GenomeNet

Database: Pfam
Entry: Erythrovirus_X
LinkDB: Erythrovirus_X
Original site: Erythrovirus_X 
#=GF ID   Erythrovirus_X
#=GF AC   PF06795.10
#=GF DE   Erythrovirus X protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_9167 (release 10.0)
#=GF GA   21.00 21.00;
#=GF TC   21.00 194.90;
#=GF NC   20.40 20.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR009629;
#=GF CC   This family consists of several Erythrovirus X proteins which
#=GF CC   seem to be found exclusively in human parvovirus and human
#=GF CC   erythrovirus. The function of this family is unknown.
#=GF SQ   1
#=GS X_PAVHV/1-81  AC P0DJZ1.1
X_PAVHV/1-81             MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
#=GC seq_cons            MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
//
DBGET integrated database retrieval system