GenomeNet

Database: Pfam
Entry: DUF4427
LinkDB: DUF4427
Original site: DUF4427 
#=GF ID   DUF4427
#=GF AC   PF14468.3
#=GF DE   Protein of unknown function (DUF4427)
#=GF AU   Godzik A
#=GF SE   PSYMP_19184 [Pseudomonas syringae pv. morsprunorum str. M302280PT]
#=GF GA   22.70 22.70;
#=GF TC   24.30 226.60;
#=GF NC   18.00 17.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR025216;
#=GF CC   This domain is often found at the C-terminal of proteins with 
#=GF CC   Pfam:PF10899 domain, for instance in STY1911 protein from a 
#=GF CC   multiple drug resistant Salmonella enterica serovar Typhi CT18.
#=GF SQ   2
#=GS Q8ZP29_SALTY/284-415  AC Q8ZP29.1
#=GS D3RQN5_ALLVD/288-416  AC D3RQN5.1
Q8ZP29_SALTY/284-415             LSASKVKNYADSINDYVSELYSKKDFLNDSYAMEFGNAWVWIHDNQSQVVRALLQAGMIKVNKEGRYLLDVNLASVDWPLRRKEAFASHVAGWLKHRFDIEAGRYSVRGKDDYDAIPSYETPLKDQHPFYNH
D3RQN5_ALLVD/288-416             LSEGAIVKIDSRFTEMILQVESAK---SNAPILERGGVWLWILDNTHDLTRSLLARRRVSVSRDGRYLAKLPEFGSRRDLRQRETMAKELARLVTQEFGLECGYFSLLGSEDYDDVPFYNGNHLENRMFYNV
#=GC seq_cons                    LStutlhphssphs-hl.pl.StK...ssu.hhEhGssWlWIhDNppplsRuLLttthlpVs+-GRYLhcls.huschsLRp+EshApclAthlppcFslEsGhaSlhGp-DYDslP.Ypsshh-p+.FYNh
//
DBGET integrated database retrieval system