GenomeNet

Database: Pfam
Entry: E2
LinkDB: E2
Original site: E2 
#=GF ID   E2
#=GF AC   PF08199.6
#=GF DE   Bacteriophage E2-like protein
#=GF AU   Rossi R
#=GF SE   Short protein clustering
#=GF GA   25.00 25.00;
#=GF TC   36.80 36.80;
#=GF NC   18.10 16.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1295892
#=GF RT   Isolation and characteristics of scallop sarcoplasmic reticulum
#=GF RT   with calcium transport activity. 
#=GF RA   Abe M, Shirakata Y, Sato D, Konishi K, Watanabe T, Nakamura J; 
#=GF RL   J Biochem (Tokyo) 1992;112:822-827.
#=GF DR   INTERPRO; IPR013184;
#=GF CC   Short conseved protein described in Lactococcus Bacteriophage c2
#=GF CC    of 37 amino acids [1].
#=GF SQ   7
#=GS Q7Y4G5_9CAUD/1-37  AC Q7Y4G5.1
#=GS Q7Y4F7_9CAUD/1-18  AC Q7Y4F7.1
#=GS Q7Y4E9_9CAUD/1-37  AC Q7Y4E9.1
#=GS Q9MBK9_BPLC2/1-37  AC Q9MBK9.1
#=GS Q7Y4G1_9CAUD/1-18  AC Q7Y4G1.1
#=GS Q7Y4M7_BPLC2/1-37  AC Q7Y4M7.1
#=GS Q7Y4H0_9CAUD/1-37  AC Q7Y4H0.1
Q7Y4G5_9CAUD/1-37             MLSRLLYSRFGKFIKRRVLIDNFSNFCHYNFIVDFLL
Q7Y4F7_9CAUD/1-18             MLLRLLYSRFGKFIKRRI-------------------
Q7Y4E9_9CAUD/1-37             MLFRLLYLRFGKSIKRRILIDNFSNFCYYNFIGYFYS
Q9MBK9_BPLC2/1-37             MLSRLLYSRFGKFIKRRLLIDNFSNFCHYNFIIYFYS
Q7Y4G1_9CAUD/1-18             MLLRLLYSRFGKFIKRRI-------------------
Q7Y4M7_BPLC2/1-37             MLSRLLYSRFGKFIKRRLLIDNFSNFCHYNFIIYFYS
Q7Y4H0_9CAUD/1-37             MLSRLLYSRFGKFIKRRLLIDNFSNFCHYNFIIYFYS
#=GC seq_cons                 ML.RLLYSRFGKFIKRRlLIDNFSNFCaYNFIh.Fh.
//
DBGET integrated database retrieval system