GenomeNet

Database: Pfam
Entry: DUF643
LinkDB: DUF643
Original site: DUF643 
#=GF ID   DUF643
#=GF AC   PF04867.9
#=GF DE   Protein of unknown function (DUF643)
#=GF AU   Kerrison ND
#=GF SE   Pfam-B_6086 (release 7.6)
#=GF GA   25.00 25.00;
#=GF TC   26.60 150.70;
#=GF NC   23.60 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR006951;
#=GF CC   Protein of unknown function found in Borrelia burgdorferi, the
#=GF CC   Lyme disease spirochete.
#=GF SQ   5
#=GS Q9S059_BORBU/3-111  AC Q9S059.2
#=GS Q9S033_BORBU/3-116  AC Q9S033.2
#=GS Q9RZY2_BORBU/4-112  AC Q9RZY2.2
#=GS Q9S0D8_BORBU/3-116  AC Q9S0D8.2
#=GS Q9S0J1_BORBU/3-111  AC Q9S0J1.2
Q9S059_BORBU/3-111             INEISDFYDNLYKKTKKEidklINKLYLTSQITLKQKRQIYSAVEKMQKYVIKTGKSV------FLESEKEFVKDTLKRKNLTKKF---QSFKVDFSYKEGMLEKCLERLGEDKSIEF
Q9S033_BORBU/3-116             TNEISNFYDNLSEDLKKS....INKLYETEQATQEQKSQMYSSYKAAQEYGIKTGKSTEEIINDIIDPTKKIIKDVLKNKYLIQKYKNSKNMQVDYSDKKGMLKKCLKKLGEYDSMIF
Q9RZY2_BORBU/4-112             TNEISDFDDNLYKKTKKEidklINKLYLTSQITLKQKRQIYSAVERMQKYVIKTGKSV------LLESEKEFVKDTLKRKNLIKKF---KSFKVDFSYKERMLEKCLERLGEDKSIEF
Q9S0D8_BORBU/3-116             INEISDFYDCLSPGTKKE....ISKLYGVKQLTLEQKKDFYRGFVSIQEYKRKTGKSIDEIINGIINPAKNFIKDVLKDKHIIEKYKNFQNMKFDCSYKKGMLEKCLKKMGEKYSDRF
Q9S0J1_BORBU/3-111             INEISDFYDNLYKRTKKEidklINKLYLTSQITLKQKRQIYSAVEKMQKYVIKTGKSV------FLESEKEFVKDTLKRKNLTKKF---QSFKVDFSYKEGMLEKCLERLGEDKSIEF
#=GC seq_cons                  INEISDFYDNLYK+TKKEIDKLINKLYLTSQITLKQKRQIYSAVE+MQKYVIKTGKSV......lLESEKEFVKDTLKRKNLIKKF...QSFKVDFSYKEGMLEKCLERLGEDKSIEF
//
DBGET integrated database retrieval system