GenomeNet

Database: Pfam
Entry: Erythrovirus_X
LinkDB: Erythrovirus_X
Original site: Erythrovirus_X 
#=GF ID   Erythrovirus_X
#=GF AC   PF06795.6
#=GF DE   Erythrovirus X protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_9167 (release 10.0)
#=GF GA   21.00 21.00;
#=GF TC   21.10 182.00;
#=GF NC   20.50 20.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR009629;
#=GF CC   This family consists of several Erythrovirus X proteins which
#=GF CC   seem to be found exclusively in human parvovirus and human
#=GF CC   erythrovirus. The function of this family is unknown.
#=GF SQ   19
#=GS Q912P3_PAVHB/1-81   AC Q912P3.1
#=GS Q38IU7_PAVHB/1-81   AC Q38IU7.1
#=GS Q779Q8_PAVHB/1-81   AC Q779Q8.1
#=GS Q8JN55_PAVHB/1-81   AC Q8JN55.1
#=GS Q912N4_PAVHB/1-81   AC Q912N4.1
#=GS D4AHZ1_PAVHB/1-81   AC D4AHZ1.1
#=GS Q85124_PAVHB/18-97  AC Q85124.1
#=GS Q912C0_9VIRU/1-81   AC Q912C0.1
#=GS Q912C3_9VIRU/1-81   AC Q912C3.1
#=GS Q910M7_9VIRU/1-81   AC Q910M7.1
#=GS A1BML5_PAVHB/1-81   AC A1BML5.1
#=GS Q912P8_PAVHB/1-81   AC Q912P8.1
#=GS Q85186_PAVHB/3-83   AC Q85186.1
#=GS Q912C9_9VIRU/1-81   AC Q912C9.1
#=GS A1BN56_PAVHB/1-81   AC A1BN56.1
#=GS Q84373_PAVHU/1-81   AC Q84373.1
#=GS Q2HZZ8_PAVHB/1-81   AC Q2HZZ8.1
#=GS Q38IT7_PAVHB/1-81   AC Q38IT7.1
#=GS A1A3Z7_PAVHB/1-81   AC A1A3Z7.1
Q912P3_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLVYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q38IU7_PAVHB/1-81              MDSYLTTPMPYHPVTVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLWTVLQGFMTLGIANWLSWE
Q779Q8_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q8JN55_PAVHB/1-81              MDSYLTTPMPYHPVTVVQNLEEKMQYYLMKTYTSLGKLACNYPVLTMLGLAMSYKLGLRRMLWTVLQGFMTLGIANWLSWE
Q912N4_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYRLGPRKVLLTVLQGFMTLGIANWLSWE
D4AHZ1_PAVHB/1-81              MDSYLTTPMPYHPVAVIQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLWTVLQGFMTLGIANWLSWE
Q85124_PAVHB/18-97             MDSYLSTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLDLAMSYKLGPRKVLLTVLQGFMTLGIANWLSW-
Q912C0_9VIRU/1-81              MDSYLTTPMPYHPVAVIQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLWTVLQGFMTLGIANWLSWE
Q912C3_9VIRU/1-81              MDSYLTTPMPYHPVAVIQNLEEKMQYYLVKTYTSLGKLAYNYPVLTILGLAMSYKLGPRKVLWTVLQGFMTLGIANWLSWE
Q910M7_9VIRU/1-81              MDSYLTTPMPYHPVTVVQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGLRRMLWTVLQGFMTLGIANWLSWE
A1BML5_PAVHB/1-81              MDSYLTTPMPYHPVTVVQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLPMSSKLGLRRMLWTVLQGFMTLGIANWLSWE
Q912P8_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEERMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q85186_PAVHB/3-83              MDSYLATPMPYHPVAVMQNLEEKMQYYLVKTNTSLGKLAYNYPVLTMLGLVMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q912C9_9VIRU/1-81              MDSYLTTPMPYHPVTVIQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGLRRMLWTVLQGFMTLGIANWLSWE
A1BN56_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAISYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q84373_PAVHU/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
Q2HZZ8_PAVHB/1-81              MDSYLTTPMPYHPVAVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLWTVLQGFMTLGIANWLSWE
Q38IT7_PAVHB/1-81              MDSYLTTPMPYHPVTVMQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLLTVLQGFMTLGIANWLSWE
A1A3Z7_PAVHB/1-81              MDSYLTTPMPYHPVTVVQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGLRRMLWTVLQGFMTLGIANWLSWE
#=GC seq_cons                  MDSYLTTPMPYHPVAVhQNLEEKMQYYLVKTYTSLGKLAYNYPVLTMLGLAMSYKLGPRKVLhTVLQGFMTLGIANWLSWE
//
DBGET integrated database retrieval system