GenomeNet

Database: Pfam
Entry: Endonuc-PvuII
LinkDB: Endonuc-PvuII
Original site: Endonuc-PvuII 
#=GF ID   Endonuc-PvuII
#=GF AC   PF09225.7
#=GF DE   Restriction endonuclease PvuII
#=GF AU   Sammut SJ
#=GF SE   pdb_3pvi
#=GF GA   25.00 25.00;
#=GF TC   215.40 215.10;
#=GF NC   20.40 18.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   9878366
#=GF RT   Asp34 of PvuII endonuclease is directly involved in DNA minor
#=GF RT   groove recognition and indirectly involved in catalysis. 
#=GF RA   Horton JR, Nastri HG, Riggs PD, Cheng X; 
#=GF RL   J Mol Biol. 1998;284:1491-1504.
#=GF RN   [2]
#=GF RM   22638584
#=GF RT   Sequence, structure and functional diversity of PD-(D/E)XK
#=GF RT   phosphodiesterase superfamily.
#=GF RA   Steczkiewicz K, Muszewska A, Knizewski L, Rychlewski L, Ginalski
#=GF RA   K;
#=GF RL   Nucleic Acids Res. 2012;40:7016-7045.
#=GF DR   INTERPRO; IPR015306;
#=GF DR   SCOP; 3pvi; fa;
#=GF CC   Members of this family are predominantly found in prokaryotic
#=GF CC   restriction endonuclease PvuII. They recognise the
#=GF CC   double-stranded DNA sequence 5'-CAGCTG-3' and cleave after G-3,
#=GF CC   resulting in specific double-stranded fragments with terminal
#=GF CC   5'-phosphates [1].
#=GF SQ   7
#=GS A1WNN0_VEREI/11-164     AC A1WNN0.1
#=GS W0F4T8_9SPHI/1-129      AC W0F4T8.1
#=GS A0A090AJ56_9GAMM/5-158  AC A0A090AJ56.1
#=GS D3PMZ8_MEIRD/75-228     AC D3PMZ8.1
#=GS K9VCS8_9CYAN/109-263    AC K9VCS8.1
#=GS K9XGE0_9CHRO/113-266    AC K9XGE0.1
#=GS K7VYC2_9NOST/113-266    AC K7VYC2.1
A1WNN0_VEREI/11-164                .TDKQKFERLFPCIREYQVLASKYKINDIFQDNGGKYLQLLMILGLTTDGTREGNDAVDSFGNEYEIKTVNLELQHQ..FTTHHHMNPAIIAKYRKVD.WYFAAFKNIELQVIYRLKPDHMESFYARWEKKWHDDGGKDINNPKIPLAHVMEYGEIIW...
W0F4T8_9SPHI/1-129                 .------------------------MNDIFQDNGGKLLQVLLHTGLKILPGREGNDAVDDAGNEYELKSVNIRLTKS..FSTHHHMNPTIIKKYRKVD.WIFAVYEGIELLEIYKLKPAHLEPYYVAWEKKWSADGDKDINNPKIPLKYVRLHG----irl
A0A090AJ56_9GAMM/5-158             p-DKNKLDELFPCIREYQELALKHGIQDIFQDNGGKLLQVILTTSLKVLPGREGNDAIDEFGNEYELKSVNILLTKS..FSTHHHLNPTIIRKYREVN.WVFSVYEGIELKEIYVLIPKQLEPFYQKWENKWYKEGNKDINNPKIPLSYVRKNGYLIF...
D3PMZ8_MEIRD/75-228                .TDIAILEALFPYIRRYQILASRYGIADIFQDNGGKLLEILIRTGLKIVPGREGNDAVDEQGQEYEIKSVNVELTRS..FSTHHHLNPSILDKYRRVR.WIFAVYRNIELQEIYCLEPQQLERFFSDWERKWRAQGGKDINNPKIPLRYVQREGRLIY...
K9VCS8_9CYAN/109-263               .SDAKRLENAMKSIQELQNLASEYGIADIFQDNGGKTLQLLILLGLRISPGREGNDAIDAEGKEYELKTINIALNRSggVTTHHHLNEIILEKYRRVEaWYIGLYEGITLKEIYKLTPEMLEPKFKEWEEKVR-LRNEPLNNPKIPLKLVKK-GQLVY...
K9XGE0_9CHRO/113-266               .SDLERLQTALEAIQELQTLANEYGINDVFQDNGGKVLQVLILLGLRISPGCEGNDAIDAEGHKYELKTINKLLSRS..VTTHHHLNLDILAKYRAVKaWYIAVYEGIVLKAIYRVAPTSLESKFSYWESRIF-EGMKSINNPKIPLALIEKEGKLVY...
K7VYC2_9NOST/113-266               .SDLERLQTALGAIQELQSLANEYGINDVFQDNGGKVLQVLILLGLRISPGREGNDAIDAEKNEYELKTINKLLSKS..VTTNHHLNLDILAKYRAVKaWYIAVYEGILLKAIYRVDPTSLETKFSYWESRIR-GGMESINNPKIPLSLIEKEGELVY...
#=GC seq_cons                      .oDhp+Lpphh.sIpEhQ.LAscYGIsDIFQDNGGKlLQlLlhhGL+IsPGREGNDAlDstGpEYELKolNlhLo+S..hoTHHHLN.sIltKYRcVc.WhhAVYEGIpLptIY+LpPppLEshastWEpKhp.pGsKsINNPKIPLphVc+pGpLla...
//
DBGET integrated database retrieval system