GenomeNet

Database: Pfam
Entry: End_beta_propel
LinkDB: End_beta_propel
Original site: End_beta_propel 
#=GF ID   End_beta_propel
#=GF AC   PF12217.3
#=GF DE   Catalytic beta propeller domain of bacteriophage endosialidase
#=GF AU   Mistry J, Gavin OL
#=GF SE   pdb_1v0e
#=GF GA   20.30 20.30;
#=GF TC   21.10 308.50;
#=GF NC   19.80 17.60;
#=GF BM   hmmbuild  --handHMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF NE   PF12195;
#=GF NL   A5VW57.1/324-406
#=GF RN   [1]
#=GF RM   15608653
#=GF RT   Crystal structure of the polysialic acid-degrading endosialidase
#=GF RT   of bacteriophage K1F.
#=GF RA   Stummeyer K, Dickmanns A, Muhlenhoff M, Gerardy-Schahn R, Ficner
#=GF RA   R;
#=GF RL   Nat Struct Mol Biol. 2005;12:90-96.
#=GF DR   INTERPRO; IPR024428;
#=GF CC   This domain family is found in bacteria and viruses, and is
#=GF CC   typically between 443 and 460 amino acids in length. This domain
#=GF CC   is the highly conserved beta propeller of bacteriophage
#=GF CC   endosialidase which represents the catalytically active part of
#=GF CC   the enzymes. This core domain forms stable SDS-resistant
#=GF CC   trimers. There is a nested beta barrel domain in this domain
#=GF CC   (Pfam:PF12195). The endosialidase protein complexes to form a
#=GF CC   homotrimeric molecule.
#=GF SQ   30
#=GS D2XJE4_9CAUD/234-693  AC D2XJE4.1
#=GS B7MGW6_ECO45/213-662  AC B7MGW6.1
#=GS Q9AZ46_9CAUD/103-545  AC Q9AZ46.1
#=GS E9U9P2_ECOLX/272-721  AC E9U9P2.1
#=GS A1AE04_ECOK1/272-721  AC A1AE04.1
#=GS H8DBH9_ECOLX/272-721  AC H8DBH9.1
#=GS H1EF96_ECOLX/214-663  AC H1EF96.1
#=GS Q858B1_BPK1F/313-755  AC Q858B1.1
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E B; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F E; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E F; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F B; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F A; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E C; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F C; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E E; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E D; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F F; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0F D; 313-755;
#=GS Q858B1_BPK1F/313-755  DR PDB; 1V0E A; 313-755;
#=GS A4UUQ0_9VIRU/103-545  AC A4UUQ0.1
#=GS Q2WC58_BPK1E/103-545  AC Q2WC58.1
#=GS E9VHT2_ECOLX/272-721  AC E9VHT2.1
#=GS C7U102_9CAUD/1-164    AC C7U102.1
#=GS C1HNF7_9ESCH/214-663  AC C1HNF7.1
#=GS A1ADJ7_ECOK1/213-662  AC A1ADJ7.1
#=GS E1RT14_ECOUM/213-662  AC E1RT14.1
#=GS Q2L3B7_ECOLX/213-662  AC Q2L3B7.1
#=GS Q1R962_ECOUT/213-662  AC Q1R962.1
#=GS A5VW57_9CAUD/213-662  AC A5VW57.1
#=GS B7NQQ5_ECO7I/272-721  AC B7NQQ5.1
#=GS D2XJ95_9CAUD/234-693  AC D2XJ95.1
#=GS D8BZP8_ECOLX/272-721  AC D8BZP8.1
#=GS E2P2P8_PASHA/46-495   AC E2P2P8.1
#=GS G5KQC4_ECOLX/213-662  AC G5KQC4.1
#=GS ENAN_BPK1F/313-755    AC Q04830.3
#=GS ENAN_BPK1F/313-755    DR PDB; 3JU4 A; 313-755;
#=GS ENAN_BPK1F/313-755    DR PDB; 3GVL A; 313-755;
#=GS ENAN_BPK1F/313-755    DR PDB; 3GVK B; 313-755;
