GenomeNet

Database: Pfam
Entry: Gag_spuma
LinkDB: Gag_spuma
Original site: Gag_spuma 
#=GF ID   Gag_spuma
#=GF AC   PF03276.9
#=GF DE   Spumavirus gag protein
#=GF AU   Mifsud W
#=GF SE   Pfam-B_1878 (release 6.5)
#=GF GA   19.60 19.60;
#=GF TC   19.90 19.90;
#=GF NC   19.10 18.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9261397
#=GF RT   Characterization of the genome of feline foamy virus and its
#=GF RT   proteins shows distinct features different from those of primate
#=GF RT   spumaviruses. 
#=GF RA   Winkler I, Bodem J, Haas L, Zemba M, Delius H, Flower R, Flugel
#=GF RA   RM, Lochelt M; 
#=GF RL   J Virol 1997;71:6727-6741.
#=GF DR   INTERPRO; IPR004957;
#=GF DR   MEROPS; A9;
#=GF SQ   132
#=GS B3FXE3_9RETR/1-204    AC B3FXE3.1
#=GS B3FXC5_9RETR/1-204    AC B3FXC5.1
#=GS B3FXF2_9RETR/1-204    AC B3FXF2.1
#=GS Q7SIS7_9RETR/1-596    AC Q7SIS7.1
#=GS P87702_FFV/1-173      AC P87702.1
#=GS B3FXH3_9RETR/1-204    AC B3FXH3.1
#=GS B3FXG3_9RETR/1-204    AC B3FXG3.1
#=GS Q6XZR9_9RETR/1-213    AC Q6XZR9.1
#=GS B3FXE1_9RETR/1-204    AC B3FXE1.1
#=GS B3FXG4_9RETR/1-204    AC B3FXG4.1
#=GS B3FXD4_9RETR/1-204    AC B3FXD4.1
#=GS Q45QF3_SFV1/1-610     AC Q45QF3.1
#=GS B2CGB8_9RETR/1-375    AC B2CGB8.1
#=GS D5JWU5_9RETR/1-563    AC D5JWU5.1
#=GS B3FXH5_9RETR/1-204    AC B3FXH5.1
#=GS B3FXG9_9RETR/1-204    AC B3FXG9.1
#=GS Q45QF5_SFV1/1-613     AC Q45QF5.1
#=GS B3FXH1_9RETR/1-204    AC B3FXH1.1
#=GS O41893_9RETR/1-172    AC O41893.1
#=GS B3FXD5_9RETR/1-204    AC B3FXD5.1
#=GS P87702_FFV/166-489    AC P87702.1
#=GS B3FXI0_9RETR/1-204    AC B3FXI0.1
#=GS Q6XZS7_9RETR/1-204    AC Q6XZS7.1
#=GS Q45QF6_SFV1/1-613     AC Q45QF6.1
#=GS Q6XZS3_9RETR/1-204    AC Q6XZS3.1
#=GS B3FXF7_9RETR/1-204    AC B3FXF7.1
#=GS Q6XZR6_9RETR/1-204    AC Q6XZR6.1
#=GS Q6XZR7_9RETR/1-204    AC Q6XZR7.1
#=GS Q98826_9RETR/1-618    AC Q98826.1
#=GS D5JWV0_9RETR/1-611    AC D5JWV0.1
#=GS B3FXG6_9RETR/1-204    AC B3FXG6.1
#=GS GAG_SFVCP/1-623       AC Q87039.1
#=GS B4HBJ4_DROPE/67-155   AC B4HBJ4.1
#=GS B3FXC2_9RETR/1-204    AC B3FXC2.1
#=GS Q70LW5_FFV/166-489    AC Q70LW5.1
#=GS GAG_FFV/165-489       AC O56860.1
#=GS Q45QE9_SFV1/1-613     AC Q45QE9.1
#=GS B3FXE6_9RETR/1-204    AC B3FXE6.1
#=GS B3FXC1_9RETR/1-204    AC B3FXC1.1
#=GS GAG_FOAMV/1-618       AC P14349.2
#=GS B3FXC7_9RETR/1-204    AC B3FXC7.1
#=GS B2CGB2_9RETR/1-375    AC B2CGB2.1
#=GS Q45QF0_SFV1/1-610     AC Q45QF0.1
#=GS B2CGC4_9RETR/1-374    AC B2CGC4.1
#=GS B3FXH2_9RETR/1-204    AC B3FXH2.1
#=GS B3FXD6_9RETR/1-204    AC B3FXD6.1
#=GS B3FXE9_9RETR/1-204    AC B3FXE9.1
#=GS B3FXF8_9RETR/1-204    AC B3FXF8.1
#=GS B3FXI1_9RETR/1-204    AC B3FXI1.1
#=GS B3FXD7_9RETR/1-204    AC B3FXD7.1
#=GS B3FXH8_9RETR/1-204    AC B3FXH8.1
#=GS B3FXC9_9RETR/1-204    AC B3FXC9.1
#=GS O41893_9RETR/166-511  AC O41893.1
#=GS GAG_SFV1/1-613        AC Q00071.1
#=GS B3FXF5_9RETR/1-204    AC B3FXF5.1
#=GS Q0PEK1_9RETR/1-80     AC Q0PEK1.1
#=GS H6V7I7_SFV1/1-613     AC H6V7I7.1
#=GS Q6XZS4_9RETR/1-204    AC Q6XZS4.1
#=GS GAG_SFV3L/1-607       AC P27400.1
#=GS Q6XZR5_9RETR/1-204    AC Q6XZR5.1
#=GS Q6XZS9_9RETR/1-204    AC Q6XZS9.1
#=GS Q6XZR4_9RETR/1-204    AC Q6XZR4.1
#=GS B3FXC6_9RETR/1-204    AC B3FXC6.1
#=GS Q6XZT0_9RETR/1-204    AC Q6XZT0.1
#=GS B3FXE4_9RETR/1-204    AC B3FXE4.1
#=GS B2CGB4_9RETR/1-375    AC B2CGB4.1
#=GS B2CGC1_9RETR/1-374    AC B2CGC1.1
#=GS B3FXF9_9RETR/1-204    AC B3FXF9.1
#=GS B3FXF1_9RETR/1-204    AC B3FXF1.1
#=GS B2CGB9_9RETR/1-375    AC B2CGB9.1
#=GS B3FXD3_9RETR/1-204    AC B3FXD3.1
#=GS Q45QF2_SFV1/1-610     AC Q45QF2.1
#=GS B3FXE2_9RETR/1-204    AC B3FXE2.1
#=GS B3FXG7_9RETR/1-204    AC B3FXG7.1
#=GS B3FXE0_9RETR/1-204    AC B3FXE0.1
