GenomeNet

Database: Pfam
Entry: Gag_spuma
LinkDB: Gag_spuma
Original site: Gag_spuma 
#=GF ID   Gag_spuma
#=GF AC   PF03276.10
#=GF DE   Spumavirus gag protein
#=GF AU   Mifsud W
#=GF SE   Pfam-B_1878 (release 6.5)
#=GF GA   19.60 19.60;
#=GF TC   20.30 20.20;
#=GF NC   19.20 19.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9261397
#=GF RT   Characterization of the genome of feline foamy virus and its
#=GF RT   proteins shows distinct features different from those of primate
#=GF RT   spumaviruses. 
#=GF RA   Winkler I, Bodem J, Haas L, Zemba M, Delius H, Flower R, Flugel
#=GF RA   RM, Lochelt M; 
#=GF RL   J Virol 1997;71:6727-6741.
#=GF DR   INTERPRO; IPR004957;
#=GF DR   MEROPS; A9;
#=GF SQ   1484
#=GS R9XZM2_9RETR/1-375    AC R9XZM2.1
#=GS R9XZI9_9RETR/1-375    AC R9XZI9.1
#=GS R9XZ19_9RETR/1-375    AC R9XZ19.1
#=GS R9Y1V3_9RETR/1-375    AC R9Y1V3.1
#=GS B3FXE3_9RETR/1-204    AC B3FXE3.1
#=GS R9Y144_9RETR/1-373    AC R9Y144.1
#=GS R9Y161_9RETR/1-375    AC R9Y161.1
#=GS U5NHW4_9RETR/1-375    AC U5NHW4.1
#=GS R9Y0D1_9RETR/1-375    AC R9Y0D1.1
#=GS R9Y207_9RETR/1-375    AC R9Y207.1
#=GS R9XY42_9RETR/1-375    AC R9XY42.1
#=GS R9XYI0_9RETR/1-375    AC R9XYI0.1
#=GS U5NHT9_9RETR/1-375    AC U5NHT9.1
#=GS U5NKX1_9RETR/1-375    AC U5NKX1.1
#=GS R9Y1P5_9RETR/1-375    AC R9Y1P5.1
#=GS U5NH90_9RETR/1-375    AC U5NH90.1
#=GS U5NH62_9RETR/1-375    AC U5NH62.1
#=GS R9Y1G6_9RETR/1-375    AC R9Y1G6.1
#=GS U5NGN9_9RETR/1-375    AC U5NGN9.1
#=GS U5NHQ3_9RETR/1-375    AC U5NHQ3.1
#=GS U5NIB4_9RETR/1-375    AC U5NIB4.1
#=GS U5NI06_9RETR/1-375    AC U5NI06.1
#=GS U5NI95_9RETR/1-375    AC U5NI95.1
#=GS R9Y165_9RETR/1-375    AC R9Y165.1
#=GS U5NH35_9RETR/1-375    AC U5NH35.1
#=GS R9XZN1_9RETR/1-375    AC R9XZN1.1
#=GS R9Y290_9RETR/1-373    AC R9Y290.1
#=GS R9Y0B4_9RETR/1-375    AC R9Y0B4.1
#=GS R9XZ72_9RETR/1-375    AC R9XZ72.1
#=GS U5NKK5_9RETR/1-375    AC U5NKK5.1
#=GS R9Y0X6_9RETR/1-375    AC R9Y0X6.1
#=GS U5NLC7_9RETR/1-375    AC U5NLC7.1
#=GS B3FXI0_9RETR/1-204    AC B3FXI0.1
#=GS R9Y1A9_9RETR/1-375    AC R9Y1A9.1
#=GS R9XZ95_9RETR/1-375    AC R9XZ95.1
#=GS U5NI74_9RETR/1-375    AC U5NI74.1
#=GS R9Y188_9RETR/1-375    AC R9Y188.1
#=GS U5NLT1_9RETR/1-375    AC U5NLT1.1
#=GS Q6XZS3_9RETR/1-204    AC Q6XZS3.1
#=GS U5NH83_9RETR/1-375    AC U5NH83.1
#=GS R9Y1N9_9RETR/1-375    AC R9Y1N9.1
#=GS U5NKY3_9RETR/1-375    AC U5NKY3.1
#=GS Q6XZR7_9RETR/1-204    AC Q6XZR7.1
#=GS U5NHX7_9RETR/1-375    AC U5NHX7.1
#=GS Q45QF0_SFV1/5-609     AC Q45QF0.1
#=GS R9Y0V9_9RETR/1-375    AC R9Y0V9.1
#=GS U5NH82_9RETR/1-375    AC U5NH82.1
#=GS R9Y1T0_9RETR/1-375    AC R9Y1T0.1
#=GS R9Y190_9RETR/1-375    AC R9Y190.1
#=GS U5NHM3_9RETR/1-375    AC U5NHM3.1
#=GS R9Y0G2_9RETR/1-375    AC R9Y0G2.1
#=GS Q45QE9_SFV1/5-612     AC Q45QE9.1
#=GS U5NIE3_9RETR/1-375    AC U5NIE3.1
#=GS R9Y2N9_9RETR/1-375    AC R9Y2N9.1
#=GS R9Y0M1_9RETR/1-375    AC R9Y0M1.1
#=GS R9Y0K1_9RETR/1-375    AC R9Y0K1.1
#=GS R9XZY8_9RETR/1-375    AC R9XZY8.1
#=GS R9Y0C0_9RETR/1-375    AC R9Y0C0.1
#=GS U5NIN3_9RETR/1-375    AC U5NIN3.1
#=GS U5NHX4_9RETR/1-375    AC U5NHX4.1
#=GS U5NKV5_9RETR/1-375    AC U5NKV5.1
#=GS U5NID4_9RETR/1-375    AC U5NID4.1
#=GS R9Y1E3_9RETR/1-375    AC R9Y1E3.1
#=GS R9Y0I2_9RETR/1-375    AC R9Y0I2.1
#=GS R9Y1Q1_9RETR/1-375    AC R9Y1Q1.1
#=GS U5NLE5_9RETR/1-375    AC U5NLE5.1
#=GS U5NIL8_9RETR/1-374    AC U5NIL8.1
#=GS U5NIN7_9RETR/1-375    AC U5NIN7.1
#=GS B3FXH2_9RETR/1-204    AC B3FXH2.1
#=GS R9XZU4_9RETR/1-375    AC R9XZU4.1
#=GS B3FXF8_9RETR/1-204    AC B3FXF8.1
#=GS B3FXI1_9RETR/1-204    AC B3FXI1.1
#=GS R9XZE3_9RETR/1-373    AC R9XZE3.1
#=GS R9Y0B0_9RETR/1-375    AC R9Y0B0.1
#=GS U5NH95_9RETR/1-375    AC U5NH95.1
#=GS U5NHD3_9RETR/1-375    AC U5NHD3.1
#=GS U5NI90_9RETR/1-375    AC U5NI90.1
#=GS B3FXC9_9RETR/1-204    AC B3FXC9.1
#=GS B3FXF5_9RETR/1-204    AC B3FXF5.1
#=GS Q6XZS4_9RETR/1-204    AC Q6XZS4.1
#=GS U5NGM6_9RETR/1-375    AC U5NGM6.1
#=GS R9Y182_9RETR/1-375    AC R9Y182.1
#=GS U5NIN8_9RETR/1-375    AC U5NIN8.1
#=GS U5NIM7_9RETR/1-375    AC U5NIM7.1
#=GS R9Y153_9RETR/1-375    AC R9Y153.1
