GenomeNet

Database: Pfam
Entry: DUF4552
LinkDB: DUF4552
Original site: DUF4552 
#=GF ID   DUF4552
#=GF AC   PF15089.1
#=GF DE   Domain of unknown function (DUF4552)
#=GF AU   Bateman A
#=GF SE   Jackhmmer:Q86WS4
#=GF GA   27.00 27.00;
#=GF TC   150.10 149.90;
#=GF NC   22.70 21.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in vertebrates. Proteins in this
#=GF CC   family are typically between 425 and 649 amino acids in length.
#=GF SQ   29
#=GS G1PAW5_MYOLU/228-647  AC G1PAW5.1
#=GS G1S8I0_NOMLE/229-652  AC G1S8I0.1
#=GS F1SHQ0_PIG/228-649    AC F1SHQ0.1
#=GS F8VQ66_MOUSE/219-643  AC F8VQ66.1
#=GS F6SX71_CALJA/174-422  AC F6SX71.1
#=GS H0WHQ7_OTOGA/239-649  AC H0WHQ7.1
#=GS F1LTS3_RAT/218-649    AC F1LTS3.1
#=GS CL040_HUMAN/229-652   AC Q86WS4.3
#=GS F6SXV9_CALJA/152-361  AC F6SXV9.1
#=GS F1MF23_BOVIN/229-647  AC F1MF23.2
#=GS G3SSJ1_LOXAF/223-646  AC G3SSJ1.1
#=GS G7N6P8_MACMU/229-652  AC G7N6P8.1
#=GS G7PHL6_MACFA/229-652  AC G7PHL6.1
#=GS H2Q5Q2_PANTR/152-361  AC H2Q5Q2.1
#=GS H2NGZ2_PONAB/229-652  AC H2NGZ2.1
#=GS F6WPL0_ORNAN/1-363    AC F6WPL0.1
#=GS F6T0N0_MACMU/176-599  AC F6T0N0.1
#=GS F1PF60_CANFA/6-430    AC F1PF60.1
#=GS G3IFZ7_CRIGR/1-120    AC G3IFZ7.1
#=GS F6SXB1_CALJA/229-646  AC F6SXB1.1
#=GS H2Q5Q1_PANTR/229-652  AC H2Q5Q1.1
#=GS G1MBC8_AILME/6-432    AC G1MBC8.1
#=GS G1SM94_RABIT/224-638  AC G1SM94.1
#=GS G5BHF9_HETGA/230-650  AC G5BHF9.1
#=GS H0UYW4_CAVPO/222-641  AC H0UYW4.1
#=GS F6T0M1_MACMU/153-363  AC F6T0M1.1
#=GS G3QT29_GORGO/229-652  AC G3QT29.1
#=GS D2HTG0_AILME/1-425    AC D2HTG0.1
#=GS H9H040_HORSE/220-420  AC H9H040.1
G1PAW5_MYOLU/228-647             ...SPGNRNFLAGSP.AIVMGEDCGSMDERRHSDFITEKQSVQHIWGENKEEVSNFLEDVSQPTPSLLPENFDSFINENAINLLSIDQQRITKPFENCGYDSMG----VTNSDKNHSSDRCI---FRNPGLN.FSSSNFNKTSYSEKCQPKRNYQKEYNNNEGNNPSTSFEKNCYPASAEKK.GKFEKDYQKKKPQIEI..QKYPVNNMKSIPLEKLNSKKSWDFGLSE....NLIEEGGTCSINGA.PKSTKKNfnNNDSSQSSLSSSYSPRATD.SCFSSSSEMPSDDEDQT...LQKIEDSSRRSIKTEETTN.....NFYLERM...AEFPRDRIVKNNDKIHKQTESFHQVSMKSNTDQSAQSPYNSTHVLQNQTSNNCTVQFVRCDAWVQTESEPIMKERLDAAIQCDIISQCKCRS.......NESSLCNVERCSENIKADTTGGQEILKNN..........