#=GS GAG_FFV/1-171         AC O56860.1
#=GS B3FXF0_9RETR/1-204    AC B3FXF0.1
#=GS Q6XZR8_9RETR/1-237    AC Q6XZR8.1
#=GS Q6XZS8_9RETR/1-204    AC Q6XZS8.1
#=GS Q18FE8_HALWD/30-174   AC Q18FE8.1
#=GS Q6XZS0_9RETR/1-204    AC Q6XZS0.1
#=GS B2CGC3_9RETR/1-374    AC B2CGC3.1
#=GS Q9J4C8_9RETR/173-532  AC Q9J4C8.1
#=GS B3FXH6_9RETR/1-204    AC B3FXH6.1
#=GS B3FXE7_9RETR/1-204    AC B3FXE7.1
#=GS B3FXC8_9RETR/1-204    AC B3FXC8.1
#=GS B3FXF4_9RETR/1-204    AC B3FXF4.1
#=GS B3FXF3_9RETR/1-204    AC B3FXF3.1
#=GS E2GD56_9RETR/1-613    AC E2GD56.1
#=GS Q45QF1_SFV1/1-611     AC Q45QF1.1
#=GS Q6XZR2_9RETR/1-204    AC Q6XZR2.1
#=GS Q8ALU2_9RETR/1-173    AC Q8ALU2.1
#=GS B3FXG1_9RETR/1-204    AC B3FXG1.1
#=GS B3FXG2_9RETR/1-204    AC B3FXG2.1
#=GS Q77YG5_FOAMV/1-618    AC Q77YG5.1
#=GS B2CGB3_9RETR/1-375    AC B2CGB3.1
#=GS B2CGC5_9RETR/1-375    AC B2CGC5.1
#=GS B3FXE8_9RETR/1-204    AC B3FXE8.1
#=GS B3FXH0_9RETR/1-204    AC B3FXH0.1
#=GS B3FXD0_9RETR/1-204    AC B3FXD0.1
#=GS Q6XZR1_9RETR/1-204    AC Q6XZR1.1
#=GS B3FXD8_9RETR/1-204    AC B3FXD8.1
#=GS B3FXF6_9RETR/1-204    AC B3FXF6.1
#=GS B3FXD2_9RETR/1-204    AC B3FXD2.1
#=GS B2CGC2_9RETR/1-374    AC B2CGC2.1
#=GS B3FXH9_9RETR/1-204    AC B3FXH9.1
#=GS Q6XZS6_9RETR/1-204    AC Q6XZS6.1
#=GS B3FXG0_9RETR/1-204    AC B3FXG0.1
#=GS B2CGC0_9RETR/1-375    AC B2CGC0.1
#=GS A8HC77_9RETR/1-590    AC A8HC77.1
#=GS B3FXI2_9RETR/1-204    AC B3FXI2.1
#=GS B3FXH7_9RETR/1-204    AC B3FXH7.1
#=GS B2CGB1_9RETR/1-375    AC B2CGB1.1
#=GS B3FXG5_9RETR/1-204    AC B3FXG5.1
#=GS Q70LW5_FFV/1-173      AC Q70LW5.1
#=GS Q45QF4_SFV1/1-613     AC Q45QF4.1
#=GS Q6XZS2_9RETR/1-204    AC Q6XZS2.1
#=GS B3FXD1_9RETR/1-204    AC B3FXD1.1
#=GS Q6XZS1_9RETR/1-204    AC Q6XZS1.1
#=GS B3FXE5_9RETR/1-204    AC B3FXE5.1
#=GS Q6XZS5_9RETR/1-204    AC Q6XZS5.1
#=GS B3FXC4_9RETR/1-204    AC B3FXC4.1
#=GS Q6XZR3_9RETR/1-204    AC Q6XZR3.1
#=GS Q9J4C8_9RETR/1-181    AC Q9J4C8.1
#=GS B2CGB5_9RETR/1-375    AC B2CGB5.1
#=GS B2CGB6_9RETR/1-375    AC B2CGB6.1
#=GS B2CGB7_9RETR/1-375    AC B2CGB7.1
#=GS B3FXD9_9RETR/1-204    AC B3FXD9.1
#=GS Q8ALU2_9RETR/162-511  AC Q8ALU2.1
#=GS B3FXC3_9RETR/1-204    AC B3FXC3.1
#=GS B3FXG8_9RETR/1-204    AC B3FXG8.1
#=GS B3FXH4_9RETR/1-204    AC B3FXH4.1
B3FXE3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXC5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNVQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q7SIS7_9RETR/1-596               ......................................................MAAqNFELDVQELLNLFQDNGVTRNPRHLETIGLRMLGGWWGEQERYQSARIILQDD.DGEPLQVPRWEEVL.RPVNPLAH..FVISAPWDQLRRAFHDLDVGNGALRFGPLANGNYIPEDPYSTSYRPVNPQEMAQMQ..RD.ELEEVLEVQGEIELQMIDLIEMQTIEIRGLRQLVNELQRe...rdSGRGASIPGASSSP.PP.QSYVG.LPgm......psvSGLS.S..LQPE........ASSTPGG.....................RAPRVSFhpsNPFVRPPS.........PER...PRA....RSSE......rIPLPLQPPVIQYVPVPqp.vlaPA...PAPSPV..IPIQHIRAVTGEVPNNPRDIPMWIGRNAPAIEGVYPVTTPDLRARIINALIGGKSGIHLTAPEAVTWASAVAAIFTRTHGSFPMHNLSAILTGIANGEGVESAYNLGMMLSNGDFNLVYGIVRGLLPGQAAVAYMQQRLDAEPSDALRAQNFIQHLHLVYEIL.GLNHRGQSIR.tS..LPTS.TRPRGQGRG.RGQGQGSIPSTP.....----RRPQSGRGLSTPNR.GSNNA.---NNNT..QSNVQTETPRRSfGGYNLRPNTFRPQRYGGGQGQRRDS.......QPDRRS-QGSSQNNRPSAplESRG.EQSRGPGGGGRAGGR.RNQNRNSGQGNESSS-h...................................
P87702_FFV/1-173                 ......................................................MAR.--ELNPLQLQQLYINNGLQPNPGHGDVIAVRFTGGPWGPGDRWTRVAIRLQDN.TGQPLQVPGYGLEP.GIINLRED..ILIAGPYNLIRTAFLDLEPARGPERHGPFGDGRLQPGDGLSEGFQPITDEEMQAE-..--.----------------VGTIGAARNEIRLLREALQRLQV......GGVGRPIPGAILQP.QP.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------vig.................................