#=GS R9Y074_9RETR/1-375    AC R9Y074.1
#=GS U5NKR7_9RETR/1-375    AC U5NKR7.1
#=GS R9Y2W7_9RETR/1-375    AC R9Y2W7.1
#=GS U5NHF8_9RETR/1-375    AC U5NHF8.1
#=GS GAG_FFV/4-142         AC O56860.1
#=GS R9Y105_9RETR/1-375    AC R9Y105.1
#=GS R9Y0P8_9RETR/1-375    AC R9Y0P8.1
#=GS R9XZ90_9RETR/1-375    AC R9XZ90.1
#=GS B2CGB9_9RETR/1-375    AC B2CGB9.1
#=GS R9Y1V1_9RETR/1-375    AC R9Y1V1.1
#=GS R9XZN7_9RETR/1-375    AC R9XZN7.1
#=GS R9Y0P9_9RETR/1-373    AC R9Y0P9.1
#=GS R9Y2Z0_9RETR/1-375    AC R9Y2Z0.1
#=GS U5NL90_9RETR/1-375    AC U5NL90.1
#=GS R9XZP7_9RETR/1-375    AC R9XZP7.1
#=GS R9Y049_9RETR/1-375    AC R9Y049.1
#=GS R9Y2Z8_9RETR/1-375    AC R9Y2Z8.1
#=GS R9Y1A5_9RETR/1-375    AC R9Y1A5.1
#=GS R9XZ81_9RETR/1-375    AC R9XZ81.1
#=GS U5NHS7_9RETR/1-375    AC U5NHS7.1
#=GS R9Y102_9RETR/1-375    AC R9Y102.1
#=GS U5NLD7_9RETR/1-375    AC U5NLD7.1
#=GS Q6XZR8_9RETR/1-237    AC Q6XZR8.1
#=GS U5NI18_9RETR/1-375    AC U5NI18.1
#=GS R9Y141_9RETR/1-375    AC R9Y141.1
#=GS R9Y1M5_9RETR/1-375    AC R9Y1M5.1
#=GS Q9J4C8_9RETR/18-138   AC Q9J4C8.1
#=GS U5NI39_9RETR/1-375    AC U5NI39.1
#=GS U5NL41_9RETR/1-375    AC U5NL41.1
#=GS U5NHJ6_9RETR/1-375    AC U5NHJ6.1
#=GS R9Y297_9RETR/1-373    AC R9Y297.1
#=GS R9Y0F5_9RETR/1-375    AC R9Y0F5.1
#=GS R9XZL5_9RETR/1-373    AC R9XZL5.1
#=GS R9XZL0_9RETR/1-375    AC R9XZL0.1
#=GS R9Y1L2_9RETR/1-375    AC R9Y1L2.1
#=GS R9Y0Z4_9RETR/1-375    AC R9Y0Z4.1
#=GS R9Y115_9RETR/1-375    AC R9Y115.1
#=GS U5NI65_9RETR/1-375    AC U5NI65.1
#=GS R9XYH4_9RETR/1-375    AC R9XYH4.1
#=GS U5NIM4_9RETR/1-375    AC U5NIM4.1
#=GS R9Y0S2_9RETR/1-375    AC R9Y0S2.1
#=GS U5NKN0_9RETR/1-375    AC U5NKN0.1
#=GS U5NH89_9RETR/1-375    AC U5NH89.1
#=GS U5NH54_9RETR/1-375    AC U5NH54.1
#=GS R9Y0Q4_9RETR/1-375    AC R9Y0Q4.1
#=GS R9Y0Z7_9RETR/1-375    AC R9Y0Z7.1
#=GS U5NIA3_9RETR/1-375    AC U5NIA3.1
#=GS R9Y0Y9_9RETR/1-375    AC R9Y0Y9.1
#=GS U5NL17_9RETR/1-375    AC U5NL17.1
#=GS R9Y007_9RETR/1-375    AC R9Y007.1
#=GS R9Y0H8_9RETR/1-375    AC R9Y0H8.1
#=GS U5NHP2_9RETR/1-375    AC U5NHP2.1
#=GS U5NIG3_9RETR/1-375    AC U5NIG3.1
#=GS R9Y1U7_9RETR/1-375    AC R9Y1U7.1
#=GS R9Y110_9RETR/1-375    AC R9Y110.1
#=GS U5NII0_9RETR/1-375    AC U5NII0.1
#=GS U5NKF0_9RETR/1-373    AC U5NKF0.1
#=GS U5NIK1_9RETR/1-375    AC U5NIK1.1
#=GS B3FXD0_9RETR/1-204    AC B3FXD0.1
#=GS U5NHU5_9RETR/1-375    AC U5NHU5.1
#=GS B3FXD2_9RETR/1-204    AC B3FXD2.1
#=GS R9XZV3_9RETR/1-375    AC R9XZV3.1
#=GS R9Y0D8_9RETR/1-375    AC R9Y0D8.1
#=GS U5NKU6_9RETR/1-375    AC U5NKU6.1
#=GS R9XZQ6_9RETR/1-375    AC R9XZQ6.1
#=GS R9Y098_9RETR/1-375    AC R9Y098.1
#=GS U5NL61_9RETR/1-375    AC U5NL61.1
#=GS U5NGJ8_9RETR/1-375    AC U5NGJ8.1
#=GS R9Y0B1_9RETR/1-375    AC R9Y0B1.1
#=GS U5NHW1_9RETR/1-375    AC U5NHW1.1
#=GS R9Y1S3_9RETR/1-375    AC R9Y1S3.1
#=GS U5NHG6_9RETR/1-375    AC U5NHG6.1
#=GS R9Y0P0_9RETR/1-375    AC R9Y0P0.1
#=GS R9Y1X2_9RETR/1-372    AC R9Y1X2.1
#=GS U5NHP4_9RETR/1-375    AC U5NHP4.1
#=GS U5NI03_9RETR/1-375    AC U5NI03.1
#=GS K0H5P0_9RETR/1-99     AC K0H5P0.1
#=GS R9XZZ1_9RETR/1-375    AC R9XZZ1.1
#=GS R9Y1C7_9RETR/1-375    AC R9Y1C7.1
#=GS U5NLA0_9RETR/1-375    AC U5NLA0.1
#=GS U5NHM6_9RETR/1-375    AC U5NHM6.1
#=GS R9XZF4_9RETR/1-373    AC R9XZF4.1
#=GS R9Y088_9RETR/1-375    AC R9Y088.1
#=GS R9XZQ9_9RETR/1-375    AC R9XZQ9.1
#=GS U5NI53_9RETR/1-375    AC U5NI53.1
#=GS R9XYI5_9RETR/1-375    AC R9XYI5.1
#=GS R9Y0T8_9RETR/1-375    AC R9Y0T8.1
#=GS U5NH09_9RETR/1-375    AC U5NH09.1
#=GS U5NL22_9RETR/1-375    AC U5NL22.1
#=GS R9XZI1_9RETR/1-375    AC R9XZI1.1
#=GS R9Y1J4_9RETR/1-375    AC R9Y1J4.1
#=GS R9XZZ7_9RETR/1-375    AC R9XZZ7.1
#=GS U5NLN1_9RETR/1-375    AC U5NLN1.1
#=GS U5NIN0_9RETR/1-375    AC U5NIN0.1
#=GS R9XZD3_9RETR/1-373    AC R9XZD3.1
#=GS Q6XZR3_9RETR/1-204    AC Q6XZR3.1
#=GS U5NLF8_9RETR/1-375    AC U5NLF8.1
#=GS U5NIH9_9RETR/1-375    AC U5NIH9.1
#=GS R9Y0E5_9RETR/1-375    AC R9Y0E5.1
#=GS R9Y156_9RETR/1-373    AC R9Y156.1
#=GS U5NLG8_9RETR/1-375    AC U5NLG8.1
#=GS B3FXD9_9RETR/1-204    AC B3FXD9.1
#=GS R9XZN3_9RETR/1-375    AC R9XZN3.1
