GenomeNet

Database: Pfam
Entry: DUF3960
LinkDB: DUF3960
Original site: DUF3960 
#=GF ID   DUF3960
#=GF AC   PF13142.4
#=GF DE   Domain of unknown function (DUF3960)
#=GF AU   Aldam G, Mistry J
#=GF SE   Pfam-B_1431 (release 24.0)
#=GF GA   22.90 22.90;
#=GF TC   24.00 138.80;
#=GF NC   21.30 22.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025046;
#=GF CC   This presumed domain is functionally uncharacterised. This
#=GF CC   domain family is found in bacteria, and is typically between 72
#=GF CC   and 89 amino acids in length.
#=GF SQ   5
#=GS Q81HR6_BACCR/1-89  AC Q81HR6.1
#=GS C2W4A3_BACCE/1-72  AC C2W4A3.1
#=GS C2WYI2_BACCE/1-89  AC C2WYI2.1
#=GS A7GLE8_BACCN/1-89  AC A7GLE8.1
#=GS Q81UY5_BACAN/1-89  AC Q81UY5.1
Q81HR6_BACCR/1-89             MKAVQGDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTILVWKEKEFYKEENLAAFIVYGMNKAKKLPQFHKDEIPTLVRILRL
C2W4A3_BACCE/1-72             -----------------MEPNNFADLLSLLVPDHPKGEGKERTILAWKEKEFYKQENLAPFILYGMNKVKDLPQFHKDEIPTLVRIVRL
C2WYI2_BACCE/1-89             MRAVQGDPNWNLVTDTYIEPNNFAELLSLLVPCHPKGEGKERTILAWKEKEFYKEENLAAVIVYGMNRVKNLPQFHKDEIPTLVRILRL
A7GLE8_BACCN/1-89             MKAVQGNPNWNLVIDTYVEPKDFADLFSLLVPCRPKGEEKERTLLVWKEKEFYKEENLIPFILYGMNKAKELPQFHKDEIPTLVRIVRL
Q81UY5_BACAN/1-89             MKAVQRDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTILVWKEKEFYKEENLAAFIVYGMNKAKNLPQFHKDEIPTLVRILRL
#=GC seq_cons                 MKAVQGDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTILVWKEKEFYKEENLAAFIVYGMNKAKcLPQFHKDEIPTLVRILRL
//
DBGET integrated database retrieval system