B3FXH3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR9_9RETR/1-213               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIEGVFPITTPDIRCRVVNALLGGSLGLAVEPVHCINWATVVATLYVRTHGSYPLHQLADVLRAVVNQEGIATAFTLGSMLTNNNFDLIWGVLRPLLPGQAVVTAMQQRLDQEINDAARIASFVGHLHDVYAIL.GLNARGQSIN..-..RSQG.VAQSGSSSS.TGRGRGRRNQQR.....QSVQPQPGQQRRSGQNNQ.GQGN-.-QNSNQR..QSSGGN---QGR.GGYNLRP------------------.......------------------..----.---------------.----------------....................................
B3FXE1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..TSVT.SQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNXVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPVSSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q45QF3_SFV1/1-610                ......................................................MAAiEGDLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTVLLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNLPVAGTPP.PP.PPSLE.PAap......spyVASA.P..LAPAa.....pvASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGTS.AGRGTRGRRSQQgtpgrQSSGQSQQQGRRSSQGQS.RQSDS.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPQS..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
B2CGB8_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLQGNLPVAGTPP.PP.PPSLD.LQpaaa...sspfV--A.P..LPPAp......aASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgt...gaaPVQ...PSA....PPAAspl.pslQPAQPMQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGSAPTNPREIXMWIGRNASAIEGVXPIPTPDIRCRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPIHQLAEVLRGVSNSEXVAAAWQLGMMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEVNDPARIVSFTNHLNAVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsv.................................
D5JWU5_9RETR/1-563               ......................................................MAR.-GNLDIARLTVLLQENSLSGNPPHLTHYVLRMTEGWWGPFPRYTRVRIILQDE.SGNPLSQPRWELVD.RMFNPLRD..PILETTLDEMDRVFDGINLSPGTERYGPLCDGNFLYTDDAWNDFNPMSALEVADVEltPA.LYREHLNFLSRVAEGMLGDIIMLKQENEDAHETITRLRE......RIINQPTSAPIITS.TP.GGVSG.LP...........PSV-.-..----........-------.....................YQPTGLH...ETYIQPSR.........PMQ...PSA....P---.......-PLPLMGDL-------......-G...SGILSV..LPISQIRTVIGNTPVDPKKVPLWIAKSASAIEGVMPTNTPDIRCRLVNALLPQHGGLILQPHECNSWTQIASALYTRVNGMIPLHALPQTLSQVTKEEGILVAYQIGMTFTGQNFPLTWGILRPLLPGQAVVAMMQGYLDQYPTDDLKAVNFASILRRVFDIL.GLNYMGQNIR..N..QSSP.SLTVSSARGaTGRGRGRSRNIG....rGRGTTPNFQGRGQPATTP.TVTTS.----GST..SSTTESQGRNSN.PNYNFRPRVNQPPRYGGGPNPYRNRep...lnNPPNRENTTQNNTRRPGSqgQNRNrNQNRTVNA-------.----------------vqvvpnqdntnqpninpnqnvst.............
B3FXH5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQPRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQPRP-SRG.RGRGQNSSRPSP.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q45QF5_SFV1/1-613                ......................................................MAAiEGDLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDD.QGQPLQQPRWRAEG.RAANPAVM..LTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNIPVADIPP.PP.PPSLD.LQpaaasspyvapASSA.P..AAPV........ASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSggs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPIVQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVVNALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVATSEGVAAAWQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIVSFITHLNGVYELL.GLNARGQSLR..-..ISAS.GGQTTAGTS.AGRGARGRRSQQgapgrQSSRQSQPQGGRSSQGQS.RQSDN.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPQS..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
B3FXH1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
O41893_9RETR/1-172               ......................................................MAL.-NDFDPIALQGYLPAPRVLQ---HNDIIICRATSGPWGIGDRYNLIRIHLQDP.AGQPLPIPQWEPIPnRTANPRTQpyPVVSAPMATLENILNNFHIPHGVSRYGPLEGGDYQPGEQYSQGFCPVTQAEIALLN..GQ.HLEE---------------------EITILREITHRLMQ......GVRPPAVPQGPAPP.PP.P----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------aq..................................
B3FXD5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
P87702_FFV/166-489               ....................................................lq---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......PQ...PVIGPV..IPINHLRSVIGNTPPNPRDVALWLGRSTAAIEGVFPIVDQITRMRVVNALVASHPGLTLTENEAGSWNAAISALWRKAHGAAAQHELAGVLSDINKKEGIQTAFNLGMQFTDGNWSLVWGIIRTLLPGQALVTNAQSQFDLMGDDIQRAENFPRVINNLYTML.GLNIHGQSIR..P..RVQT.QQQQPRSRN.QGRSQQGQLNQP.....----RPQNRNNQSYRPPR.QQQQH.SDVPEQR..DSRGPSQPPRGSgGGYNFRRNPQQPQRYGQGPPGP---.......NPYRRFGDGGNPQQQGPP..PNRGpDQGPRPGGNPRGGGR.GQGPRNGGGSVPQYT-q...................................
B3FXI0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZS7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQNNRgSNTQNQN..QDNLNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q45QF6_SFV1/1-613                ......................................................MAAiEGDLDVQALTNMFNDLGINRDPRHREVIALRMTGGWWGPATRYNLVTILLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMPFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNIPVAGTPP.PP.PPSLD.IQpaaasspyvapASSA.P..AAPV........ASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPVAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIVSFITHLNGVYELL.GLNARGQSLR..-..IPTS.GGQTTAGTS.AGRGARGRRSQQgapgrQSTGQSQQQGRRTSQGQS.RQPDN.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QSARSDNPQRSQSQQPQS..EARG.DQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
Q6XZS3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSS-------.-------------------------.......------------------..----.---------------.----------------pggy................................
B3FXF7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.DQNNRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q98826_9RETR/1-618               ..............................................masgsnve---.EYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQDD.DNEPLQRPRYEVIQ.RAVNPHTM..FMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMT..RD.ELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSS......TGQGGISPGAPRSR.PPvSSFSG.LPsl......psiPGIH.P..RAPSp.....prATSTPGNipwslgdds...ppsssfpgpSQPRVSFhpgNPFVEEEGh......rpR--...--S....QSRErrreilpAPVPSAPPMIQYIPVP......PP...PPIGTV..IPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQSNRgSSTQNQN..QDNLNQ------.GGYNLRPRTYQPQRYGGGRGRRWNDntnnqesRPSDQGSQTPRPNQAG-S..GVRG.NQSQTPRPAAGRGGR.GNHNRNQRSSGAGDS-r...................................