#=GS R9Y0A9_9RETR/1-375    AC R9Y0A9.1
#=GS R9Y185_9RETR/1-375    AC R9Y185.1
#=GS R9Y0D4_9RETR/1-375    AC R9Y0D4.1
#=GS R9Y052_9RETR/1-375    AC R9Y052.1
#=GS R9Y1F1_9RETR/1-375    AC R9Y1F1.1
#=GS O41893_9RETR/16-156   AC O41893.1
#=GS R9Y1E9_9RETR/1-375    AC R9Y1E9.1
#=GS U5NIK3_9RETR/1-375    AC U5NIK3.1
#=GS U5NGR6_9RETR/1-375    AC U5NGR6.1
#=GS R9Y0X2_9RETR/1-373    AC R9Y0X2.1
#=GS B3FXE1_9RETR/1-204    AC B3FXE1.1
#=GS R9XY07_9RETR/1-375    AC R9XY07.1
#=GS R9XZY7_9RETR/1-375    AC R9XZY7.1
#=GS B3FXG4_9RETR/1-204    AC B3FXG4.1
#=GS R9XZ69_9RETR/1-375    AC R9XZ69.1
#=GS R9Y042_9RETR/1-375    AC R9Y042.1
#=GS R9Y1R9_9RETR/1-375    AC R9Y1R9.1
#=GS U5NLN5_9RETR/1-375    AC U5NLN5.1
#=GS U5NHU1_9RETR/1-375    AC U5NHU1.1
#=GS U5NGT4_9RETR/1-375    AC U5NGT4.1
#=GS B3FXG9_9RETR/1-204    AC B3FXG9.1
#=GS R9Y1B5_9RETR/1-373    AC R9Y1B5.1
#=GS R9Y0Q2_9RETR/1-375    AC R9Y0Q2.1
#=GS R9Y134_9RETR/1-375    AC R9Y134.1
#=GS R9Y0Q3_9RETR/1-375    AC R9Y0Q3.1
#=GS R9Y2F1_9RETR/1-375    AC R9Y2F1.1
#=GS B3FXD5_9RETR/1-204    AC B3FXD5.1
#=GS U5NIH4_9RETR/1-375    AC U5NIH4.1
#=GS U5NHG9_9RETR/1-375    AC U5NHG9.1
#=GS U5NI59_9RETR/1-375    AC U5NI59.1
#=GS R9Y1D4_9RETR/1-375    AC R9Y1D4.1
#=GS R9XZM7_9RETR/1-375    AC R9XZM7.1
#=GS R9XZJ4_9RETR/1-375    AC R9XZJ4.1
#=GS U5NLM4_9RETR/1-375    AC U5NLM4.1
#=GS R9Y187_9RETR/1-373    AC R9Y187.1
#=GS U5NIB8_9RETR/1-375    AC U5NIB8.1
#=GS R9XZS1_9RETR/1-375    AC R9XZS1.1
#=GS R9Y023_9RETR/1-375    AC R9Y023.1
#=GS R9Y0N1_9RETR/1-375    AC R9Y0N1.1
#=GS U5NI86_9RETR/1-375    AC U5NI86.1
#=GS R9Y171_9RETR/1-375    AC R9Y171.1
#=GS U5NLV4_9RETR/1-375    AC U5NLV4.1
#=GS U5NHU9_9RETR/1-375    AC U5NHU9.1
#=GS B3FXC2_9RETR/1-204    AC B3FXC2.1
#=GS U5NLU6_9RETR/1-375    AC U5NLU6.1
#=GS U5NLV2_9RETR/1-375    AC U5NLV2.1
#=GS R9XZJ1_9RETR/1-375    AC R9XZJ1.1
#=GS R9Y0V6_9RETR/1-375    AC R9Y0V6.1
#=GS R9XZN2_9RETR/1-375    AC R9XZN2.1
#=GS R9Y0S1_9RETR/1-375    AC R9Y0S1.1
#=GS U5NHN4_9RETR/1-375    AC U5NHN4.1
#=GS U5NKG4_9RETR/1-375    AC U5NKG4.1
#=GS U5NLA3_9RETR/1-375    AC U5NLA3.1
#=GS R9XZV4_9RETR/1-375    AC R9XZV4.1
#=GS R9Y0R9_9RETR/1-375    AC R9Y0R9.1
#=GS U5NI20_9RETR/1-375    AC U5NI20.1
#=GS U5NIG9_9RETR/1-375    AC U5NIG9.1
#=GS R9XZY9_9RETR/1-375    AC R9XZY9.1
#=GS B3FXD7_9RETR/1-204    AC B3FXD7.1
#=GS U5NKK8_9RETR/1-375    AC U5NKK8.1
#=GS R9XZD5_9RETR/1-373    AC R9XZD5.1
#=GS R9XZS0_9RETR/1-375    AC R9XZS0.1
#=GS R9Y167_9RETR/1-373    AC R9Y167.1
#=GS R9Y1L9_9RETR/1-375    AC R9Y1L9.1
#=GS U5NLF0_9RETR/1-375    AC U5NLF0.1
#=GS U5NL84_9RETR/1-375    AC U5NL84.1
#=GS R9XY37_9RETR/1-375    AC R9XY37.1
#=GS K7Z2A0_9RETR/9-612    AC K7Z2A0.1
#=GS U5NI23_9RETR/1-375    AC U5NI23.1
#=GS D5JWV0_9RETR/227-598  AC D5JWV0.1
#=GS U5NI34_9RETR/1-375    AC U5NI34.1
#=GS Q6XZR5_9RETR/1-204    AC Q6XZR5.1
#=GS R9XY93_9RETR/1-375    AC R9XY93.1
#=GS R9Y2U3_9RETR/1-375    AC R9Y2U3.1
#=GS R9Y1X1_9RETR/1-375    AC R9Y1X1.1
#=GS U5NLD0_9RETR/1-375    AC U5NLD0.1
#=GS U5NGW4_9RETR/1-375    AC U5NGW4.1
#=GS R9Y0Y5_9RETR/1-375    AC R9Y0Y5.1
#=GS R9Y1S1_9RETR/1-375    AC R9Y1S1.1
#=GS R9Y104_9RETR/1-375    AC R9Y104.1
#=GS R9Y051_9RETR/1-375    AC R9Y051.1
#=GS U5NLL0_9RETR/1-375    AC U5NLL0.1
#=GS U5NIF9_9RETR/1-375    AC U5NIF9.1
#=GS B3FXF9_9RETR/1-204    AC B3FXF9.1
#=GS R9XZR4_9RETR/1-375    AC R9XZR4.1
#=GS R9Y050_9RETR/1-375    AC R9Y050.1
#=GS R9XZM9_9RETR/1-374    AC R9XZM9.1
#=GS U5NI58_9RETR/1-375    AC U5NI58.1
#=GS U5NHE8_9RETR/1-375    AC U5NHE8.1
#=GS R9Y1H2_9RETR/1-375    AC R9Y1H2.1
#=GS R9Y1K2_9RETR/1-375    AC R9Y1K2.1
#=GS R9Y056_9RETR/1-375    AC R9Y056.1
#=GS R9Y0U3_9RETR/1-375    AC R9Y0U3.1
#=GS U5NLM3_9RETR/1-375    AC U5NLM3.1
#=GS U5NI81_9RETR/1-375    AC U5NI81.1
#=GS U5NKI0_9RETR/1-375    AC U5NKI0.1
#=GS R9Y1J2_9RETR/1-375    AC R9Y1J2.1
#=GS R9Y0Z9_9RETR/1-373    AC R9Y0Z9.1
#=GS R9XZU9_9RETR/1-375    AC R9XZU9.1
#=GS Q6XZS8_9RETR/1-204    AC Q6XZS8.1
#=GS R9XYW0_9RETR/1-375    AC R9XYW0.1
#=GS R9Y2K2_9RETR/1-375    AC R9Y2K2.1
#=GS R9XYL5_9RETR/1-375    AC R9XYL5.1
