GenomeNet

Database: Pfam
Entry: DUF4593
LinkDB: DUF4593
Original site: DUF4593 
  All links  
No link information was found.   
#=GF ID   DUF4593
#=GF AC   PF15263.1
#=GF DE   Domain of unknown function (DUF4593)
#=GF AU   Eberhardt RY, Coggill P, Hetherington K
#=GF SE   Jackhmmer:Q6ZR54
#=GF GA   27.00 27.00;
#=GF TC   279.40 279.10;
#=GF NC   21.20 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF CC   This protein family is a putative uncharacterised protein
#=GF CC   family. Its existence is uncertain and its precise function is
#=GF CC   unknown. This family of proteins is thought to be found in
#=GF CC   eukaryotes. Proteins in this family are estimated to be around
#=GF CC   155 amino acids in length.
#=GF SQ   2
#=GS F1S8N2_PIG/1-155    AC F1S8N2.1
#=GS YN009_HUMAN/36-191  AC Q6ZR54.1
F1S8N2_PIG/1-155               GHLLSDLGPSTLPYLQGGGGCTPRPLAPGGQQPPPPPRAHMGP-EAGSAASPSPPSLPPTRGVQIKSHFTHVAPDASLGGPGLPGRSGPCGPRSSPNQVPSGQETGAGGGPQTPALTLPCSLVRSRGIKKGRSHLGENLGCVGEARGCFALLPWGQ
YN009_HUMAN/36-191             GTLLANAGPSTVPVTPTAGSCQPSPLSPGGSDPPPPPRAHVSPQEAPLGQVPGAEWLPPTRGLLCKDVSSSPGPSFHLGGPGLPGHAGPCGPRARPAQGLAGRGGNVGEGSESPLGTLPCSVPASQQLLRGRSHLQGSLAALGEARGGGAAFSWGQ
#=GC seq_cons                  GpLLushGPSTlPhh.suGuCpPpPLuPGGppPPPPPRAHhuP.EAs.utsPus..LPPTRGl.hKsh.opsuPshpLGGPGLPG+uGPCGPRupPsQs.uGptsssGtGspoPhhTLPCSlstSptlh+GRSHLttsLuslGEARGshAhhsWGQ
//
DBGET integrated database retrieval system