GenomeNet

Database: Pfam
Entry: GBP_repeat
LinkDB: GBP_repeat
Original site: GBP_repeat 
#=GF ID   GBP_repeat
#=GF AC   PF02526.9
#=GF DE   Glycophorin-binding protein
#=GF AU   Bashton M, Bateman A
#=GF SE   Pfam-B_1047 (release 5.4)
#=GF GA   25.00 25.00;
#=GF TC   102.50 43.00;
#=GF NC   18.50 16.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Repeat
#=GF RN   [1]
#=GF RM   7891744
#=GF RT   Isolation of a third member of the Plasmodium falciparum
#=GF RT   glycophorin-binding protein gene family. 
#=GF RA   Rudolph B, Nolte D, Knapp B; 
#=GF RL   Mol Biochem Parasitol 1994;68:173-176.
#=GF RN   [2]
#=GF RM   3512098
#=GF RT   A tandemly repeated sequence determines the binding domain for
#=GF RT   an erythrocyte receptor binding protein of P. falciparum. 
#=GF RA   Kochan J, Perkins M, Ravetch JV; 
#=GF RL   Cell 1986;44:689-696.
#=GF DR   INTERPRO; IPR003681;
#=GF CC   This family contains glycophorin binding proteins from P.
#=GF CC   falciparum the malarial parasite [2]. Glycophorin is a cell
#=GF CC   surface protein of erythrocytes. The Glycophorin binding protein
#=GF CC   contains a tandem 38 residue repeat. In Swiss:P02895 the repeat
#=GF CC   occurs 11 times.
#=GF SQ   59
#=GS GBPH_PLAFB/230-267    AC P32072.1
#=GS Q8IEU3_PLAF7/300-337  AC Q8IEU3.1
#=GS GBP_PLAFG/227-264     AC P02895.2
#=GS Q8IEU3_PLAF7/110-147  AC Q8IEU3.1
#=GS Q25767_PLAFA/102-139  AC Q25767.1
#=GS GBP_PLAFG/576-613     AC P02895.2
#=GS Q8IM78_PLAF7/110-147  AC Q8IM78.1
#=GS Q9U591_PLAFA/101-138  AC Q9U591.1
#=GS GBP_PLAFG/427-464     AC P02895.2
#=GS Q8IM78_PLAF7/150-187  AC Q8IM78.1
#=GS Q9U591_PLAFA/51-88    AC Q9U591.1
#=GS Q25859_PLAFA/194-231  AC Q25859.1
#=GS GBP_PLAF7/277-314     AC Q8I6U8.1
#=GS GBP_PLAF7/327-364     AC Q8I6U8.1
#=GS Q8IEU3_PLAF7/262-299  AC Q8IEU3.1
#=GS GBPH_PLAFB/269-306    AC P32072.1
#=GS GBP_PLAF7/776-813     AC Q8I6U8.1
#=GS Q9U591_PLAFA/151-188  AC Q9U591.1
#=GS GBPH_PLAFB/348-385    AC P32072.1
#=GS GBP_PLAF7/626-663     AC Q8I6U8.1
#=GS GBP_PLAF7/526-563     AC Q8I6U8.1
#=GS GBP_PLAFG/726-763     AC P02895.2
#=GS GBP_PLAFG/526-563     AC P02895.2
#=GS Q25858_PLAFA/34-71    AC Q25858.1
#=GS GBP_PLAFG/327-364     AC P02895.2
#=GS Q25767_PLAFA/52-89    AC Q25767.1
#=GS GBP_PLAFG/377-414     AC P02895.2
#=GS Q25858_PLAFA/1-21     AC Q25858.1
#=GS GBP_PLAF7/377-414     AC Q8I6U8.1
#=GS GBP_PLAF7/676-713     AC Q8I6U8.1
#=GS Q25859_PLAFA/80-117   AC Q25859.1
#=GS GBPH_PLAFB/190-227    AC P32072.1
#=GS Q25767_PLAFA/2-39     AC Q25767.1
#=GS Q25859_PLAFA/118-155  AC Q25859.1
#=GS Q9U591_PLAFA/1-38     AC Q9U591.1
#=GS Q8IEU3_PLAF7/224-261  AC Q8IEU3.1
#=GS Q8IM78_PLAF7/189-226  AC Q8IM78.1
#=GS GBP_PLAFG/676-713     AC P02895.2
#=GS GBPH_PLAFB/150-187    AC P32072.1
#=GS GBPH_PLAFB/308-345    AC P32072.1
#=GS Q25859_PLAFA/270-307  AC Q25859.1
#=GS Q8IM78_PLAF7/268-305  AC Q8IM78.1
#=GS Q9TY78_PLAFA/5-42     AC Q9TY78.1
#=GS GBPH_PLAFB/388-425    AC P32072.1
#=GS Q25859_PLAFA/232-269  AC Q25859.1
#=GS Q8IEU3_PLAF7/186-223  AC Q8IEU3.1
#=GS GBP_PLAF7/426-463     AC Q8I6U8.1
#=GS GBPH_PLAFB/110-147    AC P32072.1
#=GS Q8IEU3_PLAF7/148-185  AC Q8IEU3.1
#=GS GBP_PLAFG/277-314     AC P02895.2
#=GS GBP_PLAFG/476-513     AC P02895.2
#=GS GBP_PLAF7/576-613     AC Q8I6U8.1
#=GS Q25859_PLAFA/156-193  AC Q25859.1
#=GS GBP_PLAF7/726-763     AC Q8I6U8.1
#=GS Q8IM78_PLAF7/228-265  AC Q8IM78.1
#=GS GBP_PLAFG/626-663     AC P02895.2
#=GS GBP_PLAF7/227-264     AC Q8I6U8.1
#=GS Q8IEU3_PLAF7/338-375  AC Q8IEU3.1
#=GS GBP_PLAF7/476-513     AC Q8I6U8.1
GBPH_PLAFB/230-267               .TSADPEGQIMKAYAADPEYRKHVNVLYQILNHTDSSE-v
Q8IEU3_PLAF7/300-337             .TSADPEGQIMKAWAADPVYRKHVNVLYQILTHTDPNDE.