G1S8I0_NOMLE/229-652             ...SLGNRNLLTESP.AVIMDEDCRSMDEIRQSDYITEKHSIQHIWGKNGKEVPNFLEDVKQSTPNLLSENCDSFVSQNMINVLNIDQQRIKKTFNKCDYDSMGDTCVVTSSDKNYVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNKNERNDLTTSFENDYYPSSSERK.GKLENDYQEKTPQKSI..QKYPANTMGSIPSEELYSKQSWDLGLDE....ILMEEGGICSLKGR.PTSTEKI..SLDSTQSSRSTSYSPRPTD.SCFSSSSDLSSEDEDQI...SQQIEDSNRIPIKTKEKMN.....NFYVERM...AKLSGDRIVKNNNKIHKQNENFYQFSVKNNTDQFPQLQCNSAHILQNKTNDNCILQAARCDAGVQTESESVMEKKLDAAIQCDLISKCTCRS.......DVS-LCNLEKCSGNIKADTTGGQEIFKNN..........
F1SHQ0_PIG/228-649               ...SLGNKTFLTRRA.AVVMDEDCGSIDERRQSDFIPEKKSLQRIWGENRKEISN--EDVNQQIPSLLSENCDSFFSKNMINLLNIDQQKIKKTFDKCDYDTMEGICTVISSDKNHFTDRCIRSIFTDPELN.FSNSTFNKSSYPENCQPNKNCQNEY-NNERNNFSTSFEKDHYPASSDKK.GKFENDYQDKTPQKKIpqKKYSVNHTSNIPLEELHSKQSWDFGLGE....ILMKEGGMFSLKGG.ATSAKKT..YLDSSQSSQTTSYSPMPTD.SCFSSSSEMPSEDEDQI...LHQIEDSNRTSIKIKETTN.....NVYLESMgsmGKLPCDRIIKNNARFHKQNENFHQFSMKNNTDESPQSPYNSACILQNTANNDCILQLTRCDAWVQTESESVIEEKLDIAIQCDIISKCKCGN.......-----IDVEKCNENIKSDTTGGQEILKNS..........
F8VQ66_MOUSE/219-643             ...SSETGDFLTKRS.-MIMGEDCRSLYERRQPDFAMEKPLVQQIYANNGEEFSNFLEDVIHPTQRHLPDNHNSFVSHSMIDLLSKDQPGRRATFTKCGYDSLSDTH-VVSSDESHSSSGLINGEFTVPQAT.SPNFPFN-TSYTETCQPNRPCQ-EYNSNEINEFRRSFEKDCYSIGCGRK.GKIESDKQLKELQRNA..RKHPVYTMADIPLEELHCKQSCDFDQNE....IPMERRGMCPLKGQ.PMSTEKI..YLESSQSSQSASYSPRPTE.STFSSSTDLISEDEDQI...QQQTEDSNK---KATETTG.....NCCLEKM...ENHFDDITVKDDATAHKQNHKCLQSSEKNNADAFPESQCNSEHTVQNKSTDNCVLQAGRCDVGVQTEEAPLVGNTADVAVQCTIITRCSCMSspvlireKESSHPEAGSCTEDRTADTTGGQETPTSN..........
F6SX71_CALJA/174-422             ...SPGNRNLLTKRP.AVIMDEDCRSMNERRQSDYITEKHSIQHICGENRKEALHFLEDVNQSIPNLLSENCDPFVSQNMINLLNIDQQRLKKSFNKCDYDSMGDICVVTSSEKNDFSDRCLRNIFTVPELT.FSNSTLNKTSYPEKYQPNKNYQKEYNNNERNDLSTSIEKDYYPASSERK.GKLENDYKEKTSQKSI..QKYPVNSMRNIPSEEMHSKQSWDFGLDK....ILLEEGRICSLKSR.PTSTEKI..C------------------.-----------------...-------------------.....-------...--------------------------------------------------------------------------------------------.......-----------------------------qynsis....
