GenomeNet

Database: Pfam
Entry: DUF3982
LinkDB: DUF3982
Original site: DUF3982 
#=GF ID   DUF3982
#=GF AC   PF13138.1
#=GF DE   Protein of unknown function (DUF3982)
#=GF AU   Aldam G, Mistry J
#=GF SE   Pfam-B_2022 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   34.50 33.60;
#=GF NC   19.40 17.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025042;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are typically between 47 and 73 amino acids in length. There are
#=GF CC   two conserved sequence motifs: EKL and EIP.
#=GF SQ   72
#=GS C2TUV4_BACCE/1-43  AC C2TUV4.1
#=GS C2XXG7_BACCE/1-73  AC C2XXG7.1
#=GS C2WR91_BACCE/1-73  AC C2WR91.1
#=GS C2Z5G1_BACCE/1-43  AC C2Z5G1.1
#=GS C3DHE9_BACTS/1-68  AC C3DHE9.1
#=GS C2PCH6_BACCE/1-62  AC C2PCH6.1
#=GS C2SNK5_BACCE/1-73  AC C2SNK5.1
#=GS C3I5B5_BACTU/1-73  AC C3I5B5.1
#=GS C2PZN0_BACCE/1-73  AC C2PZN0.1
#=GS C3G6L4_BACTU/1-43  AC C3G6L4.1
#=GS C2XRJ3_BACCE/1-68  AC C2XRJ3.1
#=GS C3G0I2_BACTU/1-43  AC C3G0I2.1
#=GS C2YP79_BACCE/1-23  AC C2YP79.1
#=GS C3B6D2_BACMY/1-35  AC C3B6D2.1
#=GS C2TE37_BACCE/1-23  AC C2TE37.1
#=GS C2TE36_BACCE/1-43  AC C2TE36.1
#=GS C3DN90_BACTS/1-73  AC C3DN90.1
#=GS C2QWN3_BACCE/1-73  AC C2QWN3.1
#=GS C3GMG6_BACTU/1-59  AC C3GMG6.1
#=GS C2PIM0_BACCE/1-73  AC C2PIM0.1
#=GS C3ANX5_BACMY/1-35  AC C3ANX5.1
#=GS C2NLA5_BACCE/1-71  AC C2NLA5.1
#=GS Q4MK72_BACCE/1-68  AC Q4MK72.1
#=GS C3BNB7_9BACI/1-35  AC C3BNB7.1
#=GS C2UYU8_BACCE/1-54  AC C2UYU8.1
#=GS C2XF69_BACCE/1-73  AC C2XF69.1
#=GS C2YUZ2_BACCE/1-73  AC C2YUZ2.1
#=GS C2VR85_BACCE/1-43  AC C2VR85.1
#=GS Q4MJX5_BACCE/1-73  AC Q4MJX5.1
#=GS C3F5B7_BACTU/1-59  AC C3F5B7.1
#=GS F0PNN8_BACT0/1-71  AC F0PNN8.1
#=GS C2NF63_BACCE/1-43  AC C2NF63.1
#=GS C3EP23_BACTK/1-73  AC C3EP23.1
#=GS C3EZ61_BACTU/1-43  AC C3EZ61.1
#=GS C3EZ62_BACTU/1-23  AC C3EZ62.1
#=GS C3H4M2_BACTU/1-73  AC C3H4M2.1
#=GS B7ISQ7_BACC2/1-73  AC B7ISQ7.1
#=GS C2USX8_BACCE/1-23  AC C2USX8.1
#=GS C2S153_BACCE/1-23  AC C2S153.1
#=GS C3HXZ4_BACTU/1-68  AC C3HXZ4.1
#=GS C2U1B2_BACCE/1-73  AC C2U1B2.1
#=GS C2YP78_BACCE/1-43  AC C2YP78.1
#=GS C3HFU8_BACTU/1-23  AC C3HFU8.1
#=GS C2USX7_BACCE/1-43  AC C2USX7.1
#=GS C2TUV5_BACCE/1-23  AC C2TUV5.1
#=GS C2VXB8_BACCE/1-59  AC C2VXB8.1
#=GS C3E144_BACTU/1-68  AC C3E144.1
#=GS C2V9C5_BACCE/1-43  AC C2V9C5.1
#=GS C2P255_BACCE/1-73  AC C2P255.1
#=GS C2ZM28_BACCE/1-23  AC C2ZM28.1
#=GS C3HM69_BACTU/1-59  AC C3HM69.1
#=GS C3A993_BACMY/1-73  AC C3A993.1
#=GS C3HFU7_BACTU/1-43  AC C3HFU7.1
#=GS C2ZM27_BACCE/1-43  AC C2ZM27.1
#=GS C2S152_BACCE/1-37  AC C2S152.1
#=GS C3BZW3_BACTU/1-62  AC C3BZW3.1
#=GS C3IMR9_BACTU/1-73  AC C3IMR9.1
#=GS C3G0I3_BACTU/1-23  AC C3G0I3.1
#=GS C2VR86_BACCE/1-23  AC C2VR86.1
#=GS C2NF64_BACCE/1-23  AC C2NF64.1
#=GS B7IP35_BACC2/1-68  AC B7IP35.1
#=GS B5VCT0_BACCE/1-73  AC B5VCT0.1
#=GS C2UHI0_BACCE/1-73  AC C2UHI0.1
#=GS C2V9C6_BACCE/1-23  AC C2V9C6.1
#=GS C2WAK8_BACCE/1-53  AC C2WAK8.1
#=GS C2QFJ4_BACCE/1-73  AC C2QFJ4.1
#=GS C2VFC5_BACCE/1-73  AC C2VFC5.1
#=GS C2ZB93_BACCE/1-73  AC C2ZB93.1
#=GS C3IH15_BACTU/1-68  AC C3IH15.1
#=GS C2TK34_BACCE/1-59  AC C2TK34.1
#=GS C3C6A1_BACTU/1-73  AC C3C6A1.1
#=GS C2Z5G2_BACCE/1-23  AC C2Z5G2.1
C2TUV4_BACCE/1-43             m------LGIEIVFAVGCTAIVVPVCKVTIVEKETALLITLVEKLRVGG-------------------------
C2XXG7_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIRFEEKLSVATAPLIEIPTPSGAHPGAVVEIDTLIT
C2WR91_BACCE/1-73             .MLVFPVAGIVISLSVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2Z5G1_BACCE/1-43             m------LGIEIVIAVGCTAIVVPACKVTIVEKETALPITLVEKLRVGG-------------------------