D5JWV0_9RETR/1-611               .............................................maqgdpiin---.QGDLNVVELTHLLRENGLPGNPRNGQTYAIAMTEGWWGDHPRYRIIRVVFQDT.SGNPLSQPQWMDED.RQMNPLQD..PVVGCTFNQASRVFDQIDIGEGPSRFGPLADGMFLITDNAWMDFVPLSAMEITDIN..NErTLRDHLTFCCTLLENMMADIIVTQRENRDL-----NTTI......NNLRATIPVASQAL.PH.SSLPA.TP...........MAAStP..GGPSg......lPPSTFNI.....................GAVGPSY...QPPAQLPSapp...ialPVI...PSA....PLAP......aVPLPQSQPP-QPMYNPy...mmAG...NLQGNV..LPISQIKAVIGETPTDHKAVPLWVAKHAAAIEGVFPTGSPEVRCRVLNSLLTGHGGMMLHPVDCVSWTNAASVLFQRVHGVVPLHQLPKTLEEVAKTEGLLVAYNIGMTFTSNNFDLIWGIIRPLVPGQAAVAMLQGYLDQYPRPQDKIEHFPRFLRRTFEVL.GLNFLGQSIR..-..-STQ.APSRPNSAN.RGTNTARGRGGN.....----RGRGRGRGVPPGPP.PGRGT.ATPQAAG..TSRSSSGSFGEQ.PRYNLRPQVNRPSRYGGGPN-PARN.......NPEPQGGD-TSSTPRGQG..ERSG.RQRNNNARQNQQPPR.R-PD------------rtvntvrtaqpnptvasgsqddnstppstargseen
B3FXG6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISKPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
GAG_SFVCP/1-623                  ..............................................masgsnve---.EYELDVEALVVILRDRNIGRNPLHGEIIGLRLTEGWWGQLERFQMVRLILQDE.DNEPLQRPRHEIIP.RAVNPHTM..FVLSGPLAELQLAFQDLDLPEGPLRFGPLANGHYVEGDPYSRSYRPVTMAETAQMT..RD.ELEDTLNTQSEIEIQMINLLELYEVETRALRRQLAERSS......IGQGGISPGASHSR.PPvSSFSG.LPsl......paiPGIH.T..RAPSp.....prATSTPGNiprslgddn...mpsssfagpSQPRVSFhpgNPFAEAEGhrprsqsreR-RrdiPSA....PVIS.......APVPSAPPMIQYIPVP......PP...PPVGAV..IPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPEPSQ.....----GPVNSGRGRQCPAP.GQNDRgSNIQNQG..QENSSQ------.GGYNLRSRTYQPQRYGGGRGRRWNEntnnsetRPTEQSPQTPRPIQAG-S..GVRG.NQSQTYKPAAGRGGR.GNQNRNQRSSGAGDS-r...................................
B4HBJ4_DROPE/67-155              .........................stgyspefvvqrgesrlpralydeetigt---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....---------GQASKTPDE.DARKL.KKLYQLV..RRNLEKAAQDQA.RHYNLRRRPWKPQRYGG--------.......------------------..----.---------------.----------------vpfngalate..........................
B3FXC2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQEIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQPRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQS..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q70LW5_FFV/166-489               ....................................................lq---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......PQ...PVIGPV..IPINHLRSVIGNTPPNPRDVALWLGRSTAAIEGVFPIVDQITRMRVVNALVASHPGLTLTENEAGSWNAAISALWRKAHGAAAQHELAGVLSDINKKEGIQTAFNLGMQFTDGNWSLVWGIIRTLLPGQALVTNAQSQFDLMGDDIQRAENFPRVINNLYTML.GLNIHGQSIR..P..RVQT.QQQQPRSRN.QGRSQQGQLNQP.....----RPQNRNNQSYRPPR.QQQQH.SDVPEQR..DSRGPSQPPRGSgGGYNFRRNPQQPQRYGQGPPGP---.......NPYRRFGDGGNPQQQGPP..PNRGpDQGPRPGGNPRGGGR.GQGPRNGGGSAAAV--ht..................................
GAG_FFV/165-489                  ...................................................vlq---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......PQ...PVIGPV..IPINHLRSVIGNTPPNPRDVALWLGRSTAAIEGVFPIVDQVTRMRVVNALVASHPGLTLTENEAGSWNAAISALWRKAHGAAAQHELAGVLSDINKKEGIQTAFNLGMQFTDGNWSLVWGIIRTLLPGQALVTNAQSQFDLMGDDIQRAENFPRVINNLYTML.GLNIHGQSIR..P..RVQT.QPLQTRPRN.PGRSQQGQLNQP.....----RPQNRANQSYRPPR.QQQQH.SDVPEQR..DQRGPSQPPRGSgGGYNFRRNPQQPQRYGQGPPGP---.......NPYRRFGDGGNPQQQGPP..PNRGpDQGPRPGGNPRGGGR.GQGPRNGGGSAAAV--ht..................................
Q45QE9_SFV1/1-613                ......................................................MAAiEGDLDVQALTNMFNDLGINRDPRHREVIALRMTGGWWGPATRYNLVTILLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMPFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNIPVAGTPP.PP.PPSLD.IQpaaasspyvapASSA.P..AAPV........ASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPVAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIVSFITHLNGVYELL.GLNARGQSLR..-..IPTS.GGQTTAGTS.AGRGARGRRSQQgapgrQSTGQSQQQGRRTSQGQS.RQPDN.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QSARSDNPQRSQSQQPQS..EARG.DQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
B3FXE6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXC1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQSRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
GAG_FOAMV/1-618                  ..............................................masgsnve---.EYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQDD.DNEPLQRPRYEVIQ.RAVNPHTM..FMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMT..RD.ELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSS......TGQGGISPGAPRSR.PPvSSFSG.LPsl......psiPGIH.P..RAPSp.....prATSTPGNipwslgdds...ppsssfpgpSQPRVSFhpgNPFVEEEGh......rpR--...--S....QSRErrreilpAPVPSAPPMIQYIPVP......PP...PPIGTV..IPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDNQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQSNRgSSTQNQN..QDNLNQ------.GGYNLRPRTYQPQRYGGGRGRRWNDntnnqesRPSDQGSQTPRPNQAG-S..GVRG.NQSQTPRPAAGRGGR.GNHNRNQRSSGAGDS-r...................................