H0WHQ7_OTOGA/239-649             ...SPGNRTFLAKRP.AIILGEDCGNM-----VDFIAGHQSVQHLWEESGKEVSNFLDDLNQPTPSFLSEKCDSFVSQNMINLLSIDQQRIKKTFDECDYDSMGDVC--------VATDKCSRDIFTAPEFT.FSNSTFNSTSYPGKHQLNKNNQNEYNSNERNDLSTSFEKHYYPTNSEEKeEKLENEYQEKILKENI..QNYPLNSMSNIPLEELNSKQSWDFGGGE....VNLVEGGICSLKGM.PTSTKKI..RLCSSQSSQSTSYSPRTTD.SYFSSSSEMVSEEEDQV...PQKMEDSNRIFIETREATN.....NFDLERM...EKLSKDRIVKNNAKMDKRAKNFPQFSMKKDRDQSSQSQCDSAHALQSKTNE-HILQVASCDAGVQTESAPVVEEKLDAAVQCDIISKCACSS.......DVS-LCNKEMCSENIKADTTGGQEIPTNN..........
F1LTS3_RAT/218-649               ...SSETGDFLTESQiSVMMGDECGILYERRQPDFAVVKTSVPQIGANSGEEFSHFLEDGIHPTQRHLPDHHDSFINHNMINLLSRDQPGRRATFNQCGYDCLSDAH-VVSSDESQSTNGFIPRNFTVPRAA.SPNRPFS-ASYIETCQSNRPCQKQYTNNERNELRRSLEKDCYPVSCGRR.GKIESNNQLKTLQRNS..QESPVYTMAEIPLEELHHKQSCDFGQNEnfvlLMPVERRTGPLKGR.PVPAEKI..YLESSQSSQSTSYSPRPTD.STFSSSSELLSEDEDQN...QQQIEHSNK---KATETTD.....HGGLEKV...EGHLGDITVKDNAKVHRENHKSHQSSEKDNSDTFPESQCNSEHTPQNKSTANCVLRAGRCDVGVQTEEAPLVGSRADVAVQCTIIAPCSCKSspsvdteEESSLSKAGSCTEDMMSDTTGGQETPTDN..........
CL040_HUMAN/229-652              ...SLGNRNLLTKSP.AVIMDEDCRSTDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVSQNMINVLNIDEQRIKKTFNKCDYDSMGDTCVVTSSDKNHVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNKNERNDLSTSFENDYYPSSSERK.EKFENDYQEKTPQKSI..QKYPANSMGNIPSEELHSKQSWDFGLDE....ILMEEGGIYSLKSK.RISTKKI..SLDSAQSSRSTSYSPRPTD.SCFSSSSDLPSEDEDQI...SQQIEDSNRMTIKTKEKMN.....NFYVERM...AKLSGDRIVKNDDKIHKQNENFYQFSVKNNTDQFPQLQCNSAHILQNKTNDNCVLQAARCDAGIQTESESVMEEKLDVAIQCDLISKCTCRS.......DVS-LCNLERCSGNIKADTTGGQEIHKNN..........
F6SXV9_CALJA/152-361             ...SPGNRNLLTKRP.AVIMDEDCRSMNERRQSDYITEKHSIQHICGENRKEALHFLEDVNQSIPNLLSENCDPFVSQNMINLLNIDQQRLKKSFNKCDYDSMGDICVVTSSEKNDFSDRCLRNIFTVPELT.FSNSTLNKTSYPEKYQPNKNYQKEYNNNERNDLSTSIEKDYYPASSERK.GKLENDYKEKTSQKSI..QKYPVNSI--------------------....--------------.-------..-------------------.-----------------...-------------------.....-------...--------------------------------------------------------------------------------------------.......-----------------------------wytkcsefk.