#=GS ENAN_BPK1F/313-755    DR PDB; 3GVJ A; 313-755;
#=GS ENAN_BPK1F/313-755    DR PDB; 3GVK C; 313-755;
#=GS ENAN_BPK1F/313-755    DR PDB; 3GVK A; 313-755;
#=GS C7U0T8_9CAUD/1-164    AC C7U0T8.1
#=GS D5D7W7_ECOKI/213-662  AC D5D7W7.1
#=GS D5CWU1_ECOKI/272-721  AC D5CWU1.1
#=GS G4PWJ7_ECOLX/272-721  AC G4PWJ7.1
#=GS C7U0W2_9CAUD/1-164    AC C7U0W2.1
#=GS E5ZRI7_ECOLX/214-663  AC E5ZRI7.1
D2XJE4_9CAUD/234-693             ..NSSLTKVTDTPFYNAWTQDKTFVYDNVIYAPFMAGERHGVQNLHVAWVRSGDDGQTWSMPEWLTPIHADYNAsvsadrVNYHCMSMGTCGNRLYAVIETRYLSNMRMKKAELWSRPMpyfrhptggiaissgsttativienhglkagdavnfsntsatgvsgnmtvasiinrntftvtlsspasstinnagvtwnfatrFWDSPWEITELPGVAYSANADLCVTETHSFAVIDDVNYtiAVGYHNGDVPPRRLGVLYFSNVYDNPGVFVRRTVAQA.YADNASEPCVKSYDGVLYLTTRGTLPTSPGSTLAMSTDSGQNWSYLRFP.NNVHHSNLPFAKVGDYLYIFGTERAFGEWEGGEPD...SRYEGSYPRTFMCKVNVSSWppSLDDVQWFNITDQIYQGHIVNTAVGVGSVCVKDGWLYYIFGGEDFFSPWSIGDNSAKLW..YKHDGHPADLYSYRIKIE..
B7MGW6_ECO45/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
Q9AZ46_9CAUD/103-545             ..NGELYKITDNPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT......VNYHCMSMGVCRNRLFAMIETRTLAKNKLTNCALWDRPMsrslhltggitkaanqqyatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagkswhmgtsFHKSPWRKTDLGLIPS-------VTEVHSFATIDNNGF..VMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSE.YEPDASEPCIKYYDGVLYLITRGTLGDRLGSSLHRSRDIGQTWESLRFP.HNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPD...DRYKASYPRTFYARLNVNNW..NADDIEWVNITDQIYQGDIVNSSVGVGSVVVKDSYIYYIFGGENHFNPMTYGDNKGKDP..FKGHGHPTDIYCYKMQI-a.
E9U9P2_ECOLX/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVRGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTISSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGASWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
A1AE04_ECOK1/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
H8DBH9_ECOLX/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
H1EF96_ECOLX/214-663             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGRTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrayggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
Q858B1_BPK1F/313-755             ..QGELFKITDTPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT......VNYHCMSMGVCRNRLFAMIETRTLAKNALTNCALWDRPMsrslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagknwhmgtsFHKSPWRKTDLGLIPS-------VTEVHSFATIDNNGF..AMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSE.YEPDASEPCIKYYDGVLYLITRGTRGDRLGSSLHRSRDIGQTWESLRFP.HNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPD...DRYKASYPRTFYARLNVNNW..NADDIEWVNITDQIYQGGIVNSGVGVGSVVVKDNYIYYMFGGEDHFNPWTYGDNSAKDP..FKSDGHPSDLYCYKMKI-g.
#=GR Q858B1_BPK1F/313-755  SS    ..SEEEEE----SSEEE--TT--EEETTEEEEEEEEESSSSSTT-EEEEEEESSTTSS----EESS---TTTTT......EEEE-B-EEEETTEEEEEEEEEETTT--EEEEEEEEEE---EEEEES-EEE-TTSSEEEEE-TT----TT-EEEEES--STT--EEEEEEEEEETTEEEEE-S---SS-EE-TT-EEEEEE-STTS--EEEEEES-TT--------SEEEEEEE-SSS-E..EEEEEE-SSSS-EEEEEEETTTTT-TT--EEEE--GG.G-TTEEEEEEEEETTEEEEEEEES-TTS---EEEEESSTTSS-EEEE-T.T---SS---EEEETTEEEEEEE-SSTT-SSTT---...--SS-B--EEEEEEEETTT-..--TT---EEEEE-BB--SSS---SEEEEEEEETTEEEEEEEEB-S----TTTTTTT--T..TSTT----EEEEEEEE--S.