#=GS R9Y019_9RETR/1-375    AC R9Y019.1
#=GS R9Y0D7_9RETR/1-375    AC R9Y0D7.1
#=GS R9Y1P1_9RETR/1-375    AC R9Y1P1.1
#=GS U5NHQ4_9RETR/1-375    AC U5NHQ4.1
#=GS R9XZF0_9RETR/1-373    AC R9XZF0.1
#=GS R9XZG1_9RETR/1-375    AC R9XZG1.1
#=GS U5NLY2_9RETR/1-375    AC U5NLY2.1
#=GS R9Y070_9RETR/1-375    AC R9Y070.1
#=GS R9Y2E0_9RETR/1-375    AC R9Y2E0.1
#=GS U5NHC5_9RETR/1-375    AC U5NHC5.1
#=GS B3FXC8_9RETR/1-204    AC B3FXC8.1
#=GS U5NHU3_9RETR/1-375    AC U5NHU3.1
#=GS U5NL54_9RETR/1-375    AC U5NL54.1
#=GS U5NL68_9RETR/1-375    AC U5NL68.1
#=GS U5NLH1_9RETR/1-375    AC U5NLH1.1
#=GS U5NKE6_9RETR/1-375    AC U5NKE6.1
#=GS R9XZW9_9RETR/1-375    AC R9XZW9.1
#=GS U5NHX9_9RETR/1-375    AC U5NHX9.1
#=GS R9XY71_9RETR/1-375    AC R9XY71.1
#=GS U5NK98_9RETR/12-280   AC U5NK98.1
#=GS U5NLS0_9RETR/1-375    AC U5NLS0.1
#=GS U5NHR2_9RETR/1-375    AC U5NHR2.1
#=GS U5NKV1_9RETR/1-375    AC U5NKV1.1
#=GS K7Z286_9RETR/9-617    AC K7Z286.1
#=GS B3FXG2_9RETR/1-204    AC B3FXG2.1
#=GS R9Y012_9RETR/1-375    AC R9Y012.1
#=GS U5NHH9_9RETR/1-375    AC U5NHH9.1
#=GS R9Y035_9RETR/1-375    AC R9Y035.1
#=GS R9Y0U2_9RETR/1-375    AC R9Y0U2.1
#=GS U5NLW5_9RETR/1-375    AC U5NLW5.1
#=GS R9XY78_9RETR/1-375    AC R9XY78.1
#=GS R9Y191_9RETR/1-375    AC R9Y191.1
#=GS U5NHH2_9RETR/1-375    AC U5NHH2.1
#=GS B3FXI2_9RETR/1-204    AC B3FXI2.1
#=GS R9Y2H4_9RETR/1-375    AC R9Y2H4.1
#=GS R9XYN7_9RETR/1-375    AC R9XYN7.1
#=GS R9XXX2_9RETR/1-375    AC R9XXX2.1
#=GS R9Y1E0_9RETR/1-375    AC R9Y1E0.1
#=GS U5NIG4_9RETR/1-375    AC U5NIG4.1
#=GS U5NHN6_9RETR/1-375    AC U5NHN6.1
#=GS R9Y1F2_9RETR/1-375    AC R9Y1F2.1
#=GS B2CGB1_9RETR/1-375    AC B2CGB1.1
#=GS U5NM00_9RETR/1-375    AC U5NM00.1
#=GS U5NLQ7_9RETR/1-375    AC U5NLQ7.1
#=GS U5NHM1_9RETR/1-375    AC U5NHM1.1
#=GS U5NHW9_9RETR/1-375    AC U5NHW9.1
#=GS R9Y0S7_9RETR/1-372    AC R9Y0S7.1
#=GS R9Y034_9RETR/1-374    AC R9Y034.1
#=GS R9XZS3_9RETR/1-375    AC R9XZS3.1
#=GS U5NIP3_9RETR/1-375    AC U5NIP3.1
#=GS U5NHY4_9RETR/1-375    AC U5NHY4.1
#=GS U5NID9_9RETR/1-375    AC U5NID9.1
#=GS R9XZH3_9RETR/1-375    AC R9XZH3.1
#=GS R9Y1P4_9RETR/1-375    AC R9Y1P4.1
#=GS R9Y021_9RETR/1-375    AC R9Y021.1
#=GS R9XZQ2_9RETR/1-375    AC R9XZQ2.1
#=GS R9XXY7_9RETR/1-375    AC R9XXY7.1
#=GS U5NHH4_9RETR/1-375    AC U5NHH4.1
#=GS U5NI14_9RETR/1-375    AC U5NI14.1
#=GS U5NLU9_9RETR/1-375    AC U5NLU9.1
#=GS U5NHU6_9RETR/1-375    AC U5NHU6.1
#=GS U5NGL6_9RETR/12-280   AC U5NGL6.1
#=GS U5NHV7_9RETR/1-375    AC U5NHV7.1
#=GS R9Y234_9RETR/1-375    AC R9Y234.1
#=GS R9Y1H0_9RETR/1-375    AC R9Y1H0.1
#=GS R9XZC0_9RETR/1-373    AC R9XZC0.1
#=GS R9XYH1_9RETR/1-375    AC R9XYH1.1
#=GS R9Y002_9RETR/1-375    AC R9Y002.1
#=GS R9Y1Q0_9RETR/1-375    AC R9Y1Q0.1
#=GS R9Y1R1_9RETR/1-375    AC R9Y1R1.1
#=GS U5NHV0_9RETR/1-375    AC U5NHV0.1
#=GS U5NGQ7_9RETR/1-375    AC U5NGQ7.1
#=GS R9XZJ9_9RETR/1-375    AC R9XZJ9.1
#=GS R9Y1F7_9RETR/1-375    AC R9Y1F7.1
#=GS U5NIQ8_9RETR/1-375    AC U5NIQ8.1
#=GS R9Y080_9RETR/1-375    AC R9Y080.1
#=GS U5NH65_9RETR/1-375    AC U5NH65.1
#=GS U5NI42_9RETR/1-375    AC U5NI42.1
#=GS U5NHA5_9RETR/1-375    AC U5NHA5.1
#=GS U5NI64_9RETR/1-375    AC U5NI64.1
#=GS R9Y2I2_9RETR/1-375    AC R9Y2I2.1
#=GS R9Y0C6_9RETR/1-375    AC R9Y0C6.1
#=GS U5NIB5_9RETR/1-375    AC U5NIB5.1
#=GS U5NHA0_9RETR/1-375    AC U5NHA0.1
#=GS R9XZ15_9RETR/1-375    AC R9XZ15.1
#=GS R9Y043_9RETR/1-375    AC R9Y043.1
#=GS B3FXH5_9RETR/1-204    AC B3FXH5.1
#=GS U5NKX9_9RETR/1-375    AC U5NKX9.1
#=GS R9XZ35_9RETR/1-375    AC R9XZ35.1
#=GS U5NKH0_9RETR/1-375    AC U5NKH0.1
#=GS Q45QF3_SFV1/5-609     AC Q45QF3.1
#=GS R9Y0B7_9RETR/1-375    AC R9Y0B7.1
#=GS R9XZR5_9RETR/1-375    AC R9XZR5.1
#=GS U5NGN3_9RETR/12-280   AC U5NGN3.1
#=GS R9XZ76_9RETR/1-375    AC R9XZ76.1
#=GS R9Y1R0_9RETR/1-375    AC R9Y1R0.1
#=GS R9Y0A4_9RETR/1-375    AC R9Y0A4.1
#=GS U5NLK5_9RETR/1-375    AC U5NLK5.1
#=GS R9XYL0_9RETR/1-375    AC R9XYL0.1
#=GS R9XZ64_9RETR/1-372    AC R9XZ64.1
#=GS R9Y2W1_9RETR/1-375    AC R9Y2W1.1
#=GS U5NH76_9RETR/1-375    AC U5NH76.1
#=GS U5NII4_9RETR/1-375    AC U5NII4.1