C3DHE9_BACTS/1-68             m------LGIEIVFAVGCTEIVVPACKVTIVEKETALPITLVEKLRVGGWPLNEIPNPNGEEPGKVVDAEKLIS
C2PCH6_BACCE/1-62             m------------FAVGCTAIVVPACKVTIVEKETALPITLVEKLRLGGWPLNEIPNPNGEDPGKVVDAEKLIS
C2SNK5_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIRFEEKLSVATAPLIEIPTPSGAHPGAVVEIDTLIT
C3I5B5_BACTU/1-73             .MLVFPVAGIVISLRVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2PZN0_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIRFEEKLSVATAPLIEIPTPSGAHPGAVVEIDTLIT
C3G6L4_BACTU/1-43             m-------------------------------NESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C2XRJ3_BACCE/1-68             m------FGIEIVFAVGCTDIVVPAVKVIIVEKETALPITLVEKLRLGGWPLNERPKPNGEEPGKVVDAEKLIS
C3G0I2_BACTU/1-43             m------LGIEIVFAVGCTEIVVPASKVTIVENETALPITLVEKLRVGG-------------------------
C2YP79_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C3B6D2_BACMY/1-35             m---------------------------------------FAEKLSEGMLPLMEIPKPKGADPENIVEAEKSMT
C2TE37_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C2TE36_BACCE/1-43             m------LGIEIVFAVGCTEIVVPASKVTIVENDTALPITLVEKLRVGG-------------------------
C3DN90_BACTS/1-73             .MLVFPVAGIVISLRVDWTEILAPATNVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2QWN3_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C3GMG6_BACTU/1-59             m---------------DWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C2PIM0_BACCE/1-73             .MLVFPVSGIVISLRVGLTEMFAPAANVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C3ANX5_BACMY/1-35             m---------------------------------------FAEKLSEGMLPLMEIPKPKGADPENIVEAEKSMT
C2NLA5_BACCE/1-71             m---FPVAGIVISLRVDWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
Q4MK72_BACCE/1-68             m------FGIEIVFAVGCTEIVVPACKVTIVENDTALPITLVEKLRVGGWPLNEIPNPNGEDPGKVVDAEKLIS
C3BNB7_9BACI/1-35             m---------------------------------------FAEKLSEGMLPLMEIPKPKGADPENIVEAEKSMT
C2UYU8_BACCE/1-54             .-------------------MFAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVAMDTLIT
C2XF69_BACCE/1-73             .MLVFPVAGIVISLSVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2YUZ2_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPALNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEIDTLMT
C2VR85_BACCE/1-43             m------LGIEIVFAVGCIEIVVPACKVTIVEKETALPITLVEKLRVGG-------------------------
Q4MJX5_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPALNVSIVVNESESPIRFEEKLSVATAPLIEMPTPSGAHPGAVVEMDTLIT
C3F5B7_BACTU/1-59             m---------------DWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
F0PNN8_BACT0/1-71             m---FPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIKFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLIT
C2NF63_BACCE/1-43             m------LGIEIVFAVGCTEIVVPACKVTIVENDTALPITLVEKLRVGG-------------------------
C3EP23_BACTK/1-73             .MLVFPVAGIVISLSVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C3EZ61_BACTU/1-43             m------LGIEIVFAVGCTEIVVPASKVTIVENDTALPITLVEKLRVGG-------------------------
C3EZ62_BACTU/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C3H4M2_BACTU/1-73             .MLVFPVAGIVISLRVDWTEILASAANVSIVVNESESPIKFEEKLSVATAPLIEMPTPRGAHPGAVVEIDTLIT
B7ISQ7_BACC2/1-73             .MLVFPVAGIVISLRVDWTEILAPATNVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2USX8_BACCE/1-23             .--------------------------------------------------MKEIPNPNGEEPGKVVDAEKLIS
