GenomeNet

Database: Pfam
Entry: DUF3982
LinkDB: DUF3982
Original site: DUF3982 
#=GF ID   DUF3982
#=GF AC   PF13138.4
#=GF DE   Protein of unknown function (DUF3982)
#=GF AU   Aldam G, Mistry J
#=GF SE   Pfam-B_2022 (release 24.0)
#=GF GA   18.10 18.10;
#=GF TC   18.10 93.20;
#=GF NC   17.60 17.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025042;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are typically between 47 and 73 amino acids in length. There are
#=GF CC   two conserved sequence motifs: EKL and EIP.
#=GF SQ   1
#=GS C2WAK8_BACCE/19-53  AC C2WAK8.1
C2WAK8_BACCE/19-53             AFAEKLSAGMLPLMEMPKPKGADPENIVEAEKSMT
#=GC seq_cons                  AFAEKLSAGMLPLMEMPKPKGADPENIVEAEKSMT
//
DBGET integrated database retrieval system