B3FXC7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQNNRgSNTQNQN..QDNSNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGB2_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaa...sspyV---.-..--AP........ASSAPAApvvsadlgwfaggpspgsvdpRLARVAY...NPFLPGPSdgs...rvaPVQ...PSA....PPXAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
Q45QF0_SFV1/1-610                ......................................................MAAiEGDLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTVLLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNLPVAGTPP.PP.PPSLE.PAap......spyVASA.P..LAPAa.....pvASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGTS.AGRGARGRRSQQgtpgrQSSGQSQQQGRRSSQGQS.RQSDS.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPQL..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
B2CGC4_9RETR/1-374               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDVADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQMQ..RD.EMEEILDIVGQIMMQMSDLIGMQDVQIRGL-----ENQV......RGLRGNLPVAGTPP.PP.PPSLDmQP..........aAASS.P.fVAPIpp....pvASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....PPAAspl.palQPAQPFQPIIQYVHPP......PV...NPAQQI..IPIQHIRAVTGNAPSNPRDIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVSNSEGVAAAWQLGMMLTNQDYNLVWGIVRPLLPGQAVVTALQHRLDQEVSDPARIVSFINHLNAVYEIL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsa.................................
B3FXH2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXE9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSS.....----GPATSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXI1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSALGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQSRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPTS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXH8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQSRP-SRG.TGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXC9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGIFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQNTSRPAQ.....----GPANSGRGRQRPAS.GQFDRgSNNQNQS..QGNTGQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
O41893_9RETR/166-511             ....................................................pp---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...------PP.........PAQ...PPA....P---.......LPAPPIGPPPPAAPAPa...pgPM...PVPQH-..LPITHIRAVIGETPANIREVPLWLARAVPALQGVYPVQDAVMRSRTVNALTVRHPGLALEPLECGSWQECLAALWQRTFGATALHALGDTLGQIANSDGIVMAIELGLLFSDDNWDLVWGICRRFLPGQAVCVAVQARLDPLPDNATRIVMISHIIRDVYAIL.GLDPLGRPMQ.qT..LPRR.NNQPPRQQP.QRRQQ-PRRTGN.....QEERGQRNRGRQNAQTPR.QEGNRlQNSQLPG..PRDCPNNSNQ--.PRYPLRPNPQQPQRYGQEQNRGNNP.......NPYRQPTPGNGNQNR---..----.NFSRGPAPVNEQS--.RGRGRSSQGTNNTGS-s...................................
GAG_SFV1/1-613                   ......................................................MAAiEGDLDVQALANLFNDLGINRNPRHREVIALRMTGGWWGPATRYNLVSLLLQDD.QGQPLPQPRWRAEG.RAANPAVM..FTLEAPWQDLRLAFDNIDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQMQ..RD.ELEEVLDVVGQITMQMNDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.LQpaaa...sspyVAPA.P..SAPA........ASAAAADlgwfagg......pgpgsldpRLARVAY...NPFLPGPSdgs...gaaPAQ...PSA....PPVAspl.pslLPAQPMQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPSNPREIPMWIGRNASAIEGVFPIPTSDIRSRVINALLGRQLGLNLDPQHCITWASAIATLYVRTHGSYPLHQLAEVLRRVSNSEGAAAAWQLGMMLTNQDYNLVWGMVRPLLPGQAVVTAMQHRLDQEVSDAARIVSFVNHLNAVYELL.GLNARGQNLR..-..-VST.GGQTTARTS.AGRGARGRRSQQgtpgrQSSGQAPPQGRRSSQGQQpRQSES.GDQNNQR..QLQGGN----NR.GGYNLRPRTYQPQRYGGGRGRRWND.......QTARADNQQRSQSQQPQS..EARG.EQSRTSGAGREQGGR.GNQNRNQRSAGENTD-r...................................
B3FXF5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDReSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q0PEK1_9RETR/1-80                ...................................................rnn---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.--QPP----.--RQQPQRRQQPrrtgnQEERGQRNRGRQNAQTPR.QEGNRlQNSQLPG..PRDYPNNSNQ--.PRYPLRPNPQQPQRYGQE-------.......------------------..----.---------------.----------------....................................
H6V7I7_SFV1/1-613                ......................................................MAAvEGDLDVQALTNLFNDLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDD.QGQPLPQPRWRAEG.RAANPAVM..FTLEAPWQDLRMPFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLGGNLPVAGTPP.PP.PPSLD.IQpaaasspyvapAPSA.P..SAPA........AAADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....LPVAspl.pslPPAQPMQPVIQYVPPP......PY...NPAQQV..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAVATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAWQLGMMLTNRDYNLIWGIVRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGAS.AGRGTRGRRSQQgapgrQSSGPSQQQGRRSSQGQP.RQSDF.SDQNNQR..QAQGGN----GG.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPRS..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
Q6XZS4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQGAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSS-------.-------------------------.......------------------..----.---------------.----------------pggy................................
GAG_SFV3L/1-607                  .....................................................m-G-.DHNLNVQELLNLFQNLGIPRQPNHREVIGLRMLGGWWGPGTRYILVSIFLQDD.SGQPLQQPRWRPEG.RPVNPLVH..NTIEAPWGELRQAFEDLDVAEGTLRFGPLANGNWIPGDEYSMEFQPPLAQEIAQMQ..RD.ELEEILDITGQICAQVIDLVDMQDAQIRGLERRIQDR--......LGLRDNLPVAGIQA.PP.SSPIG.QP...........IASS.S..LQPIp......gSSSSPADldgiwt.........prqidpRLSRVAY...NPFLPGSSdgs..ggsiPVQ...PSA....PPAVlps.lpsLPAPVSQPIIQYVAQP......PV...PAPQA-..IPIQHIRAVTGNTPTNPRDIPMWLGRHSAAIEGVFPMTTPDLRCRVVNALIGGSLGLSLEPIHCVNWAAVVAALYVRTHGSYPIHELANVLRAVVTQEGVATGFQLGIMLSNQDYNLVWGILRPLLPGQAVVTAMQQRLDQEVNDAARITSFNGHLNDIYQLL.GLNARGQSIA..-..RAQS.ASTSGNSAS.AGRGRRGQRTQQ.....QAGRQQQQQTRRTNQGNQ.GQRD-.---NNQR..QSSGGNQGQRGQ.GGYDLRPRTYQPQRYGGGRGRRWNDnqqqqqaQPGRSSDQPRSQSQQPQP..EARG.DQSRTSGAGRGQQGR.GNQNRNQRRADANNTR....................................
Q6XZR5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQGAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZS9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQGAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSS-------.-------------------------.......------------------..----.---------------.----------------pggy................................
