GenomeNet

Database: Pfam
Entry: Flavi_M
LinkDB: Flavi_M
Original site: Flavi_M 
#=GF ID   Flavi_M
#=GF AC   PF01004.16
#=GF DE   Flavivirus envelope glycoprotein M
#=GF AU   Finn RD, Bateman A
#=GF SE   Pfam-B_156 (release 3.0)  
#=GF GA   21.20 10.00;
#=GF TC   144.10 142.50;
#=GF NC   19.30 9.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8676481
#=GF RT   Recombinant subviral particles from tick-borne encephalitis
#=GF RT   virus are fusogenic and provide a model system for studying
#=GF RT   flavivirus envelope glycoprotein functions. 
#=GF RA   Schalich J, Allison SL, Stiasny K, Mandl CW, Kunz C, Heinz FX; 
#=GF RL   J Virol 1996;70:4549-4557.
#=GF RN   [2]
#=GF RM   7913359
#=GF RT   The interactions of the flavivirus envelope proteins:
#=GF RT   implications for virus entry and release. 
#=GF RA   Heinz FX, Auer G, Stiasny K, Holzmann H, Mandl C, Guirakhoo F,
#=GF RA   Kunz C; 
#=GF RL   Arch Virol Suppl 1994;9:339-348.
#=GF RN   [3]
#=GF RM   8437237
#=GF RT   Proper maturation of the Japanese encephalitis virus envelope
#=GF RT   glycoprotein requires cosynthesis with the premembrane protein. 
#=GF RA   Konishi E, Mason PW; 
#=GF RL   J Virol 1993;67:1672-1675.
#=GF DR   INTERPRO; IPR000069;
#=GF CC   Flaviviruses are small enveloped viruses with virions comprised
#=GF CC   of 3 proteins called C, M and E. The envelope glycoprotein M is
#=GF CC   made as a precursor, called prM. The precursor portion of the
#=GF CC   protein is the signal peptide for the proteins entry into the
#=GF CC   membrane. prM is cleaved to form M in a late-stage cleavage
#=GF CC   event. Associated with this cleavage is a change in the
#=GF CC   infectivity and fusion activity of the virus.
#=GF SQ   2
#=GS POLG_DEN1W/207-280  AC P17763.2
#=GS POLG_YEFV1/212-285  AC P03314.1
POLG_DEN1W/207-280             VALAPHVGLGLETRTETWMSSEGAWKQIQKVETWALRHPGFTVIALFLAHAIGTSITQKGIIFILLMLVTPSMA
POLG_YEFV1/212-285             IDLPTHENHGLKTRQEKWMTGRMGERQLQKIERWFVRNPFFAVTALTIAYLVGSNMTQRVVIALLVLAVGPAYS
#=GC seq_cons                  lsLssH.shGLcTRpEpWMouchu.+QlQKlEpWhlRpPhFsVhALhlAahlGoshTQ+slIhlLlhhVsPuhu
//
DBGET integrated database retrieval system