GenomeNet

Database: Pfam
Entry: Deltaretro_Tax
LinkDB: Deltaretro_Tax
Original site: Deltaretro_Tax 
#=GF ID   Deltaretro_Tax
#=GF AC   PF05599.9
#=GF DE   Deltaretrovirus Tax protein
#=GF AU   Nicot S, Moxon SJ, Studholme DJ
#=GF SE   Pfam-B_8606 (release 8.0)
#=GF GA   25.00 25.00;
#=GF TC   175.30 175.30;
#=GF NC   20.00 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12404172
#=GF RT   Cross-reactivity between immunodominant human T lymphotropic
#=GF RT   virus type I tax and neurons: implications for molecular
#=GF RT   mimicry. 
#=GF RA   Levin MC, Lee SM, Morcos Y, Brady J, Stuart J; 
#=GF RL   J Infect Dis 2002;186:1514-1517.
#=GF RN   [2]
#=GF RM   11689633
#=GF RT   Rat CRM1 is responsible for the poor activity of human T-cell
#=GF RT   leukemia virus type 1 Rex protein in rat cells. 
#=GF RA   Hakata Y, Yamada M, Shida H; 
#=GF RL   J Virol 2001;75:11515-11525.
#=GF RN   [3]
#=GF RM   11046153
#=GF RT   Distinct p300-responsive mechanisms promote caspase-dependent
#=GF RT   apoptosis by human T-cell lymphotropic virus type 1 Tax protein. 
#=GF RA   Nicot C, Harrod R; 
#=GF RL   Mol Cell Biol 2000;20:8580-8589.
#=GF DR   INTERPRO; IPR008596;
#=GF CC   This family consists of Rex/Tax proteins from human and simian
#=GF CC   T-cell leukaemia viruses. The exact function of these proteins
#=GF CC   is unknown. Tax is the viral transactivator; is it a nuclear
#=GF CC   phosphoprotein that interacts with CREB, coactivator CBP/p300
#=GF CC   and PCAF to form a multiprotein complex, which activates viral
#=GF CC   LTR and stimulates virus expression. Tax is also involved in
#=GF CC   deregulated expression of numerous cellular genes leading to
#=GF CC   T-cell leukaemia. Rex is a nucleolar post transcriptional
#=GF CC   regulator that facilitates export to the cytoplasm of viral RNA
#=GF CC   not or incompletely spliced [personal communication, Dr. S
#=GF CC   Nicot].
#=GF SQ   1
#=GS P30II_HTL1C/155-241  AC P0CK17.1
P30II_HTL1C/155-241             MLIISPLPRVWTESSFRIPSLRVWRLCTRRLVPHLWGTMFGPPTSSRPTGHLSRASDHLGPHRWTRYRLSSTVPYPSTPLLPHPENL
#=GC seq_cons                   MLIISPLPRVWTESSFRIPSLRVWRLCTRRLVPHLWGTMFGPPTSSRPTGHLSRASDHLGPHRWTRYRLSSTVPYPSTPLLPHPENL
//
DBGET integrated database retrieval system