B3FXC6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQGAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZT0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXE4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGB4_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaa...sspyV---.-..--AP........ASSAPAApvvsadlgwfaggpspgsvdpRLARVAY...NPFLPGPSdgs...rvaPVQ...PSA....PPVAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
B2CGC1_9RETR/1-374               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQMQ..RD.EMEEILDIVGQIMMQMSDLIGMQDVQIRGL-----ENQV......RGLRGNLPVAGTPP.PPpPSLDX.QP...........AAAS.SpfVAPIpp....paASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....PPAAspl.pxlQPAQPXQPIIQYVHPP......PV...NPAQQX..IPIQHIRAVTGNAPSNPRDIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTXXPQHCITWASAIATLYVRTHGSYPXHQLAEVLRGVSNSEGVAAAWQLGMMLTNQDYNLVWGIVRPLLPGQAVVTAXQHRLDQEVSDPARIVSFINHLNAVYEIL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsa.................................
B3FXF9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYFPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SKG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPVSSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGB9_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMXDLIGMQDAQIRGL-----EGQL......RGLQGNLPVAGTPP.PP.PPSLD.LQpaaa...sspfV--A.P..LPPAp......aASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdxt...gaaPVQ...PSA....PPAAspl.pslQPAQPMQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGSAPTNPREIPMWIGRNASAIEGVFPIPTPDIRCRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPIHQLAEVLRGVSNSEGXAAAWQLGMMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEVNDPARIVSFTNHLNAVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsv.................................
B3FXD3_9RETR/1-204               .....................................................v---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..------------------------------IDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPPQ.....----GPANSGRGRQRPAP.GQNYRgSNIQNQG..QGNLSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q45QF2_SFV1/1-610                ......................................................MAAiEGDLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTVLLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNLPVAGTPP.PP.PPSLE.PAap......spyVASA.P..LAPAa.....pvASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGTS.AGRGTRGRRSQQgtpgrQSSGQSQQQGRRSSQGQS.RQSDS.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPQS..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
B3FXE2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXE0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
GAG_FFV/1-171                    ......................................................MAR.--ELNPLQLQQLYINNGLQPNPGHGDIIAVRFTGGPWGPGDRWARVTIRLQDN.TGQPLQVPGYDLEP.GIINLRED..ILIAGPYNLIRTAFLDLEPARGPERHGPFGDGRLQPGDGLSEGFQPITDEEIQAE-..--.----------------VGTIGAARNEIRLLREALQRLQA......GGVGRPIPGAVLQP.QP.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------v...................................
B3FXF0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPVSSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR8_9RETR/1-237               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----IRAVTGEPPRNPREIPIWLGRNAPAIEGVFPVNSPEVRCRVINAIIGGNLGLALTPTECATWDSAVATLFIRTHGTYPMHQLGNVIKGIVDQEGVATGYTLGMMLSGQNFPLVYGIIRGFLPGQAVVTAIQQRLDQEIDDQTRSDTFIQHLNAVYEIL.GLNARGQSIR..-..TGAN.STPRP-TRG.RGRGISRQSQSA.....----PGAGRGRQRSDGNL.QDNNP.-SSQNQG..QSNNNQ------.RGYNLRPRTYQPAR-----------.......------------------..----.---------------.----------------....................................
Q6XZS8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQNNRgSNTQNQN..QDNLNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q18FE8_HALWD/30-174              iiamsgisvafgigilartlgyavgvnftlplrginttllsgfgviltvvgivs---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..------------------------------------------------------------------------------------------------------------------------------------------------------LISGLITLVYKLIvDAVSRGAQMAsnS..RSKS.QSRSSQSKT.NARTQSNRAPPP.....QSQQQSPTQSQQSPQSRS.TQRST.PRSTQNT..DSE---------.-------------------------.......------------------..----.---------------.----------------ttpgrr..............................
Q6XZS0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGC3_9RETR/1-374               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQMQ..RD.EMEEILDIVGQIMMQMSDLIGMQDVQIRGL-----ENQV......RGLRGNLPVAGTPP.PP.PPSLDmQP..........aAASS.P.fVAPIpp....paASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....PPAAspl.palQPAQPFQPIIQYVHPP......PV...NPAQQI..IPIQHIRAVTGNAPSNPRDIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVSNSEGVAAAWQLGMMLTNQDYNLVWGIVRPLLPGQAVVTALQHRLDQEVSDPARIVSFINHLNAVYXIL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsa.................................
Q9J4C8_9RETR/173-532             ..................................................vgpl---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...------PA.........PAQ...PP-....----.......IPGPPVPPPVPPPAPPap.vnpPV...PPVQPIhhLPITHIRAVIGETPAQIRDVPLWLAQSIPALTGVYPAMDAGTLTRLVNAITARHPGLALGMNEAGSWHEAVHLIWQRTFGATALHALSDVLKGIAQRNGVVMALEMGLMFTNDDWDLTWSVIRRCLPGQASVVTIQARLDALPNNQARIIQAGFIIREVYEVL.GLDPLGRPLN.fPggLTQR.DTAVPVTRG.RGRGRTGPRRGPvlpvsSNQRRQETAGGNQPQTQP.QQQNTfSNQTNQRgnQRQWQNRGTDSQ.RRYFFRPRPSQPQRYGSNQG-PDNP.......NPYR----GRDSTNQ---..----.SGQERQLPQQQQGSR.RGPGRNTNSGNNTVH-t...................................
B3FXH6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQPRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSDTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXE7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXC8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSISRPSS.....----GPTNSGRGRQRPAS.GQFDRgSNNQNQN..QGNIXQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
E2GD56_9RETR/1-613               ..............................................masnsnve---.EYLLDVEALVDILRERHIPRNPMHQEIIGLRMTEGWWGQMERFQMTRLILQDD.DGEPLQQPRYEVVP.RAVNPRTQ..FVISGTLAELRLAFLELDLPEGALRYGPLANGHYIQGDPYSLSYRPVTMAETAHMT..RD.ELEDVLNVQSEIGIQLINILELQEVEVRALRRQLAENSS......VRRGGMSPGAPIPR.PPvSSYAG.LPsl......ppaPGIF.P..SAPSp.....pqASSTPGQrpwslgnd....ldqsvipgpSQPRVSFhpsNPFQIDSV.........P-R...PRSasreRPAV.......ETQPSAPPLIQYVPVP......PPvfpPSVNTV..IPIQHIRAVTGEPPRNPREIPIWLGRNAPAIEGVFPVNSPEVRCRVINAIIGGNLGLALTPTECATWDSAVATLFIRTHGTYPMHQLGNVIKGIVDQEGVATGYTLGMMLSGQNFPLVYGIIRGFLPGQAVVTAIQQRLDQEVDDQTRSDTFIQHPNAVYEIL.GLNARGQSIR..-..TGAN.STPRP-TRG.RGRGISRQSQSA.....----PGAGRGRQRSDGNL.QDNNP.-SSQNQG..QSNSNQ------.RGYNLRPRTYQPARYGGGRGRRWSDnt..qtnRQTESSTQNPRQAQTG-Q..GVRG.DQSRAPRSGASRGGR.GNQNRNQRPSGSGDS-h...................................