#=GS U5NH68_9RETR/1-373    AC U5NH68.1
#=GS R9Y1B0_9RETR/1-375    AC R9Y1B0.1
#=GS R9XZS9_9RETR/1-375    AC R9XZS9.1
#=GS K7Z296_9RETR/9-612    AC K7Z296.1
#=GS B3FXF7_9RETR/1-204    AC B3FXF7.1
#=GS Q6XZR6_9RETR/1-204    AC Q6XZR6.1
#=GS U5NKI7_9RETR/1-375    AC U5NKI7.1
#=GS U5NLQ8_9RETR/1-375    AC U5NLQ8.1
#=GS R9XYY3_9RETR/1-375    AC R9XYY3.1
#=GS R9XYJ4_9RETR/1-375    AC R9XYJ4.1
#=GS U5NHU8_9RETR/1-375    AC U5NHU8.1
#=GS U5NHW2_9RETR/1-375    AC U5NHW2.1
#=GS U5NHP0_9RETR/1-375    AC U5NHP0.1
#=GS R9Y152_9RETR/1-373    AC R9Y152.1
#=GS R9XY59_9RETR/1-375    AC R9XY59.1
#=GS O41893_9RETR/157-518  AC O41893.1
#=GS U5NLH4_9RETR/1-375    AC U5NLH4.1
#=GS R9Y2B4_9RETR/1-375    AC R9Y2B4.1
#=GS U5NL48_9RETR/1-375    AC U5NL48.1
#=GS U5NLJ6_9RETR/1-375    AC U5NLJ6.1
#=GS R9Y0Q1_9RETR/1-375    AC R9Y0Q1.1
#=GS R9Y158_9RETR/1-375    AC R9Y158.1
#=GS B3FXE6_9RETR/1-204    AC B3FXE6.1
#=GS U5NL36_9RETR/1-375    AC U5NL36.1
#=GS B3FXC1_9RETR/1-204    AC B3FXC1.1
#=GS R9Y1F3_9RETR/1-375    AC R9Y1F3.1
#=GS R9XZS7_9RETR/1-375    AC R9XZS7.1
#=GS U5NLN3_9RETR/1-375    AC U5NLN3.1
#=GS U5NHC9_9RETR/1-375    AC U5NHC9.1
#=GS R9Y266_9RETR/1-373    AC R9Y266.1
#=GS U5NHV3_9RETR/1-375    AC U5NHV3.1
#=GS R9Y0F9_9RETR/1-375    AC R9Y0F9.1
#=GS R9XZH1_9RETR/1-375    AC R9XZH1.1
#=GS R9Y1U4_9RETR/1-375    AC R9Y1U4.1
#=GS B3FXD6_9RETR/1-204    AC B3FXD6.1
#=GS B3FXE9_9RETR/1-204    AC B3FXE9.1
#=GS U5NHE0_9RETR/1-375    AC U5NHE0.1
#=GS R9Y0K6_9RETR/1-375    AC R9Y0K6.1
#=GS U5NL13_9RETR/1-375    AC U5NL13.1
#=GS U5NIC0_9RETR/1-375    AC U5NIC0.1
#=GS R9XYU6_9RETR/1-375    AC R9XYU6.1
#=GS R9Y1J5_9RETR/1-375    AC R9Y1J5.1
#=GS R9Y1G7_9RETR/1-375    AC R9Y1G7.1
#=GS R9Y1H5_9RETR/1-375    AC R9Y1H5.1
#=GS R9Y005_9RETR/1-375    AC R9Y005.1
#=GS R9Y0H0_9RETR/1-375    AC R9Y0H0.1
#=GS U5NL67_9RETR/1-375    AC U5NL67.1
#=GS U5NI76_9RETR/1-375    AC U5NI76.1
#=GS R9Y0W1_9RETR/1-375    AC R9Y0W1.1
#=GS U5NHH7_9RETR/1-375    AC U5NHH7.1
#=GS U5NKW0_9RETR/1-375    AC U5NKW0.1
#=GS R9XY29_9RETR/1-375    AC R9XY29.1
#=GS R9Y022_9RETR/1-375    AC R9Y022.1
#=GS R9Y0F7_9RETR/1-375    AC R9Y0F7.1
#=GS U5NHC8_9RETR/1-375    AC U5NHC8.1
#=GS B3FXC6_9RETR/1-204    AC B3FXC6.1
#=GS U5NLK9_9RETR/1-375    AC U5NLK9.1
#=GS R9Y1H9_9RETR/1-375    AC R9Y1H9.1
#=GS U5NL99_9RETR/1-375    AC U5NL99.1
#=GS U5NKA3_9RETR/9-280    AC U5NKA3.1
#=GS R9Y018_9RETR/1-375    AC R9Y018.1
#=GS U5NIP0_9RETR/1-375    AC U5NIP0.1
#=GS U5NKW8_9RETR/1-375    AC U5NKW8.1
#=GS U5NK93_9RETR/1-373    AC U5NK93.1
#=GS Q45QF5_SFV1/5-613     AC Q45QF5.1
#=GS R9Y2F4_9RETR/1-375    AC R9Y2F4.1
#=GS R9Y0J9_9RETR/1-375    AC R9Y0J9.1
#=GS U5NI50_9RETR/1-375    AC U5NI50.1
#=GS U5NHR1_9RETR/1-375    AC U5NHR1.1
#=GS K7Z2A6_9RETR/3-606    AC K7Z2A6.1
#=GS U5NH73_9RETR/1-375    AC U5NH73.1
#=GS U5NGP9_9RETR/1-375    AC U5NGP9.1
#=GS U5NHB0_9RETR/1-375    AC U5NHB0.1
#=GS B3FXF0_9RETR/1-204    AC B3FXF0.1
#=GS U5NI92_9RETR/1-375    AC U5NI92.1
#=GS U5NKZ9_9RETR/1-375    AC U5NKZ9.1
#=GS R9Y273_9RETR/1-373    AC R9Y273.1
#=GS U5NIJ0_9RETR/1-375    AC U5NIJ0.1
#=GS U5NKN1_9RETR/1-375    AC U5NKN1.1
#=GS R9Y2M3_9RETR/1-375    AC R9Y2M3.1
#=GS R9XY47_9RETR/1-375    AC R9XY47.1
#=GS R9Y1T5_9RETR/1-375    AC R9Y1T5.1
#=GS R9Y055_9RETR/1-375    AC R9Y055.1
#=GS U5NHX1_9RETR/1-375    AC U5NHX1.1
#=GS R9Y1I1_9RETR/1-375    AC R9Y1I1.1
#=GS U5NHI7_9RETR/1-375    AC U5NHI7.1
#=GS R9Y135_9RETR/1-373    AC R9Y135.1
#=GS U5NH21_9RETR/1-375    AC U5NH21.1
#=GS B3FXF3_9RETR/1-204    AC B3FXF3.1
#=GS R9XZI2_9RETR/1-375    AC R9XZI2.1
#=GS U5NL45_9RETR/1-375    AC U5NL45.1
#=GS R9Y1Z4_9RETR/1-375    AC R9Y1Z4.1
#=GS U5NL73_9RETR/1-375    AC U5NL73.1
#=GS R9Y117_9RETR/1-375    AC R9Y117.1
#=GS U5NLD1_9RETR/1-375    AC U5NLD1.1
#=GS R9XZK4_9RETR/1-375    AC R9XZK4.1
#=GS U5NLX1_9RETR/1-375    AC U5NLX1.1
#=GS U5NHL8_9RETR/1-375    AC U5NHL8.1
#=GS R9Y000_9RETR/1-375    AC R9Y000.1
#=GS R9XYP2_9RETR/1-375    AC R9XYP2.1
#=GS R9XZU5_9RETR/1-375    AC R9XZU5.1
#=GS R9Y0Y3_9RETR/1-375    AC R9Y0Y3.1
#=GS R9Y1C2_9RETR/1-373    AC R9Y1C2.1
#=GS U5NIQ2_9RETR/1-375    AC U5NIQ2.1