A4UUQ0_9VIRU/103-545             ..NGELYKITDNPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT......VNYHCMSMGVCRNRLFAMIETRTLAKNALTNCALWDRPMsrslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagknwhmgtsFHKSPWRKTDLGLIPH-------VTEVHSFATIDNNGF..VMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSE.YEPDAAEPCIKYYDGVLYLITRGTRGDRLGSSLHRSRDIGQTWESLRFP.HNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPD...DRYKASYPRTFYARLNVNNW..NAADIEWVNITDQIYQGDIVNSSVGVGSVVVKDSYIYYIFGGENHFNPMTYGDNRDKDP..FKGHGHPTDIYCYKMQI-a.
Q2WC58_BPK1E/103-545             ..NGELYKITDNPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDMHPDYPT......VNYHCMSMGVCRNRLFAMIETRTLAKNELTNCALWDRPMsrslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmkvatvidkdnftvltpnqqtsdlnnagknwhmgtsFHKSPWRKTDLGLIPR-------VTEVHSFATIDNNGF..VMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSE.YEPDAAEPCIKYYDGVLYLITRGTRGDRLGSSLHRSRDIGQTWESLRFP.HNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPD...DRYKASYPRTFYARLNVNNW..NADDIEWVNITDQIYQGDIVNSSVGVGSVVVKDSFIYYIFGGENHFNPMTYGDNKDKDP..FKGHGHPTDIYCYKMQI-a.
E9VHT2_ECOLX/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttkntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPVE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
C7U102_9CAUD/1-164               ..------------------------------------------------------------------------......---------------------------------------...................................................................................--------------------------------------..-------------------------------------.-----SEPCVKYYDGILYLTTRRTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELVIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGH------------..
C1HNF7_9ESCH/214-663             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGRTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrayggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
A1ADJ7_ECOK1/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
E1RT14_ECOUM/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
Q2L3B7_ECOLX/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
Q1R962_ECOUT/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
A5VW57_9CAUD/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
B7NQQ5_ECO7I/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVRGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPVE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
D2XJ95_9CAUD/234-693             ..NGSLTKVTDTPFYNAWTQDKTFVYDHVIYAPFMAGERHGVQNLHVAWVRSGDDGQTWSMPEWLTPIHADYNAsvstdrVNYHCMSMGTCGNRLYAVIETRYLSNMRMKKAELWSRPMpyfrhptggitissgsttativienhglkagdavnfsntsatgvsgnmtvssiinrntftvtlsspasstinnagvtwnfatrFWDSPWEITELPGVAYSTNADLCVTETHSFAVIDDVNYtiAVGYHNGDVSPRRLGVLYFSNVYDNPGVFVRRTVAQA.YADNASEPCVKSYGGVLYLTTRGTLPTSPGSTLAMSTDSGQNWSYLRFP.NNVHHSNLPFAKVGDYLYIFGTERAFGEWEGGEQD...SRYEGSYPRTFMCKVNVSSWpsSLDDVQWFNITDQIYQGHIVNSAVGVGSVCVKDGWLYYIFGGEDFFSPWSIGDNSAKLW..YKHDGHPADLYSYRIKIE..
D8BZP8_ECOLX/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVRGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPVE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
E2P2P8_PASHA/46-495              ka--DLSQITRTGYYTAWTQDKAFVHNGVIYAPFMLAFRHGYDDLRIAWVKSFDNGNTWTTPEILMDYHPQNPT......LGWHCFSMGIVGNRLFMLVEERDVASKKMVRSFLYSRVMtknffvtggisqsgnvvtveleehglfvgdsisfsnsgi.....sgvsgkmtvtsvldanrftvmnskeqtitnndswlcatyFEDNQWQIQELSTFAN--SAGVAATHLHSFCPVNRSQF..AFGFHNGDASPREIGFVKCSINWATGRVTTDKIILSEtLSRAAAEPCLRYYKNKLFLTTRSQNP-NVGSLLIRCDLNGENISSFNIStEKIHYTNMPFHIENDVIYMFAAERAENEWETGQSDksgNRYRANRPRMFLLKHRLSDW.gKPEKTEVQVISQGIYSGEAANSACGVGSIVYKDGILHCLFGDEDYRNSHSLTENARRANnaHIDSGYQPEIYALRIV--ld
G5KQC4_ECOLX/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
ENAN_BPK1F/313-755               ..QGELFKITDTPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT......VNYHCMSMGVCRNRLFAMIETRTLAKNALTNCALWDRPMsrslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagknwhmgtsFHKSPWRKTDLGLIPS-------VTEVHSFATIDNNGF..AMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSE.YEPDASEPCIKYYDGVLYLITRGTRGDRLGSSLHRSRDIGQTWESLRFP.HNVHRTTLPFAKVGDDLIMFGSERAENEWEAGAPD...DRYKASYPRTFYARLNVNNW..NADDIEWVNITDQIYQGGIVNSGVGVGSVVVKDNYIYYMFGGEDHFNPWTYGDNSAKDP..FKSDGHPSDLYCYKMKI-g.
