GenomeNet

Database: Pfam
Entry: DUF3977
LinkDB: DUF3977
Original site: DUF3977 
#=GF ID   DUF3977
#=GF AC   PF13122.1
#=GF DE   Protein of unknown function (DUF3977)
#=GF AU   Aldam G, Mistry J
#=GF SE   Pfam-B_1744 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   61.30 61.20;
#=GF NC   20.00 17.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025009;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 80 amino acids in length.
#=GF SQ   85
#=GS C3E4G3_BACTU/1-77   AC C3E4G3.1
#=GS Q736V7_BACC1/1-77   AC Q736V7.1
#=GS B1ESM4_BACAN/1-77   AC B1ESM4.1
#=GS C2PWE2_BACCE/1-77   AC C2PWE2.1
#=GS C3LGW3_BACAC/1-77   AC C3LGW3.1
#=GS B3J176_BACAN/1-77   AC B3J176.1
#=GS C3HJG7_BACTU/1-34   AC C3HJG7.1
#=GS B0AJZ7_BACAN/1-77   AC B0AJZ7.1
#=GS B5UUU6_BACCE/1-77   AC B5UUU6.1
#=GS C3CJM6_BACTU/1-77   AC C3CJM6.1
#=GS C3F2J8_BACTU/1-77   AC C3F2J8.1
#=GS C3AWS7_BACMY/1-65   AC C3AWS7.1
#=GS B7H9Y0_BACC4/1-77   AC B7H9Y0.1
#=GS C3C3B7_BACTU/1-77   AC C3C3B7.1
#=GS Q81CJ6_BACCR/1-77   AC Q81CJ6.1
#=GS B3ZEZ1_BACCE/1-77   AC B3ZEZ1.1
#=GS C2T1Z0_BACCE/1-77   AC C2T1Z0.1
#=GS C2PFX6_BACCE/1-77   AC C2PFX6.1
#=GS C2R933_BACCE/1-77   AC C2R933.1
#=GS C3D2M6_BACTU/1-77   AC C3D2M6.1
#=GS C3A6T7_BACMY/1-77   AC C3A6T7.1
#=GS A9VHQ2_BACWK/1-77   AC A9VHQ2.1
#=GS C2MLN0_BACCE/1-77   AC C2MLN0.1
#=GS C2UES8_BACCE/1-77   AC C2UES8.1
#=GS Q4MKF9_BACCE/1-77   AC Q4MKF9.1
#=GS C1EWZ3_BACC3/1-77   AC C1EWZ3.1
#=GS Q6HHX1_BACHK/1-77   AC Q6HHX1.1
#=GS C2XV10_BACCE/1-77   AC C2XV10.1
#=GS C3H1V1_BACTU/1-77   AC C3H1V1.1
#=GS B0QC10_BACAN/1-77   AC B0QC10.1
#=GS B7HTJ5_BACC7/1-77   AC B7HTJ5.1
#=GS G9Q7W9_9BACI/1-77   AC G9Q7W9.1
#=GS C2Z8U4_BACCE/1-77   AC C2Z8U4.1
#=GS B7IJI3_BACC2/1-77   AC B7IJI3.1
#=GS E8Q7H3_STRED/2-78   AC E8Q7H3.1
#=GS C3G3V5_BACTU/1-77   AC C3G3V5.1
#=GS C2QCQ9_BACCE/1-77   AC C2QCQ9.1
#=GS C2YBD9_BACCE/1-77   AC C2YBD9.1
#=GS D8H0A8_BACAI/1-77   AC D8H0A8.1
#=GS I0D335_BACAN/1-77   AC I0D335.1
#=GS B1UJ58_BACAN/1-77   AC B1UJ58.1
#=GS C2YSI5_BACCE/1-77   AC C2YSI5.1
#=GS C3BKX5_9BACI/1-77   AC C3BKX5.1
#=GS C2ZQI7_BACCE/1-77   AC C2ZQI7.1
#=GS A6CIL1_9BACI/1-77   AC A6CIL1.1
#=GS C2SL88_BACCE/1-77   AC C2SL88.1
#=GS C3PCA1_BACAA/1-77   AC C3PCA1.1
#=GS C2WNE6_BACCE/1-77   AC C2WNE6.1
#=GS F5U533_STREQ/2-78   AC F5U533.1
#=GS B5V0V2_BACCE/1-77   AC B5V0V2.1
#=GS B9J2Z5_BACCQ/1-77   AC B9J2Z5.1
#=GS D7WJF9_BACCE/1-77   AC D7WJF9.1
#=GS C2TYH5_BACCE/1-77   AC C2TYH5.1
#=GS D5TMU3_BACT1/1-77   AC D5TMU3.1
#=GS C2XCH9_BACCE/1-77   AC C2XCH9.1
#=GS C2UWB0_BACCE/1-77   AC C2UWB0.1
#=GS F9NFG0_STREQ/2-78   AC F9NFG0.1
#=GS C2THJ4_BACCE/1-77   AC C2THJ4.1
#=GS C2W8P1_BACCE/17-93  AC C2W8P1.1
#=GS C3FL44_BACTB/1-77   AC C3FL44.1
#=GS C2NZH7_BACCE/1-77   AC C2NZH7.1
#=GS G8U7X4_BACCE/1-77   AC G8U7X4.1
#=GS C3ELK9_BACTK/1-77   AC C3ELK9.1
#=GS C3B473_BACMY/1-77   AC C3B473.1
#=GS B3ZK73_BACCE/1-77   AC B3ZK73.1
#=GS H0NK32_BACCE/1-77   AC H0NK32.1
#=GS B3YP96_BACCE/1-77   AC B3YP96.1
#=GS F0PTP7_BACT0/1-77   AC F0PTP7.1
#=GS C3IK89_BACTU/1-77   AC C3IK89.1
#=GS C2QU02_BACCE/1-77   AC C2QU02.1
#=GS C2N1U8_BACCE/1-77   AC C2N1U8.1
#=GS E7Q068_STRDY/2-78   AC E7Q068.1
#=GS B1GDU9_BACAN/1-77   AC B1GDU9.1
#=GS C2NIL4_BACCE/1-77   AC C2NIL4.1
#=GS Q63AI4_BACCZ/1-77   AC Q63AI4.1
#=GS C2S4B3_BACCE/1-77   AC C2S4B3.1
#=GS C3GJT4_BACTU/1-77   AC C3GJT4.1
#=GS B7JRM8_BACC0/1-77   AC B7JRM8.1
#=GS B0PYN6_BACAN/1-77   AC B0PYN6.1
#=GS C3DKP3_BACTS/1-77   AC C3DKP3.1
#=GS C2VCU7_BACCE/1-77   AC C2VCU7.1
#=GS F2H388_BACTU/1-77   AC F2H388.1
#=GS C3I1N7_BACTU/1-77   AC C3I1N7.1
#=GS Q81PP2_BACAN/1-77   AC Q81PP2.1
#=GS C2RP27_BACCE/1-77   AC C2RP27.1
C3E4G3_BACTU/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
Q736V7_BACC1/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKVKKRRIDYKFIVGIVS
B1ESM4_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2PWE2_BACCE/1-77              .MKYIEIGIGNRWFIRTETENKDETEFEERGIIKPIYFESLYVRIWFRKTCFIFDMKEGFKKVRKSRAEYKFIVGMVS
C3LGW3_BACAC/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B3J176_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C3HJG7_BACTU/1-34              .-------------------------------------------MWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B0AJZ7_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B5UUU6_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
C3CJM6_BACTU/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKERFKKVKKRRIEYKFIVGIVS
C3F2J8_BACTU/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C3AWS7_BACMY/1-65              .------------MVRTEIEREDGTEFEQKGVVKPIYFESCYLRVWFRKTCLIFDSKEGFKRVKKRRNEYKFILGIVS
B7H9Y0_BACC4/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
C3C3B7_BACTU/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKIKKRRIEYKFIVGIVS
Q81CJ6_BACCR/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
B3ZEZ1_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2T1Z0_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
C2PFX6_BACCE/1-77              .MKYIEIGFGNRWFIRTEIENKDGTECEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVKKRRIEYKFIVGIVS
C2R933_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
C3D2M6_BACTU/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKERFKKVKKRRIEYKFIVGIVS
C3A6T7_BACMY/1-77              .MKYIEIGIGNRWFIRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
A9VHQ2_BACWK/1-77              .MKYIEIGIGNRWFIRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
C2MLN0_BACCE/1-77              .MKYIEIGIGNTWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
C2UES8_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKGRIEYKFIVGIVS
Q4MKF9_BACCE/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
C1EWZ3_BACC3/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKSCFIFDTKEGFKKVKKSRFEYKFIFGIVS
Q6HHX1_BACHK/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2XV10_BACCE/1-77              .MKYIEIGIGNRWFIRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
C3H1V1_BACTU/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
B0QC10_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B7HTJ5_BACC7/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
G9Q7W9_9BACI/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
C2Z8U4_BACCE/1-77              .MKYIEIGIGNRWFIRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
B7IJI3_BACC2/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYLESVYVRIWFRKTCFIFDTKEGFKKDKKRRIEYKFIVGIVS
E8Q7H3_STRED/2-78              t-KYIEIGLGNSWLVRTEYEKDDGTEVEVRGISGAVHPRSIYLRIWLGYTVWILDFKEGFKQQTKSRKSFKCVVGIVS
C3G3V5_BACTU/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2QCQ9_BACCE/1-77              .MKYVEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKVKKRRIEYKFIIGIVS
C2YBD9_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKTKKRRIEYKFIVGIVS
D8H0A8_BACAI/1-77              .MKYIEIGIGNTWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
I0D335_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B1UJ58_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2YSI5_BACCE/1-77              .MKYIEIGIGNRWFVRTETENTDGTEFEERGIIKPIYFESLYVRIWFRKTCLIFDTKEGFKKVSKSRDDYKFIVGIVS
C3BKX5_9BACI/1-77              .MKYIEAGIGNKWLVRTEIEREDGTEFEQKGVVKPIYFESCYLRVWFRKTCLIFDSKEGFKKMRKNRNEYKFILGIVS
C2ZQI7_BACCE/1-77              .MKYIEIGIGNRWFIRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
A6CIL1_9BACI/1-77              .MKYIEFGIGNTWIVRTETELEDGTEYEQKGIIPPIKFRSVYLRIWLLKTVIVMDFKEGFKKMKKNRNAFKLIFGITS