F1MF23_BOVIN/229-647             ...SPGNRKFLTRTP.TVVVGEDCGSMDERRQSHFITENNSLQHIWKENRKKFSN--EDMNQQTSSLLSDNCDSFISENMINLLNIDQQKIKETFDKYGYDNTRDTYAVIDSDKNHFKDSHIKSIFTDLELG.FSNSTFKISSHSEKCQPNKICQKEYKNNERNNFSTSFEKDFYSASSNEK.GKFENDYQEKIYQEKT..QKYQVNHIDNIPLEELHSEQSWDFGVGE....ILI-EGGMCSLKDG.TTSTKKT..YLHSSRSSQSSSYSPRPTDsSCFNSSSEMLSEDEDQT...----EDSNRRSIKTKETAN.....NFYLENM...EKFPCDKVINNNAKFHKQNENFNQFSVNNNIHQFPESQCNSAHILQSKTSNNCILQVAKCDAWVQTESELIMEEKLDAAIQCDIISKCKCRN.......DVSSFCNVERYNENVKADTTGGQEILRNN..........
G3SSJ1_LOXAF/223-646             ...SPGNRNFLTERP.AVIMGEDCGSMNERRESDFVTEKQTVQPFRGENRKAVLNCIEDANQAIPSSLSENCNSFFSQNMINLLNLDQQRIKENTDKCGCDS-GDICAVTSSSKKYFTDRCLRSIFTVPELT.YSNSTFNKTSNPEKCQPKNGYQKKYINNEGNNFSTSFEKHCYPASSEKT.GKYESNYQKKIPQKKI..QKYPVNNMGNIPLEELHSEQSWDMGLGE....TLMEERGACSLKSS.RTSTKKI..YLDSSQSSQSTGYSPRQTD.SSYSSSSEMPSEDEDQV...LPQSEDSNRRFIETKETTN.....NVYLNRM...SKLSDDRIIKNNASIHKQNEISPQFSKKNNSDQFSQSQHNSAYILQNKTNNNCILQAAKCDAWVQTESEHAIEEKLDAAIQCDIISKCKCRS.......DVSSLSNAERCSGNIKAETTGGQEILKNS..........
G7N6P8_MACMU/229-652             ...SLGNRNLLTKCP.TVIMDEDCRSMDEIGQSDYITEKHSIQHIWRKNGKKVSNFLEDVNQSTPNFLSENSDSFVSQNMINVLNIDQQKIKKTFNKCDYDSMGDICVATHSDKNRVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKNQREYNKNERNDLSTSFXXXYYPSSSERK.GKLENDYQERTPQKSI..QKYPANSMGNILSEELHYKQSWDFGLDE....ILMEEGGICSLKSR.PTSTEKI..SLDSAQSSWSTSYSPRPTD.SCFSSSSDVPSEDEDQI...SQHIEDSNRMPIKTKEKTN.....NFYVEGM...AKVSGDRIVKNNDKIHKQNENFYQFSVKNNTDQFPQSQCNSAHILQNKTSDNCILQPARCDAGVQTESESVMEEKLDAAIQCDLISKCTCRS.......DVS-LCNLERCSENTKTDTTGGQEILKNN..........
G7PHL6_MACFA/229-652             ...SLGNRNLLTKCP.TVIMDEDCRSMDEIGQSDYITEKHSIQHIWRKNGKKVSNFLEDVNQSTPNFLSENSDSFVSQNMINVLNIDQQKIKKTFNKCDYDSMGDICVATHSDKNRVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKNQREYNKNERNDLSTSFENDYYPSSSERK.GKLENDYQERTPQKSI..QKYPANSMGNIPSEELHYKQSWDFGLDE....ILMEEGGICSLKSR.PTSTEKI..SLDSAQSSWSTSYSPRPTD.SCFSSSSDVPSEDEDQI...SQHIEDSNRMPIKTKEKTN.....NFYVEGM...AKVSGDRIVKNNDKIHKQNENFYQFSVKNNTDQFPQSQCNSAHILQNKTSDNCILQPARCDAGVQTESESVMEEKLDAAIQCDLISKCTCRS.......DVS-LCNLERCSENIKTDTTGGQEILKNN..........