Q45QF1_SFV1/1-611                ......................................................MAAiEGDLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDD.QGQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQI......RGLRGNLPVAGTPP.PP.PPSLE.PAaap.....spyVAPA.P..LAPAa.....pvASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGTS.AGRGARGRRSQQgtpgrQSSGQAQQQGRRSSQGQS.RQSDS.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QPARSDNQQRSQSQQPQL..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
Q6XZR2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCVTWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRTSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q8ALU2_9RETR/1-173               ......................................................MAL.-NDFDPIALQGYLPAPRVLQ---HNDIIICRATSGPWGIGDRYNLIRIHLQDP.AGQPLPIPQWEPIPnRTANPRTQpyPVVSAPMATLENILNNFHIPHGVSRYGPLEGGDYQPGEQYSQGFCPVTQAEIALLN..GQ.HLEE---------------------EITILREITHRLMQ......GVRPPAVPQGPAPP.PP.PA---.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------qp..................................
B3FXG1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQCPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q77YG5_FOAMV/1-618               ..............................................masgsnve---.EYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRLILQDD.DNEPLQRPRYEVIQ.RAVNPHTM..FMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQMT..RD.ELEDVLNTQSEIEIQMINLLELYEVETRALRRQLAERSS......TGQGGISPGAPRSR.PPvSSFSG.LPsl......psiPGIH.P..RAPSp.....prATSTPGNipwslgdds...ppsssfpgpSQPRVSFhpgNPFVEEEGh......rpR--...--S....QSRErrreilpAPVPSAPPMIQYIPVP......PP...PPIGTV..IPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDNQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.GQSNRgSSTQNQN..QDNLNQ------.GGYNLRPRTYQPQRYGGGRGRRWNDntnnqesRPSDQGSQTPRPNQAG-S..GVRG.NQSQTPRPAAGRGGR.GNHNRNQRSSGAGDS-r...................................
B2CGB3_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaa...sspyV---.-..--AP........ASSAPAApvvsadlgwfaggpspgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
B2CGC5_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQMQ..RD.EMEEILDIVGQIXMQMSDLIGMQDAQIRGL-----ENQV......RGLRGNLPVAGTPP.PP.PPSLD.LQpaaa...sspfV---.-..-APVppapavsgAA----Adlgxfagg.....pssgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....PPAAspl.pslQPAQPMQPIIQYVHPP......PV...NPAQQV..IPIQHIRAVTGNAPSNPREIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLNLDPQHCITWASAIATLYVRTHGSYPLHQLAEVLRGVANSEGVAAAWQLGMMLTNQDYNLVWGMVRPLLPGQAVVTAMQHRLDQEVSDPARIVSFVNHLNAVYEIL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsa.................................
B3FXE8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SKG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXH0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIRHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPVS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCVTWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRTSQ.....----GSANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXF6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPTP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGC2_9RETR/1-374               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQMQ..RD.EMEEILDIVGQIMMQMSDLIGMQDVQIRGL-----ENQV......RGLRGNLPVAGTPP.PP.PPSLDmQP..........aAASS.P.fVAPIpp....paASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgs...gaaPVQ...PSA....PPAAspl.palQPAQPFQPIIQYVHPP......PV...NPAQQI..IPIQHIRAVTGNAPSNPRDIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVSNSEGVAAAWQLGMMLTNQDYNLVWGIVRPLLPGQAVVTALQHRLDQEVSDPARIVSFINHLNAVYEIL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsa.................................
B3FXH9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQSRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZS6_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG0_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SKG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGC0_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLQGNLPVAGTPS.PP.PPSLD.LQpaa.....assP---.F..VAPIpp...aaaA--SAAAadlgwfag....gpssgsvdpRLARVAY...NPFLPGPSdgv...gaaPVQ...PSA....PPAAspl.pslQPAQPMQPVIQYVHPP......PV...NPAQQV..IPIQHIRAVTGNAPTNPREIPMWVGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPMHQLAEVLRGVSNSEGVAAAWQLGIMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEINDPARIVSFTNHLNAVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsv.................................
A8HC77_9RETR/1-590               ................................................maqgnq---.PEHIDIGHLTILLRENGLPTNPPHGTEYAVRMTEGWWGDYARFTVIRVAFQDN.QGNPLPRPEWEYIN.RDVRPLND..SIIGCTFRQAQQAFNNIDLARTPSRYGPLSNGLFLITDPEWLTFNPLSAVEIADLD..DQ.EIRDFLAHATIVLDNVMADVVIQQREIEDLTKTNLRLRNalassgTYQPIGMPIAQSSPaGP.SASVA.GP..........hMPAM.P..SVPY........ISAIPSA.....................PPA----...-PIPVAPA.........AAP...PLG....PLPS.......APAPPVLPVIQPNTFGtdgngyTA...VGPVPV..LPIAQIKAVIGEAPTDARQIPLWVAKHAAAIEGTFPTGSADVRCRVLNALLTSHGGMTLSPNECGTWSLAAAALYQRIYGVIPLHDLPHTMAEVARREGILVAFNMGMTFTNNSFDVVWGIIRPLLPGQASVAMLQGYLDQYQGQQQKAQAFPTLLRRTFETL.GLNYLGQSIR.sN..QPARtSGSVAGSIT.QGRGRGQPRSRP.....-PNRASNRSNNPPRPPPP.RSQEQ.QPSPAGR..GSSSSSAPPQ-R.SGYNLRQQINRPQRLGGGPN-----.......-PYRNLENRNIPRSETVP.sSRRA.ETSETNRPNQARGGQqGSSNRNQTRSINT---vra.................................
