GenomeNet

Database: Pfam
Entry: DUF3977
LinkDB: DUF3977
Original site: DUF3977 
#=GF ID   DUF3977
#=GF AC   PF13122.3
#=GF DE   Protein of unknown function (DUF3977)
#=GF AU   Aldam G, Mistry J
#=GF SE   Pfam-B_1744 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   88.10 87.90;
#=GF NC   16.40 15.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025009;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 80 amino acids in length.
#=GF SQ   4
#=GS Q81PP2_BACAN/1-77      AC Q81PP2.1
#=GS A0A060LY43_9BACI/1-77  AC A0A060LY43.1
#=GS R3WCY4_9ENTE/2-78      AC R3WCY4.1
#=GS Q81CJ6_BACCR/1-77      AC Q81CJ6.1
Q81PP2_BACAN/1-77                 .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
A0A060LY43_9BACI/1-77             .MKYIECGWGNRWLLRTEVEYRDGTEMEYRGWKGPVSVRSLYLRLWVGHTILILDSKEGVKKQQKTQSRFKCVVGLVS
R3WCY4_9ENTE/2-78                 g-KYVEFGIGNTWIVRTEFENKDGTEYEVKGVSGKICIKSVYVRLWMAKKVMIIDSSEGIKFSKKKRNAFKLVFGIHS
Q81CJ6_BACCR/1-77                 .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
#=GC seq_cons                     .MKYIEhGaGNRWhVRTEsENKDGTEaE.RGlhtPIhlcSLYVRhWhtKTsLIlDoKEGhKK.KK+R.caKhlhGIVS
//
DBGET integrated database retrieval system