H2Q5Q2_PANTR/152-361             ...SLGNRNLLTKSP.AVIMDEDCRSTDEIRQSDYITEKHSVQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVSQNMINVLNIDQQRIKKTFNKCDYDSMGDTCVVTSSDKNHVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNKNERNDLSTSFENDYYPSSSERK.EKFENDYQEKTPQKSI..QKYPANSV--------------------....--------------.-------..-------------------.-----------------...-------------------.....-------...--------------------------------------------------------------------------------------------.......-----------------------------wctkcsefk.
H2NGZ2_PONAB/229-652             ...SLGNRNLLTKSP.AVIMDEDCRSMDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVSQNMINVLNIDQQRIKKIFNKCDYDSMGDTCVVTSSDKNHVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNRNERNDLSTSFENDYYPSSSERK.GKLENDYQEKIPQKSI..QKYPANSMGNIPSEELHSKQSRDFGLDE....ILMEEGGIYSLKSR.PTSTEKI..SLDSAQSSRSTSYSPRPTD.SCFSSSSDLPSEDEDQI...SQQIEDSNRMTIKTKEKMN.....NFYVERM...AKLSGDRIVKNNDKIHKQNENFYQFSVKNNTDQFPQSQCNSAHILQNKTNDNCILQATRCDAGIQTDSESIMEEKLDAAIQCDLISKCTCRS.......DVS-LCDLERCSGNIKADTTGGQEILKNN..........
F6WPL0_ORNAN/1-363               fyk------------.------------------------------------------AENQSVHSILSKDVHPFVDKESTSFLRTDQQDVNLIFDNRSSSDTKNTH---KFQENSSVDRNLKSVFTVPDQTfFGNSGIPSKNYNENNQLNNNPWREYSSHQRNDYSASFENQYDPVMSGKR.RTLENYGETLESSKKI..QNYPNKHIGNLFLRESLHKSPQDLGFSQ....SLMREEEKDELEASpKIMNDKI..GCDSSPSSQSPSYSPRQTE.SFFSSSPVMPSEEEDLV...-LPIEDPES----EKKWKN.....ETFSNSK...PSASCEESIKRGVKGHEQSDNFYTSG-----DNSGLSQCNSRANFRKRNNKHCYHPIGQRDAWSQTEERSVPEGKSDVAVQCDMMQEREERN.......HLFPLKSARGVPENTKVDTTRRQEIPSE-e.........
F6T0N0_MACMU/176-599             ...SLGNRNLLTKCP.TVIMDEDCRSMDEIGQSDYITEKHSIQHIWRKNGKKVSNFLEDVNQSTPNFLSENSDSFVSQNMINVLNIDQQKIKKTFNKCDYDSMGDICVATHSDKNRVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKNQREYNKNERNDLSTSFENDYYPSSSERK.GKLENDYQERTPQKSI..QKYPANSMGNIPSEELHYKQSWDFGLDE....ILMEEGGICSLKSR.PTSTEKI..SLDSAQSSWSTSYSPRPTD.SCFSSSSDVPSEDEDQI...SQHIEDSNRMPIKTKEKTN.....NFYVEGM...AKVSGDRIVKNNDKIHKQNENFYQFSVKNNTDQFPQSQCNSAHILQNKTSDNCILQPARCDAGVQTESESVMEEKLDAAIQCDLISKCTCRS.......DVS-LCNLERCSENTKTDTTGGQEILKNN..........
