIQQSAKQMLNILQEELSSYPNEQGHH.KNNLKNI
C2W3C3_BACCE/10-53             MYIINELPTPIQQSARKVLNILQEELSSCMQETTHStTSNLKNI
#=GC seq_cons                  MaIlpELPsPIQQSA+phLNILQEELSSh.pEpsHp.psNLKNI
//
DBGET integrated database retrieval system