#=GS R9XZY4_9RETR/1-375    AC R9XZY4.1
#=GS R9Y2E7_9RETR/1-375    AC R9Y2E7.1
#=GS U5NGV3_9RETR/1-375    AC U5NGV3.1
#=GS U5NKP2_9RETR/1-375    AC U5NKP2.1
#=GS U5NHQ5_9RETR/1-375    AC U5NHQ5.1
#=GS R9Y0A3_9RETR/1-375    AC R9Y0A3.1
#=GS R9Y1Y5_9RETR/1-375    AC R9Y1Y5.1
#=GS R9Y1A4_9RETR/1-374    AC R9Y1A4.1
#=GS R9Y0E7_9RETR/1-375    AC R9Y0E7.1
#=GS R9Y0S0_9RETR/1-375    AC R9Y0S0.1
#=GS R9Y0E4_9RETR/1-375    AC R9Y0E4.1
#=GS R9Y0I8_9RETR/1-375    AC R9Y0I8.1
#=GS U5NLG5_9RETR/1-375    AC U5NLG5.1
#=GS U5NH57_9RETR/1-375    AC U5NH57.1
#=GS B3FXH7_9RETR/1-204    AC B3FXH7.1
#=GS R9Y1C5_9RETR/1-373    AC R9Y1C5.1
#=GS R9XYF7_9RETR/1-375    AC R9XYF7.1
#=GS U5NII9_9RETR/1-375    AC U5NII9.1
#=GS R9XZR0_9RETR/1-375    AC R9XZR0.1
#=GS R9XYF2_9RETR/1-375    AC R9XYF2.1
#=GS U5NHH3_9RETR/1-375    AC U5NHH3.1
#=GS R9Y2P3_9RETR/1-375    AC R9Y2P3.1
#=GS U5NL89_9RETR/1-375    AC U5NL89.1
#=GS U5NLQ3_9RETR/1-375    AC U5NLQ3.1
#=GS R9Y0W5_9RETR/1-375    AC R9Y0W5.1
#=GS R9Y1H4_9RETR/1-375    AC R9Y1H4.1
#=GS Q6XZS2_9RETR/1-204    AC Q6XZS2.1
#=GS U5NKJ1_9RETR/1-375    AC U5NKJ1.1
#=GS R9Y0R4_9RETR/1-375    AC R9Y0R4.1
#=GS U5NGV8_9RETR/1-375    AC U5NGV8.1
#=GS U5NKN5_9RETR/1-375    AC U5NKN5.1
#=GS R9Y1Q7_9RETR/1-375    AC R9Y1Q7.1
#=GS Q6XZS5_9RETR/1-204    AC Q6XZS5.1
#=GS Q70LW5_FFV/158-506    AC Q70LW5.1
#=GS R9Y066_9RETR/1-375    AC R9Y066.1
#=GS R9XXW4_9RETR/1-375    AC R9XXW4.1
#=GS U5NHQ7_9RETR/1-375    AC U5NHQ7.1
#=GS R9Y0Q6_9RETR/1-375    AC R9Y0Q6.1
#=GS R9Y1P3_9RETR/1-375    AC R9Y1P3.1
#=GS R9Y1T3_9RETR/1-375    AC R9Y1T3.1
#=GS U5NL03_9RETR/1-375    AC U5NL03.1
#=GS U5NHI2_9RETR/1-375    AC U5NHI2.1
#=GS R9Y0M6_9RETR/1-375    AC R9Y0M6.1
#=GS U5NIC3_9RETR/1-375    AC U5NIC3.1
#=GS R9Y180_9RETR/1-375    AC R9Y180.1
#=GS R9Y015_9RETR/1-375    AC R9Y015.1
#=GS U5NHU2_9RETR/1-375    AC U5NHU2.1
#=GS U5NKL7_9RETR/1-375    AC U5NKL7.1
#=GS R9Y059_9RETR/1-375    AC R9Y059.1
#=GS R9XZX4_9RETR/1-375    AC R9XZX4.1
#=GS R9Y0M7_9RETR/1-375    AC R9Y0M7.1
#=GS D5JWV0_9RETR/10-240   AC D5JWV0.1
#=GS R9Y0U0_9RETR/1-375    AC R9Y0U0.1
#=GS U5NHP7_9RETR/1-375    AC U5NHP7.1
#=GS U5NI28_9RETR/1-375    AC U5NI28.1
#=GS R9Y257_9RETR/1-373    AC R9Y257.1
#=GS U5NHT3_9RETR/1-375    AC U5NHT3.1
#=GS U5NLY7_9RETR/1-375    AC U5NLY7.1
#=GS R9Y2Y2_9RETR/1-375    AC R9Y2Y2.1
#=GS U5NHQ8_9RETR/1-375    AC U5NHQ8.1
#=GS R9Y1H1_9RETR/1-374    AC R9Y1H1.1
#=GS Q7SIS7_9RETR/5-595    AC Q7SIS7.1
#=GS R9Y0T2_9RETR/1-375    AC R9Y0T2.1
#=GS U5NIK7_9RETR/1-375    AC U5NIK7.1
#=GS R9XZM4_9RETR/1-375    AC R9XZM4.1
#=GS R9Y1C6_9RETR/1-375    AC R9Y1C6.1
#=GS U5NI30_9RETR/1-375    AC U5NI30.1
#=GS R9Y0S6_9RETR/1-375    AC R9Y0S6.1
#=GS R9XZX2_9RETR/1-375    AC R9XZX2.1
#=GS R9XZY1_9RETR/1-375    AC R9XZY1.1
#=GS R9XYX3_9RETR/1-375    AC R9XYX3.1
#=GS U5NH27_9RETR/1-375    AC U5NH27.1
#=GS U5NL43_9RETR/1-375    AC U5NL43.1
#=GS R9Y0I3_9RETR/1-375    AC R9Y0I3.1
#=GS R9XZT8_9RETR/1-375    AC R9XZT8.1
#=GS D5JWU5_9RETR/213-567  AC D5JWU5.1
#=GS B3FXH1_9RETR/1-204    AC B3FXH1.1
#=GS R9XZW4_9RETR/1-375    AC R9XZW4.1
#=GS U5NHS2_9RETR/1-375    AC U5NHS2.1
#=GS R9Y1V8_9RETR/1-375    AC R9Y1V8.1
#=GS R9Y197_9RETR/1-375    AC R9Y197.1
#=GS U5NH80_9RETR/1-375    AC U5NH80.1
#=GS U5NKS2_9RETR/1-375    AC U5NKS2.1
#=GS R9XZ10_9RETR/1-375    AC R9XZ10.1
#=GS U5NLP5_9RETR/1-375    AC U5NLP5.1
#=GS R9Y1P7_9RETR/1-375    AC R9Y1P7.1
#=GS R9Y075_9RETR/1-375    AC R9Y075.1
#=GS R9Y2R2_9RETR/1-375    AC R9Y2R2.1
#=GS U5NHR5_9RETR/1-375    AC U5NHR5.1
#=GS R9Y095_9RETR/1-375    AC R9Y095.1
#=GS U5NH52_9RETR/13-280   AC U5NH52.1
#=GS R9Y132_9RETR/1-373    AC R9Y132.1
#=GS U5NLT5_9RETR/1-375    AC U5NLT5.1
#=GS R9XYT4_9RETR/1-375    AC R9XYT4.1
#=GS R9XYZ5_9RETR/1-375    AC R9XYZ5.1
#=GS R9Y0U9_9RETR/1-375    AC R9Y0U9.1
#=GS R9XZI5_9RETR/1-375    AC R9XZI5.1
#=GS R9Y1E4_9RETR/1-375    AC R9Y1E4.1
#=GS R9Y1P0_9RETR/1-375    AC R9Y1P0.1
#=GS R9XZP4_9RETR/1-375    AC R9XZP4.1
#=GS U5NH43_9RETR/1-375    AC U5NH43.1
#=GS U5NLA8_9RETR/1-375    AC U5NLA8.1
#=GS U5NKJ4_9RETR/1-375    AC U5NKJ4.1