F1PF60_CANFA/6-430               ...SPGNCSFLTGRS.VVVMGEECGSMDEQRQSDFITEKQSAQHIWGENRREASHFLEDVNQSKAHLISENYDSFISENIINLLSIDQQRIRKTFDKCDCDSMGDASAITSSDKNDSTDRCIRSIFTDPELT.FSNSTFNKTSYPEKYQPSK-YQKEYNNNERNILSTSFEKDCYVASSEKK.GKFESDYQEKIPQNES..QKYPVKHMGDISLEELHSKQSWDFGFGE....ILMEGGGTSSLKDR.PTSTKIC.hYLDSSQSSQSTYYSPRPTD.SCFSSSSEMPSEDEDQI...LQQIEESNRRSIRIKETTN.....NFYPEGM...PKLPHGSIIRNNTKNQNQNENLHHFSMKNNTDQFPQSQCNSTHILQNKTSDNCILQVARCDAWVQTDSEPVMEEKLDAAVQCDIISKCKCRS.......NVSPLCNVERCSENVNADTTGGQETLKNN..........
G3IFZ7_CRIGR/1-120               ...------------.--------------------------------------------------------------------------------------------------------------------.-------------------------------------------------.----------------..----------------------------....--------------.-------..-------------------.-----------------...-------------------.....-------...-------MVKDNVKIHKQKDNFPQSSVK-NTDTFPVSQYNSGHISQNKTSNDCVLQAGRCDLGVQTENELLMGTTADVAIQCTIISQCSCKRspdvpvtEVPSLHKAASCSDAITAHTTGGQETLADN..........
F6SXB1_CALJA/229-646             ...SPGNRNLLTKRP.AVIMDEDCRSMNERRQSDYITEKHSIQHICGENRKEALHFLEDVNQSIPNLLSENCDPFVSQNMINLLNIDQQRLKKSFNKCDYDSMGDICVVTSSEKNDFSDRCLRNIFTVPELT.FSNSTLNKTSYPEKYQPNKNYQKEYNNNERNDLSTSIEKDYYPASSERK.GKLENDYKEKTSQKSI..QKYPVNSMRNIPSEEMHSKQSWDFGLDK....ILLEEGRICSLKSR.PTSTEKI..SLDSAQSNRSTSYSPRPTD.SCFSSSSDLLSEDEDQI...SQQIENSNRMPIKTKETENvermeTENVERM...EKLSGDRIVKNNDKIHKQNENFHQFS-----------QCNSAHILQNKTNTNCILQVARRDVGVQTESESVVREKLDAAIQCNLISKCTCRS.......DVS-LCNLERCSESIKADTTGGQEILKN-k.........
H2Q5Q1_PANTR/229-652             ...SLGNRNLLTKSP.AVIMDEDCRSTDEIRQSDYITEKHSVQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVSQNMINVLNIDQQRIKKTFNKCDYDSMGDTCVVTSSDKNHVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNKNERNDLSTSFENDYYPSSSERK.EKFENDYQEKTPQKSI..QKYPANSVGNIPSEELHSKQSWDFGLDE....ILMEEGGIYSLKSR.PTSTKKI..SLDSAQSSRSTSYSPRPTD.SCFSSSSDLPSEDEDQI...SQQIEDSNRMTIKTKEKMN.....NFYVERM...AKLSGDRIVKNDDKIHKQNENFYQFSVKNNTDQFPQLQCNSAHILQNKTNDNCVLQAARCDAGIQTESESVMEEKLDAAIQCDLISKCTCRS.......DVS-LCNLERCSGNIKADTTGGQEIHKNN..........
G1MBC8_AILME/6-432               ...SPGNRNFLTGRP.VVVMGEECGSMDEQRQSDFITEKQSVQHIWGENRREVSNFLEDVNQPKASLISENCNSFISENVINLLNIDQQRIKKTFDKCGYDSMGDICATTSSDKNDSTDRCIRSIFTYPELT.LSNSTFNKTTYPEKCQPNKRYQKEYHNNERNTLSTSFEKDCYAPSSEKK.GKFGSDYQEKTPHNGS..QKYPVNHMGNISLEELHLKQPWDFGLGE....ILMEEGGTCSLKDR.PTSAKNIcqYLDSSQSSQSTSYSPRPTD.SCFSSSSEMLSEDEEQI...LQQIEESNRKSIRIKETTN.....NFYLERM...PKLSCGRIIKNNAKIHKQSENLHQFSMKNNTDKFLQCQCNSAYILQNKTSNNYIPQVARCDAWVQTDSEPITEEKLDAAIQCDIISECKCRS.......DVSPLCNIGRCSENIKADTTGGQEILKNN..........