B3FXI2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXH7_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEIL.GLNTRGQSIR..-..ASVT.PQPRP-SRG.RGRGQNSSRPSQ.....----GPANSGRGRQRPAS.GQNERgSNTQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B2CGB1_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaafspyvapASSA.P..AAPV........VSADLGWfaggps.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPVAspl.lplPPAQPVQPVIQYVHPP......PV...NPAQQV..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
B3FXG5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SKG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q70LW5_FFV/1-173                 ......................................................MAR.--ELNPLQLQQLYINNGLQPNPGHGDVIAVRFTGGPWGPGDRWTRVAIRLQDN.TGQPLQVPGYGLEP.GIINLRED..ILIAGPYNLIRTAFLDLEPARGPERHGPFGDGRLQPGDGLSEGFQPITDEEMQAE-..--.----------------VGTIGAARNEIRLLREALQRLQV......GGVGRPIPGAILQP.QP.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------vig.................................
Q45QF4_SFV1/1-613                ......................................................MAAiEGDLDVQALANLFNDLGINRNPRHREIIALRMTGGWWGPAVRYNLVTLLLQDD.QGQPLQQPRWRAEG.RPANPVVM..FTLEAPWQDIRLAFDNIDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQMQ..RD.ELEEILDVVGQITMQMNDLIGMQDAQIRGL-----EGQL......RGLRGNLPGAGTPP.PP.PPSLD.LQpaaasspyaapAPSA.P..AAPA........ASADLGWfaggpn.........lgsvdpRLARVAY...NPFLPGPSdgs...gtaPVQ...PSA....PPVAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELL.GLNARGQSLR..-..IPAS.GGQTTAGTS.AGRGARGRRSQQgtpgrQSSGQSQQQGRRSSQGQS.RQSDS.SDQNVQR..QSQGGN----GR.GGYNLRPRTYQPQRYGGGRGRRWND.......QSARSDNQQRSQSQQPQS..EARG.EQSRTSGAGRGQGGR.GNQNRNQRSAGGNAD-r...................................
Q6XZS2_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSTPRPSQ.....----GPASSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXD1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAP.GQNNRgSNTQNQN..QDNSNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZS1_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQGAPRPSQ.....----GPANSGRGRQRLAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXE5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQSISRPSS.....----GPANSGRGRQRPAS.GQFDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZS5_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSASRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXC4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIIDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAP.GQNNRgSNTQNQN..QDNSNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q6XZR3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSAPRPSQ.....----GPANSGRGRQRPAP.GQNDRgSNIQNQG..QGNSSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q9J4C8_9RETR/1-181               ......................................................MAQ.NETFDPVALQGYYPAGGILA---DNDIINIRFTSGQWGIGDRWLQVRLRLVDPnTGQPLAQPEYE---.DTGLPAENrgIVVAVSHNAARNIFNNVQPAGGPNRHGPLHDGQFQVGDDPSEHFVPIEENLIPQE-..--.----------------IVNLGAARREVRLLREMCVRLLHv...rrQMMGMGMPGAIQPQ.PPvGPLP-.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------.----------..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------apaq................................
B2CGB5_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENVLDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaasspyvapASSA.P..AAPV........ASADLGWfaggpg.........pgsvdpRLARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPVAspl.lplPPAQPVQPIIQYVHPP......PI...NPAQQI..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
B2CGB6_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLRGNLPVAGTPP.PP.PPSLD.IQpaaasspyvapASSA.P..AAPV........ASADLGWfaggpg.........pgsvdpRMARVAY...NPFLPGPSdgs...gvaPVQ...PSA....PPAAspl.lplPPAQPVQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------ipa.................................
B2CGB7_9RETR/1-375               ......................................................---.-----------------------------------------------------.--------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQMQ..RD.ELENILDIVGQITMQMSDLIGMQDAQIRGL-----EGQL......RGLQGNLPVAGTPP.PP.PPSLD.LQpaaa...sspfV--A.P..LPPAp......aASAAAADlgwfagg......pssgsvdpRLARVAY...NPFLPGPSdgt...gaaPVQ...PSA....PPAAspl.pslQPAQPMQPVIQYVHPP......PI...NPAQQV..IPIQHIRAVTGSAPTNPREIPMWIGRNASAIEGVFPIPTPDIRCRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPIHQLAEVLRGVSNSEGVAAAWQLGMMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEVNDPARIVSFTNHLNAVYELL.GLNARGQSLR..-..----.---------.------------.....------------------.-----.-------..------------.-------------------------.......------------------..----.---------------.----------------lsv.................................
B3FXD9_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQSISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNTSQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
Q8ALU2_9RETR/162-511             ..................................................qgpa---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...----PPPP.........PAQ...PPA....P---.......LPAPPIGPPPPAAPAPa...pgPM...PAPQH-..LPITHIRAVIGETPANIREVPLWLARAVPALQGVYPVQDAVMRSRTVNALTVRHPGLALEPLECGSWQECLAALWQRTFGATALHALGDTLGQIANSDGIVMAIELGLLFSDDNWDLVWGICRRFLPGQAVCVAVQARLDPLPDNATRIVMISHIIRDVYAIL.GLDPLGRPMQ.qT..LPRR.NNQPPRQQP.QRRQQ-PRRTGN.....QEERGQRNRGRQNAQTPR.QEGNRlQNSQLPG..PRDCPNNSNQ--.PRYPLRPNPQQPQRYGQEQNRGNNP.......NPYRQPTPGNGNQNR---..----.NFSRGPAPVNEQS--.RGRGRSSQGTNNTGS-s...................................
B3FXC3_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVITPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNTSRPSQ.....----GPANSGRGRQRPAS.SQNNRgSNTQNQN..QDNSNQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXG8_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.SQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
B3FXH4_9RETR/1-204               ......................................................---.-----------------------------------------------------.--------------.--------..--------------------------------------------------------..--.---------------------------------------......--------------.--.-----.--...........----.-..----........-------.....................-------...--------.........---...---....----.......----------------......--...------..-----------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEIL.GLNARGQSIR..-..ASVT.PQPRP-SRG.RGRGQNISRPSP.....----GPANSGRGRQRPAS.GQYDRgSNNQNQN..QGNISQ------.-------------------------.......------------------..----.---------------.----------------ggy.................................
#=GC seq_cons                    ...........................................................................................................................................................................................................................................................................................................................................................................................................................................................AIDGVFPlTTPDLRCRIINAlLGGNLGLSLTPuDClTWDSAVuTLFlRTHGpaPhHQLGsVlpGIsNQEGVATAYTLGMMLSGQNYsLVSGIIRGaLPGQAVVTAhQQRLDQElDDQARAETFIpHLNAVYEIL.GLNARGQSIR.....ASVT.sQPRP.SRG.RGRGQstsRPSp.........GPAsSGRGRQRPAs.GQ.-RGSNsQNQs..QuNsuQ................................................................................................uGh.................................
//
DBGET integrated database retrieval system