GenomeNet

Database: Pfam
Entry: Enterotoxin_b
LinkDB: Enterotoxin_b
Original site: Enterotoxin_b 
#=GF ID   Enterotoxin_b
#=GF AC   PF01376.17
#=GF DE   Heat-labile enterotoxin beta chain
#=GF PI   Enterotoxin_B; 
#=GF AU   Bateman A
#=GF SE   SCOP
#=GF GA   25.00 25.00;
#=GF TC   34.60 238.90;
#=GF NC   23.60 18.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Heat-labile_enterotoxin_family
#=GF RN   [1]
#=GF RM   8478941
#=GF RT   Refined structure of Escherichia coli heat-labile enterotoxin, a
#=GF RT   close relative of cholera toxin. 
#=GF RA   Sixma TK, Kalk KH, van Zanten BA, Dauter Z, Kingma J, Witholt B,
#=GF RA   Hol WG; 
#=GF RL   J Mol Biol 1993;230:890-918.
#=GF DR   INTERPRO; IPR001835;
#=GF DR   SCOP; 1lts; fa;
#=GF DR   HOMSTRAD; ltb;
#=GF SQ   1
#=GS CHTB_VIBCH/22-123  AC P01556.1
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHP D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF J; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5C G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RCV E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RCV G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3CHB H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1JR0 F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CT1 F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5F D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RF2 F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1G8Z G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHQ F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5D G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC I; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5F H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1G8Z F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RDP G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHQ H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHQ E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E L; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5B E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CT1 E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHP H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E M; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RD9 F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE C; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3CHB D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX G; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5C E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHQ D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1FGB D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX M; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF B; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1JR0 E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CT1 H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1G8Z D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RD9 H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX K; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1FGB E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RDP E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3CHB E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 2CHB H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E N; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5B G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX F; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC B; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 2CHB D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5B H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1MD2 G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5C F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5F G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 2CHB E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX J; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHP G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1FGB G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC A; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RF2 E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5B D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RF2 H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RD9 D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC J; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5D F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1XTC E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E J; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5C D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 2CHB F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3CHB G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE A; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RCV F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1JR0 H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RF2 G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CT1 G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1G8Z H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1G8Z E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RCV H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5F E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CT1 D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RDP D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX H; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE J; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5D H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF C; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5C H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RDP H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1JR0 D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1MD2 F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RF2 D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RD9 G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX D; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RCV D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1FGB F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF A; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE B; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF I; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHP E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1MD2 E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1MD2 D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1XTC H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX L; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX E; 2-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5B F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1XTC D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5D E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 2CHB G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1XTC F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELF G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE I; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1JR0 G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E K; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELE E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5D D; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3CHB F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHQ G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1XTC G; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1FGB H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RD9 E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5F F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1S5E E; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1RDP F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1MD2 H; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 1CHP F; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 5ELC C; 1-102;
#=GS CHTB_VIBCH/22-123  DR PDB; 3EFX I; 2-102;
CHTB_VIBCH/22-123             TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMA
#=GR CHTB_VIBCH/22-123  SS    X-SSHHHHHTTSTTEEEEEEEEEESEEEEEESTTBEEEEEEETTS-EEEE-SSSTTS-TTHHHHHHHHHHHHHHHHHHTXEEEEEEEETTSSSEEEEEEEEE
#=GC SS_cons                  X-SSHHHHHTTSTTEEEEEEEEEESEEEEEESTTBEEEEEEETTS-EEEE-SSSTTS-TTHHHHHHHHHHHHHHHHHHTXEEEEEEEETTSSSEEEEEEEEE
#=GC seq_cons                 TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMA
//
DBGET integrated database retrieval system