G1SM94_RABIT/224-638             ...SPGNGNLVTERS.ALITGEERGCMNERRQSHLIAEKQSVQHTWGKNGKELSPFLGVVNQPAPVLLSENCDPFVSQNMINLLSIDQQKMSEMFGKCRHDGVGDTCVIAGSDQNPSADRGIRSIFTVPELP.LSKSTFHKTSYPEKGQAREHFWKEYSDNRVSDLCMPFEKNCYPPSSEKQ.GKLGNDCQGKMPQKSI..QRHAENSVRKIPLEELPSEQPRDFQHSQ....ILMEERGIDSLQDR.PTSVKKI..YLDS--SSQSSSYSPRPTD.SCFSSSSEMPSEEEDQM...LQQMEDSNMISIKPKETSN.....NYFPGEV...AELSRDEVVK--AEVDKLNENFHPFLVKH-TEESLLSRCSSAPVLLSVTNGNSFVQVARCDAEVQTENELELQGKTDAAIQCDRISACACGR.......NLSPLC-----SANTAADTTGGQRILNN-s.........
G5BHF9_HETGA/230-650             ..n-PENEDFLATRP.GVTSGEDWRSMNE-RQSDFIIEKQVAQRTWGENGKEISTFLKDVNQPAHSILSENCDSFVGQNMINLLSIDQQVIQKTFDKSSYDSLGNACLVTNSDENHSTGVCIGSIFTVSEST.CSNSAFNKTSCPEKCQPVKHNQKEHNSNEIRDLST-F-EDCYPASYENR.GKHENGFQEKTSQKNI..QEDPVNSMCNSHLAELHPNQSWDIGLDE....ILM-EGGTCSLKGR.PTFTKKI..YLDSSQGSQCTSYSPRPTE.SCFSSSSEMPSENEEQIlktQDQSEASNEISTKTTGTNN.....NFYLESM...AELSDNSIDNSNAKFHKQNEKFYQYS--DNTNQFLQSQCDSAHALKSKAS-NCILQVVKCDTGVQTDREPVMEEKLDAAIQCDILWKCACGR.......DVSSLRSVEGYTESITVDTTGGQDILKNN..........
H0UYW4_CAVPO/222-641             ..n-PGNGSFLTRRP.GIPLGEDWKSMNE-RQSDFVFEKQAAQRIWGQSWEEISNFFEDVNQATHSILSENCGSYVDQNMINLLSIDQQMMQKTFDKCIYDNLGNTCLVTNFGENQPTDGCVRSIFTVPEST.FTDPAFNKTSCPEKYQPNKKYQREHNSNEIHDLRIFLE-DSYPASYEKQ.AGKHNDYHEKMPQKNN..QENPVNSVCKSPLEGIHANQLGDFGLGE....VMM-EKGTCSLKGS.QISKLRI..YLESSQGSQCSSYSPRPTE.SCFSSSSEMLSEDEDQI...LQQTEDSSKMSTKTTETSN.....NFYLENK...VELPDNKIVNKNAKFHKQNEKFHQYSVKNSAVKFPQSQCNLAHA-ENKT-SNCIMQVVKCDTGVQTETASVMQEKLDAAIQCDILSECACGR.......DLSSLGSGERCTQSIMSDTTGGQDILTN-r.........