GBP_PLAFG/227-264                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q8IEU3_PLAF7/110-147             .TSADPEGQIMKAWAADPEYRKHINVLYQILTHTDPNDE.
Q25767_PLAFA/102-139             .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
GBP_PLAFG/576-613                .TSSDPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
Q8IM78_PLAF7/110-147             .TSADPEGQIMKAYAADPEYRKHLNVLYQILNNTDPNDE.
Q9U591_PLAFA/101-138             .TSADPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAFG/427-464                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q8IM78_PLAF7/150-187             .TSADPEGQIMKAYAADPEYRKHVNVLYQILNHTDSSE-v
Q9U591_PLAFA/51-88               .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q25859_PLAFA/194-231             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTHTDPNDE.
GBP_PLAF7/277-314                .TSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDD.
GBP_PLAF7/327-364                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q8IEU3_PLAF7/262-299             .TSADPEGQIMKAWAADPEYLKHVNVLYQILTNTDPNDE.
GBPH_PLAFB/269-306               .TSADPEGQIMKAYAADPEYRKHVNVLYQILNHTDSSE-v
GBP_PLAF7/776-813                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q9U591_PLAFA/151-188             .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
GBPH_PLAFB/348-385               .TSADPEGQIMKAYAADPEYRKHVNVLYQILNNTDPNDE.
GBP_PLAF7/626-663                .TSSDPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAF7/526-563                .TSADPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAFG/726-763                .TSADPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAFG/526-563                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q25858_PLAFA/34-71               .TSADPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAFG/327-364                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q25767_PLAFA/52-89               .TSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDD.
GBP_PLAFG/377-414                .TSADPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
Q25858_PLAFA/1-21                a------------------YRKHLEVFHKILTNTDPNDE.
GBP_PLAF7/377-414                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
GBP_PLAF7/676-713                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q25859_PLAFA/80-117              .TSADPEGQIMKAWAADPEYRKHINVLYQILTHTDPNDE.
GBPH_PLAFB/190-227               s-SADPEGQIMKAYAADPEYRKHVNVLYQILNNTDPNDE.
Q25767_PLAFA/2-39                .TSSDPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q25859_PLAFA/118-155             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTHTDPNDE.
Q9U591_PLAFA/1-38                .TSSDPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
Q8IEU3_PLAF7/224-261             .TSADPEGQIMKAWAADPEYLKHVNVLYQILTHTDPNDE.
Q8IM78_PLAF7/189-226             .TSADPEGQIMKAYAADPEYRKHVNVLYQILNHTDSNE-v
GBP_PLAFG/676-713                .TSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDD.
GBPH_PLAFB/150-187               .TSADPEGQIMKAYAADPEYRKHLNVLYQILNNTDPNDE.
GBPH_PLAFB/308-345               .TSADPEGQIMKAYAADPEYRKHVNVLYQILNNTDPNDE.
Q25859_PLAFA/270-307             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTNTDPNDE.
Q8IM78_PLAF7/268-305             .TSADPEGQIMKAYAADPEYRKHVNVLYQILTNTDPNDE.
Q9TY78_PLAFA/5-42                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
GBPH_PLAFB/388-425               .TSADPEGQIMKAYAADPEYRKHVNVLYQILNNTDPNDE.
Q25859_PLAFA/232-269             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTHTDPNDE.
Q8IEU3_PLAF7/186-223             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTHTDPNDE.
GBP_PLAF7/426-463                .TSSDPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
GBPH_PLAFB/110-147               .TSADPEGQIMKAWAADPEYRKHLNVLYQILNNTDPNDE.
Q8IEU3_PLAF7/148-185             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTHTDPNDE.
GBP_PLAFG/277-314                .TSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDD.
GBP_PLAFG/476-513                .TSSDPEGQIMREYAADPEYRKHLEIFHKILTNTDPNDE.
GBP_PLAF7/576-613                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q25859_PLAFA/156-193             .TSADPEGQIMKAWAADPEYLKHVNVLYQILTNTDPNDE.
GBP_PLAF7/726-763                .TSADPEGQIMREYASDPEYRKHLEIFYKILTNTDPNDD.
Q8IM78_PLAF7/228-265             .TSADPEGQIMKAYAADPEYRKHVNVLYQILNNTDPNDE.
GBP_PLAFG/626-663                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
GBP_PLAF7/227-264                .TSADPEGQIMREYAADPEYRKHLEIFYKILTNTDPNDE.
Q8IEU3_PLAF7/338-375             .TSADPEGQIMKAWAADPEYRKHVNVLYQILTNTDPNDE.
GBP_PLAF7/476-513                .TSADPEGQIMREYAADPEYRKHLEVFHKILTNTDPNDE.
#=GC seq_cons                    .TSADPEGQIM+tYAADPEYRKHLpVhYpILTNTDPNDE.
//
DBGET integrated database retrieval system