#=GR ENAN_BPK1F/313-755    SS    ..SEEEEE----SSEEE--TT--EEETTEEEEEEEEESSSSSTT-EEEEEEESSTTSS----EESS---TTTTT......EEEE-B-EEEETTEEEEEEEEEETTT--EEEEEEEEEE--EEEEEES-EEE-TTS-EEEEE-TT----TT-EEEEES-SSTT--EEEE--EEEETTEEEEE-S---SS-EE-TT-EEEEEE-STTS--EEEEEES-TT--------SEEEEEEE-SSS-E..EEEEEE-SSSS-EEEEEEETTTTT-TT--EEEE--GG.G-TTEEEEEEEEETTEEEEEEEES-TTS---EEEEESSTTSS-EEEE-S.S---SS---EEEETTEEEEEEE-SSTT-SSTT---...--SS-B--EEEEEEEETTT-..--TT---EEEEE-BB--SSS---SEEEEEEEETTEEEEEEEEB-S----TTTTTTT--T..TSTT----EEEEEEEE--S.
C7U0T8_9CAUD/1-164               ..------------------------------------------------------------------------......---------------------------------------...................................................................................--------------------------------------..-------------------------------------.-----SEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGH------------..
D5D7W7_ECOKI/213-662             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
D5CWU1_ECOKI/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YFHDGHPADLYCFRVKIK..
G4PWJ7_ECOLX/272-721             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrvyggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELVIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
C7U0W2_9CAUD/1-164               ..------------------------------------------------------------------------......---------------------------------------...................................................................................--------------------------------------..-------------------------------------.-----SEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELVIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGH------------..
E5ZRI7_ECOLX/214-663             ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGRTWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMsrslrayggitkaanqqvayiritdhglfagdfvnfsnsgvtgvtgnmtvttvidkntftvttqntqdvdqnnegrywsfgtsFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
#=GC SS_cons                     ..SEEEEE----SSEEE--TT--EEETTEEEEEEEEESSSSSTT-EEEEEEESSTTSS----EESS---TTTTT......EEEE-B-EEEETTEEEEEEEEEETTT--EEEEEEEEEE--EEEEEES-EEE-TTSSEEEEE-TT----TT-EEEEES-SSTT--EEEEEEEEEETTEEEEE-S---SS-EE-TT-EEEEEE-STTS--EEEEEES-TT--------SEEEEEEE-SSS-E..EEEEEE-SSSS-EEEEEEETTTTT-TT--EEEE--GG.G-TTEEEEEEEEETTEEEEEEEES-TTS---EEEEESSTTSS-EEEE-T.T---SS---EEEETTEEEEEEE-SSTT-SSTT---...--SS-B--EEEEEEEETTT-..--TT---EEEEE-BB--SSS---SEEEEEEEETTEEEEEEEEB-S----TTTTTTT--T..TSTT----EEEEEEEE--S.
#=GC seq_cons                    ..QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDG+TWTTPEWLTDLHENYPT......VNYHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMSRSLRlYGGITKAANQQVAYIRITDHGLFAGDFVNFSNSGVTGVTGNMTVTTVIDKNTFTVTTQNTQDVDQNNEGRYWSFGTSFHSSPWRKTSLGTIPSFVDGSTPVTEIHSFATISDNSF..AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPuE.YEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSWNSLRFP.NNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPD...NRYAGNYPRTFMTRVNVNEW..SLDNVEWVNVTDQIYQGGIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYP..YVHDGHPADLYCFRVKIK..
//
DBGET integrated database retrieval system