F6T0M1_MACMU/153-363             ...SLGNRNLLTKCP.TVIMDEDCRSMDEIGQSDYITEKHSIQHIWRKNGKKVSNFLEDVNQSTPNFLSENSDSFVSQNMINVLNIDQQKIKKTFNKCDYDSMGDICVATHSDKNRVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKNQREYNKNERNDLSTSFENDYYPSSSERK.GKLENDYQERTPQKSI..QKYPANSI--------------------....--------------.-------..-------------------.-----------------...-------------------.....-------...--------------------------------------------------------------------------------------------.......-----------------------------wctkcsefke
G3QT29_GORGO/229-652             ...SLGNRNLLTKSP.AVIMDEDCRSTDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVSQNMINVLNIDQQRIKKTFNKCDYDSMGNTCVVTSSDKNHVTDRCIRNIFTVPELT.FSNSTLNKTSYPEKCQPNKKYQREYNKNERNDLSTSFENDYYPSSSERK.EKFENDYQEKTPQKSI..QKYPANSMGNIPSEELHSKQSWDFGLDE....ILMEDGGIYSLKSR.PTSTKKI..SLDSAQSSRSTSYSPRPTD.SCFSSSSDLPSEDEDQI...SQQIEDSNRMTIKTEEKMN.....NFYVERM...AKLSGDRIVKNNDKIHKQNENFYQFSVKNYTDQFPQSQCNSAHILQNKTNDNCILQAARCDAGIQTESESVLEEKLDAAIQCDLISKCTCRS.......DLS-LCNLERCSGNIKADTTGGQEIHKNN..........
D2HTG0_AILME/1-425               ...SPGNRNFLTGRP.VVVMGEECGSMDEQRQSDFITEKQSVQHIWGENRREVSNFLEDVNQPKASLISENCNSFISENVINLLNIDQQRIKKTFDKCGYDSMGDICATTSSDKNDSTDRCIRSIFTYPELT.LSNSTFNKTTYPEKCQPNKRYQKEYHNNERNTLSTSFEKDCYAPSSEKK.GKFGSDYQEKTPHNGS..QKYPVNHMGNISLEELHLKQPWDFGLGE....ILMEEGGTCSLKDR.PTSAKNI..YLDSSQSSQSTSYSPRPTD.SCFSSSSEMLSEDEEQI...LQQIEESNRKSIRIKETTN.....NFYLERM...PKLSCGRIIKNNAKIHKQSENLHQFSMKNNTDKFLQCQCNSAYILQNKTSNNYIPQVARCDAWVQTDSEPITEEKLDAAIQCDIISECKCRS.......DVSPLCNIGRCSENIKADTTGGQEILKNN..........
H9H040_HORSE/220-420             ...SPGNRNFLTERP.DIVTGEDCGTMDERRQSDFIIEKQSVQHILEENRKEISSFLEDANQPTPSLLSENCDSFISENVINLLNIDQWSIKKTFDKCGFDSMGDICAVTSSDKNHSTERCIRSTFTNPELT.FSNSTFNKTCYPEKRQSNKNYQKEYNDYEKNNLSTSFEKDSFPASSEKK.GKFESDYQEKAPQKTI..QIYPVNR---------------------....--------------.-------..-------------------.-----------------...-------------------.....-------...--------------------------------------------------------------------------------------------.......-----------------------------l.........
#=GC seq_cons                    ...S.GNRNhLTcpP.sVlMsEDCtSMsEhRQSDaITEKpSlQHIWGcNtKElSNFLEDVNQssPslLSENCDSFVSQNMINlLNIDQQ+IKKTFsKCsYDSMGDhCsVTuSDKNcsTDRCIRsIFTVPELT.FSNSThNKTSYPEKCQPNKphQ+EYNsNERNDLSTSFEpDhYPuSSE+K.GKhENDYQEKsPQKsI..QKYPsNoMssIP.EELHtKQSWDFGlsE....ILMcEGGhsSLKup.PTSscKI...LDSuQSSpSoSYSPRPTD.SCFSSSS-h.SEDEDQl....QphE-SN+hsI+scEptN.....NhalEpM...sclss-cIlKsNsKhHKQNENFaQaShKsNoDpFspSQCNSAHlLQNKTssNClLQsuRCDAhVQTEoEslhcEKLDAAIQCDlIScCpC+s.......-lS.LsshcpCotNlpuDTTGGQEIhpNN..........
//
DBGET integrated database retrieval system