#=GS U5NIE8_9RETR/1-375    AC U5NIE8.1
#=GS U5NGZ7_9RETR/1-375    AC U5NGZ7.1
#=GS R9Y076_9RETR/1-375    AC R9Y076.1
#=GS R9Y0U7_9RETR/1-375    AC R9Y0U7.1
#=GS R9Y0Z5_9RETR/1-371    AC R9Y0Z5.1
#=GS U5NKA8_9RETR/1-375    AC U5NKA8.1
#=GS B3FXC7_9RETR/1-204    AC B3FXC7.1
#=GS U5NHQ2_9RETR/1-375    AC U5NHQ2.1
#=GS U5NLE1_9RETR/1-375    AC U5NLE1.1
#=GS R9Y100_9RETR/1-375    AC R9Y100.1
#=GS U5NIM0_9RETR/1-375    AC U5NIM0.1
#=GS U5NII5_9RETR/1-375    AC U5NII5.1
#=GS R9XZE0_9RETR/1-373    AC R9XZE0.1
#=GS R9Y0M9_9RETR/1-373    AC R9Y0M9.1
#=GS U5NHJ2_9RETR/1-375    AC U5NHJ2.1
#=GS R9Y1R5_9RETR/1-375    AC R9Y1R5.1
#=GS U5NKV7_9RETR/1-375    AC U5NKV7.1
#=GS U5NI02_9RETR/1-375    AC U5NI02.1
#=GS R9Y1D2_9RETR/1-375    AC R9Y1D2.1
#=GS U5NHJ1_9RETR/1-375    AC U5NHJ1.1
#=GS R9Y0L8_9RETR/1-375    AC R9Y0L8.1
#=GS R9Y0S8_9RETR/1-375    AC R9Y0S8.1
#=GS A8HC77_9RETR/222-594  AC A8HC77.1
#=GS R9XZN6_9RETR/1-375    AC R9XZN6.1
#=GS R9XYC7_9RETR/1-375    AC R9XYC7.1
#=GS Q45QF4_SFV1/5-612     AC Q45QF4.1
#=GS U5NH58_9RETR/11-278   AC U5NH58.1
#=GS R9XYT9_9RETR/1-375    AC R9XYT9.1
#=GS K0HDB2_9RETR/1-99     AC K0HDB2.1
#=GS R9XZZ5_9RETR/1-375    AC R9XZZ5.1
#=GS R9Y0D5_9RETR/1-375    AC R9Y0D5.1
#=GS U5NI45_9RETR/1-375    AC U5NI45.1
#=GS U5NKP8_9RETR/1-375    AC U5NKP8.1
#=GS Q6XZS9_9RETR/1-204    AC Q6XZS9.1
#=GS U5NGS9_9RETR/1-375    AC U5NGS9.1
#=GS R9XZT0_9RETR/1-375    AC R9XZT0.1
#=GS U5NI87_9RETR/1-375    AC U5NI87.1
#=GS U5NL72_9RETR/1-375    AC U5NL72.1
#=GS U5NI43_9RETR/1-373    AC U5NI43.1
#=GS R9Y0R5_9RETR/1-372    AC R9Y0R5.1
#=GS U5NKV0_9RETR/1-375    AC U5NKV0.1
#=GS R9Y1N0_9RETR/1-375    AC R9Y1N0.1
#=GS GAG_SFVCP/9-622       AC Q87039.1
#=GS U5NL59_9RETR/1-375    AC U5NL59.1
#=GS U5NKY1_9RETR/1-375    AC U5NKY1.1
#=GS R9XYY8_9RETR/1-375    AC R9XYY8.1
#=GS U5NHP5_9RETR/1-375    AC U5NHP5.1
#=GS R9Y0G4_9RETR/1-375    AC R9Y0G4.1
#=GS R9Y166_9RETR/1-375    AC R9Y166.1
#=GS R9Y0U5_9RETR/1-375    AC R9Y0U5.1
#=GS R9XZK6_9RETR/1-375    AC R9XZK6.1
#=GS R9Y2G2_9RETR/1-375    AC R9Y2G2.1
#=GS Q6XZS0_9RETR/1-204    AC Q6XZS0.1
#=GS U5NKF8_9RETR/1-375    AC U5NKF8.1
#=GS U5NLH6_9RETR/1-375    AC U5NLH6.1
#=GS R9Y1E1_9RETR/1-374    AC R9Y1E1.1
#=GS R9Y0X9_9RETR/1-375    AC R9Y0X9.1
#=GS U5NHP8_9RETR/1-375    AC U5NHP8.1
#=GS U5NKP0_9RETR/1-375    AC U5NKP0.1
#=GS R9Y118_9RETR/1-373    AC R9Y118.1
#=GS Q45QF1_SFV1/5-610     AC Q45QF1.1
#=GS GAG_SFV3L/3-606       AC P27400.1
#=GS R9Y1U0_9RETR/1-375    AC R9Y1U0.1
#=GS R9Y0P7_9RETR/1-375    AC R9Y0P7.1
#=GS R9Y0D2_9RETR/1-375    AC R9Y0D2.1
#=GS U5NKK3_9RETR/1-375    AC U5NKK3.1
#=GS U5NLL3_9RETR/1-375    AC U5NLL3.1
#=GS U5NHW6_9RETR/1-375    AC U5NHW6.1
#=GS R9XZX6_9RETR/1-375    AC R9XZX6.1
#=GS R9XZZ4_9RETR/1-375    AC R9XZZ4.1
#=GS D5JWU5_9RETR/3-234    AC D5JWU5.1
#=GS U5NH87_9RETR/13-280   AC U5NH87.1
#=GS R9XZP8_9RETR/1-375    AC R9XZP8.1
#=GS U5NKF7_9RETR/1-375    AC U5NKF7.1
#=GS R9XZJ8_9RETR/1-375    AC R9XZJ8.1
#=GS U5NI98_9RETR/1-375    AC U5NI98.1
#=GS R9Y1K8_9RETR/1-375    AC R9Y1K8.1
#=GS S4TZZ6_9RETR/5-40     AC S4TZZ6.1
#=GS B3FXH0_9RETR/1-204    AC B3FXH0.1
#=GS R9XYV3_9RETR/1-375    AC R9XYV3.1
#=GS U5NHT8_9RETR/1-375    AC U5NHT8.1
#=GS U5NHB8_9RETR/1-375    AC U5NHB8.1
#=GS R9Y1T6_9RETR/1-375    AC R9Y1T6.1
#=GS U5NKZ1_9RETR/1-375    AC U5NKZ1.1
#=GS R9Y1E5_9RETR/1-375    AC R9Y1E5.1
#=GS U5NHR6_9RETR/1-375    AC U5NHR6.1
#=GS B3FXG0_9RETR/1-204    AC B3FXG0.1
#=GS R9Y147_9RETR/1-373    AC R9Y147.1
#=GS R9XZV8_9RETR/1-375    AC R9XZV8.1
#=GS R9Y1E8_9RETR/1-375    AC R9Y1E8.1
#=GS R9Y1V5_9RETR/1-374    AC R9Y1V5.1
#=GS R9Y0B3_9RETR/1-375    AC R9Y0B3.1
#=GS R9Y1N3_9RETR/1-375    AC R9Y1N3.1
#=GS U5NKQ6_9RETR/1-375    AC U5NKQ6.1
#=GS R9Y154_9RETR/1-375    AC R9Y154.1
#=GS R9XZV0_9RETR/1-375    AC R9XZV0.1
#=GS R9Y1V6_9RETR/1-375    AC R9Y1V6.1
#=GS R9Y1N5_9RETR/1-375    AC R9Y1N5.1
#=GS R9Y1K0_9RETR/1-375    AC R9Y1K0.1
#=GS U5NIJ9_9RETR/1-375    AC U5NIJ9.1
#=GS R9XZY5_9RETR/1-375    AC R9XZY5.1
#=GS B3FXC4_9RETR/1-204    AC B3FXC4.1
#=GS U5NLB5_9RETR/1-375    AC U5NLB5.1
