GenomeNet

Database: Pfam
Entry: DUF682
LinkDB: DUF682
Original site: DUF682 
#=GF ID   DUF682
#=GF AC   PF05081.10
#=GF DE   Protein of unknown function (DUF682)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_6152 (release 7.7)
#=GF GA   25.00 25.00;
#=GF TC   44.80 283.10;
#=GF NC   20.90 18.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR007773;
#=GF CC   This family consists if several uncharacterised baculovirus
#=GF CC   proteins.
#=GF SQ   2
#=GS Q8B9G5_NPVR1/5-157  AC Q8B9G5.1
#=GS Q91EW3_GVCPM/3-155  AC Q91EW3.1
Q8B9G5_NPVR1/5-157             KTIVLYLCQAPATASLYVSADTDADEPIIYFENITECLTDDQCDKFTYFAELKQEQALFMKKVYKHLVLKNEGAFNKNHVLFDAMIMYKTYVQLVD--ESAFGSNVINYCEQFITAIFEIFTLSSKIVVAV--PVNWENDNLSVLLKHLHNLNLIGI
Q91EW3_GVCPM/3-155             TTINLFTYKPPPN----TVCDDDIDKQNFFIQGVLEALNDNSKSKQACFLELKREQCLLLRKIKHDLLYSCEGNYCQNHVLLDALHLYKLYKEEFDDTQSAFDIDLMQTCREIVYLTFELFSCAANIVVFVHASANYKDNVLAQLLVELQSKNFITL
#=GC seq_cons                  pTIsLahhpsPss....sssDsDhDc..hahpslhEsLsDsppsK.shFhELKpEQsLhh+Klh+cLlhpsEGsaspNHVLhDAhhhYKhYhp.hD..pSAFs.slhphCcphlhhhFElFohuupIVVhV..ssNacsssLu.LLhcLpshNhIsl
//
DBGET integrated database retrieval system