C2SL88_BACCE/1-77              .MKYIEIGIGNRWFIRTETENKVGIEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKVRKSRAEYKFIVGMVS
C3PCA1_BACAA/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2WNE6_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKTKKRRIEYKFIVGIVS
F5U533_STREQ/2-78              t-KYIEIGLGNSWLVRTEYEKDDGTEVEVRGISGAVHPRSIYLRIWLGYTVWILDFKEGFKQQTKSRKSFKCVIGIVS
B5V0V2_BACCE/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
B9J2Z5_BACCQ/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
D7WJF9_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYLESVYIRIWFRKTCFIFDTKEGFKKIKKRRFEYKFIFGIVS
C2TYH5_BACCE/1-77              .MKYIEIGIGNRWFVRTETENTDGTEFEEKGIVRPIYFESFYVRVWFRKMCFIFDTKEGFKKVRKSRAEYKFIIGIVS
D5TMU3_BACT1/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYIRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
C2XCH9_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKTKKRRIEYKFIVGIVS
C2UWB0_BACCE/1-77              .MKYIEIGIGNRWFVRTETENTDGTEFEEKGIVRPIYFESFYVRVWFRKTCFIFDTKEGFKKVRKSRAEYKFIIGIVS
F9NFG0_STREQ/2-78              t-KYIEIGLGNSWLVRTEYEKDDGTEVEVRGISGAVHPRSIYLRIWLGYTVWILDFKEGFKQQTKSRKSFKCVVGIVS
C2THJ4_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2W8P1_BACCE/17-93             .VKYIEVGIGNKWFIRTETEREDGTEFEQKGIVKPIYFESLYVRVWFRKICFILDSKEGFKKVQKKRSEYKFIFGVVS
C3FL44_BACTB/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKERFKKVKKRRIEYKFIVGIVS
C2NZH7_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
G8U7X4_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKSCFIFDTKEGFKKVKKSRFEYKFIFGIVS
C3ELK9_BACTK/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKTKKRRIEYKFIVGIVS
C3B473_BACMY/1-77              .MKYIEAGIGNKWLVRTEIEREDGTEFEQKGVVKPIYFESCYLRVWFRKTCLIFDSKEGFKKMRKNRNEYKFILGIVS
B3ZK73_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKSCFIFDTKEGFKKVKKSRFEYKFIFGIVS
H0NK32_BACCE/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
B3YP96_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
F0PTP7_BACT0/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C3IK89_BACTU/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYLESVYVRIWFRKTCFIFDTKEGFKKDKKRRIEYKFIVGIVS
C2QU02_BACCE/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
C2N1U8_BACCE/1-77              .MKYIEIGIGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKTCFIFDTKEGFKKDKKRRVEYKFIVGIVS
E7Q068_STRDY/2-78              t-KYIEIGLGNSWLVRTEYEKDDGTEVEVRGISGAVHPRSIYLRIWLGYTVWILDFKEGFKQQTKSRKSFKCVVGIVS
B1GDU9_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2NIL4_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRIWFRKSCFIFDTKEGFKKVKKSRFEYKFIFGIVS
Q63AI4_BACCZ/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2S4B3_BACCE/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKEGFKKVKKRRIEYKFIVGIVS
C3GJT4_BACTU/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B7JRM8_BACC0/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
B0PYN6_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C3DKP3_BACTS/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYLESVYVRIWFRKTCFIFDTKEGFKKDKKRRIEYKFIVGIVS
C2VCU7_BACCE/1-77              .MKYIEIGIGNRWFVRTETENTDGTEFEEKGIVRPIYFESFYVRVWFRKMCFIFDTKEGFKKVRKSRAEYKFIIGIVS
F2H388_BACTU/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRVWFRKTCLIFDTKERFKKVKKRRIEYKFIVGIVS
C3I1N7_BACTU/1-77              .MKYIEIGIGNKWFVRTETENKDGTEFEERGIIKPIYLESIYVRIWFRKTCFIFDTKEGFKKDKKRRIEYKFIVGIVS
Q81PP2_BACAN/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYLESLYVRMWFRKTCLILDTKEGFKKVKKRRIEYKFIFGIVS
C2RP27_BACCE/1-77              .MKYIEIGFGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRMWFRKTCLIFDTKEGFKKIKKKRIEYKFIVGIVS
#=GC seq_cons                  .MKYIEIGhGNRWFVRTETENKDGTEFEERGIIKPIYFESLYVRlWFRKTChIFDTKEGFKKVKKRRIEYKFIlGIVS
//
DBGET integrated database retrieval system