C2S153_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C3HXZ4_BACTU/1-68             m------LGIEIVFAVGCTEIVVPACKVTIVEKETALPITLVEKLRVGGWPLNEIPNPNGEGPGKVVDAEKLIS
C2U1B2_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIKLEEKLSVATAPLIEIPTPSGAHPGAVVAMDTLIT
C2YP78_BACCE/1-43             m------LGIEIVFAVGCIEIVVPACKVTIVENETALPITLVEKLRVGG-------------------------
C3HFU8_BACTU/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C2USX7_BACCE/1-43             m------LGIEIVFAVGCTAIVVPVCKVTIVEKETALLITLVEKLRVGG-------------------------
C2TUV5_BACCE/1-23             .--------------------------------------------------MKEIPNPNGEEPGKVVDAEKLIS
C2VXB8_BACCE/1-59             m---------------DWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C3E144_BACTU/1-68             m------LGIEIVFAVGCTEIVVPACKVTIVENDTALPITLVEKLRVGGWPLNEIPNPNGEEPGKVVDAEKLIS
C2V9C5_BACCE/1-43             m------LGIEIVFAVGCTAIVVPVCKVTIVEKETALLITLVEKLRVGG-------------------------
C2P255_BACCE/1-73             .MLVFPVAGIVISLSVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2ZM28_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEEPGKVVDAEKLIS
C3HM69_BACTU/1-59             m---------------DWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C3A993_BACMY/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIRFEEKLSVATAPLIEIPTPSGAHPGAVVEIDTLIT
C3HFU7_BACTU/1-43             m------LGIEIVFAVGCTEIVVPASKVTIVENDTALPITLVEKLRVGG-------------------------
C2ZM27_BACCE/1-43             m------LGIEIVIAVGCTAIVVPACKVTIVEKETALPITLVEKLRVGG-------------------------
C2S152_BACCE/1-37             m------------FAVGCIEIVVPACKVTIVEKETALPITLVEKLRVGG-------------------------
C3BZW3_BACTU/1-62             m------------FAVGCTEIVVPACKVTIVENDTALPITLVEKLRVGGWPLNEIPNPNGEDPGKVVDAEKLIS
C3IMR9_BACTU/1-73             .MLVFPVAGIVISLRVDWTEILAPATNVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C3G0I3_BACTU/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C2VR86_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEDPGKVVDAEKLIS
C2NF64_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEEPGKVVDAEKLIS
B7IP35_BACC2/1-68             m------LGIEIVFAVGCTEIVVPACKVTIVEKETALLITLVEKLRVGGWPLNEIPNPNGEEPGKVVDAEKLIS
B5VCT0_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIKFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLIT
C2UHI0_BACCE/1-73             .MLVFPVAGIVISLRVDWTEILAPAANVSIVVNESESPIKFEEKLSVATAPLIEIPTPSGAHPGAVVEMDTLIT
C2V9C6_BACCE/1-23             .--------------------------------------------------MKEIPNPNGEEPGKVVDAEKLIS
C2WAK8_BACCE/1-53             m---------------------VLAFKVSIVVNVIELPIAFAEKLSAGMLPLMEMPKPKGADPENIVEAEKSMT
C2QFJ4_BACCE/1-73             .MLVLPVLGIVISLRVDLTEIFAPAANVSIVVNASESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLIT
C2VFC5_BACCE/1-73             .MLVFPVAGIVISLRVDWTEMFAPAANVSIVVNESESPIKLEEKLSVATAPLIEIPTPSGAHPGAVVAMDTLIT
C2ZB93_BACCE/1-73             .MLVFPVAGTVISLRVDWTEMFAPAANVSIVVNESESPMRFEEKLSVATAPLIEIPTPSGAHPGAVVEIDTLIT
C3IH15_BACTU/1-68             m------LGIEIVFAVGCTEIVVPACKVTIVEKETALPITLVEKLRVSGWPLNEIPNPNGEEPGKVVDAEKLIS
C2TK34_BACCE/1-59             m---------------DWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C3C6A1_BACTU/1-73             .MLVFPVAGIVISLRVDWTEMFAPAVNVSIVVNESESPIRFEEKLSVATAPFIEIPTPSGAHPGAVVEMDTLMT
C2Z5G2_BACCE/1-23             .--------------------------------------------------MNEIPNPNGEEPGKVVDAEKLIS
#=GC seq_cons                 .......hGI.IshtVshTEhhsPAspVoIV.pEot.PIph.EKLpVushPh.EIPsPsGtcPGtVV-h-pLIo
//
DBGET integrated database retrieval system