#=GS R9Y083_9RETR/1-375    AC R9Y083.1
#=GS U5NKR3_9RETR/1-375    AC U5NKR3.1
#=GS R9Y1F4_9RETR/1-375    AC R9Y1F4.1
#=GS R9Y1R6_9RETR/1-375    AC R9Y1R6.1
#=GS R9XZZ6_9RETR/1-375    AC R9XZZ6.1
#=GS R9Y048_9RETR/1-375    AC R9Y048.1
#=GS R9Y0H7_9RETR/1-375    AC R9Y0H7.1
#=GS U5NHZ4_9RETR/1-375    AC U5NHZ4.1
#=GS U5NH07_9RETR/1-375    AC U5NH07.1
#=GS U5NHC4_9RETR/1-375    AC U5NHC4.1
#=GS R9Y1A3_9RETR/1-375    AC R9Y1A3.1
#=GS U5NHI4_9RETR/1-375    AC U5NHI4.1
#=GS U5NHC3_9RETR/1-375    AC U5NHC3.1
#=GS B2CGB6_9RETR/1-375    AC B2CGB6.1
#=GS R9Y173_9RETR/1-375    AC R9Y173.1
#=GS R9Y064_9RETR/1-375    AC R9Y064.1
#=GS R9Y1V2_9RETR/1-375    AC R9Y1V2.1
#=GS R9Y1S9_9RETR/1-375    AC R9Y1S9.1
#=GS U5NHG1_9RETR/1-375    AC U5NHG1.1
#=GS U5NI72_9RETR/1-375    AC U5NI72.1
#=GS U5NHE4_9RETR/1-375    AC U5NHE4.1
#=GS R9XZS6_9RETR/1-375    AC R9XZS6.1
#=GS U5NHE3_9RETR/1-375    AC U5NHE3.1
#=GS R9Y004_9RETR/1-375    AC R9Y004.1
#=GS U5NIB0_9RETR/1-375    AC U5NIB0.1
#=GS R9Y193_9RETR/1-375    AC R9Y193.1
#=GS R9Y0N5_9RETR/1-375    AC R9Y0N5.1
#=GS R9Y006_9RETR/1-375    AC R9Y006.1
#=GS B2CGB8_9RETR/1-375    AC B2CGB8.1
#=GS U5NKD0_9RETR/1-375    AC U5NKD0.1
#=GS R9Y0V0_9RETR/1-375    AC R9Y0V0.1
#=GS R9Y1B4_9RETR/1-375    AC R9Y1B4.1
#=GS R9Y215_9RETR/1-375    AC R9Y215.1
#=GS R9Y0X7_9RETR/1-375    AC R9Y0X7.1
#=GS R9XZF8_9RETR/1-373    AC R9XZF8.1
#=GS U5NLQ0_9RETR/1-375    AC U5NLQ0.1
#=GS R9Y0M2_9RETR/1-375    AC R9Y0M2.1
#=GS R9XZL4_9RETR/1-375    AC R9XZL4.1
#=GS U5NLR1_9RETR/1-375    AC U5NLR1.1
#=GS R9Y1D3_9RETR/1-375    AC R9Y1D3.1
#=GS R9Y0L6_9RETR/1-375    AC R9Y0L6.1
#=GS U5NHN3_9RETR/1-374    AC U5NHN3.1
#=GS R9Y281_9RETR/1-373    AC R9Y281.1
#=GS U5NHF1_9RETR/1-375    AC U5NHF1.1
#=GS U5NIF0_9RETR/1-375    AC U5NIF0.1
#=GS R9Y047_9RETR/1-375    AC R9Y047.1
#=GS R9Y1W2_9RETR/1-375    AC R9Y1W2.1
#=GS U5NI29_9RETR/1-375    AC U5NI29.1
#=GS R9Y128_9RETR/1-375    AC R9Y128.1
#=GS U5NI60_9RETR/1-375    AC U5NI60.1
#=GS R9XZL9_9RETR/1-375    AC R9XZL9.1
#=GS R9Y0S9_9RETR/1-375    AC R9Y0S9.1
#=GS R9Y0H4_9RETR/1-375    AC R9Y0H4.1
#=GS U5NLL7_9RETR/1-375    AC U5NLL7.1
#=GS U5NIP9_9RETR/1-375    AC U5NIP9.1
#=GS U5NKJ9_9RETR/1-375    AC U5NKJ9.1
#=GS R9XYR7_9RETR/1-375    AC R9XYR7.1
#=GS U5NI13_9RETR/1-375    AC U5NI13.1
#=GS R9Y178_9RETR/1-375    AC R9Y178.1
#=GS R9Y0C3_9RETR/1-375    AC R9Y0C3.1
#=GS R9Y041_9RETR/1-375    AC R9Y041.1
#=GS R9Y0J2_9RETR/1-375    AC R9Y0J2.1
#=GS R9XZM5_9RETR/1-375    AC R9XZM5.1
#=GS R9Y0Q8_9RETR/1-375    AC R9Y0Q8.1
#=GS R9Y044_9RETR/1-375    AC R9Y044.1
#=GS R9XZJ5_9RETR/1-375    AC R9XZJ5.1
#=GS U5NLR7_9RETR/1-375    AC U5NLR7.1
#=GS U5NLG9_9RETR/1-375    AC U5NLG9.1
#=GS U5NIK5_9RETR/1-375    AC U5NIK5.1
#=GS R9Y1L4_9RETR/1-375    AC R9Y1L4.1
#=GS R9XY65_9RETR/1-375    AC R9XY65.1
#=GS R9Y1G0_9RETR/1-375    AC R9Y1G0.1
#=GS R9Y1W1_9RETR/1-375    AC R9Y1W1.1
#=GS U5NLB8_9RETR/1-375    AC U5NLB8.1
#=GS B2CGB2_9RETR/1-375    AC B2CGB2.1
#=GS R9Y1L5_9RETR/1-375    AC R9Y1L5.1
#=GS U5NKL1_9RETR/1-375    AC U5NKL1.1
#=GS U5NLU5_9RETR/1-375    AC U5NLU5.1
#=GS R9Y0Q7_9RETR/1-372    AC R9Y0Q7.1
#=GS B2CGC4_9RETR/1-374    AC B2CGC4.1
#=GS U5NH86_9RETR/1-375    AC U5NH86.1
#=GS R9XY16_9RETR/1-375    AC R9XY16.1
#=GS U5NLF4_9RETR/1-375    AC U5NLF4.1
#=GS R9Y090_9RETR/1-375    AC R9Y090.1
#=GS R9Y0C4_9RETR/1-375    AC R9Y0C4.1
#=GS U5NIF8_9RETR/1-375    AC U5NIF8.1
#=GS U5NH32_9RETR/4-280    AC U5NH32.1
#=GS R9Y0W2_9RETR/1-375    AC R9Y0W2.1
#=GS U5NKS7_9RETR/1-374    AC U5NKS7.1
#=GS R9XYQ8_9RETR/1-375    AC R9XYQ8.1
#=GS R9XZT4_9RETR/1-375    AC R9XZT4.1
#=GS R9Y1Q6_9RETR/1-375    AC R9Y1Q6.1
#=GS U5NHY7_9RETR/1-375    AC U5NHY7.1
#=GS U5NHY3_9RETR/1-375    AC U5NHY3.1
#=GS R9Y2B8_9RETR/1-375    AC R9Y2B8.1
#=GS R9Y2R8_9RETR/1-375    AC R9Y2R8.1
#=GS R9XZX0_9RETR/1-375    AC R9XZX0.1
#=GS U5NLS1_9RETR/1-375    AC U5NLS1.1
#=GS R9XZG6_9RETR/1-375    AC R9XZG6.1
#=GS U5NHL9_9RETR/1-375    AC U5NHL9.1
#=GS R9XZI7_9RETR/1-375    AC R9XZI7.1
#=GS U5NLJ4_9RETR/1-375    AC U5NLJ4.1
#=GS U5NHP1_9RETR/1-375    AC U5NHP1.1
#=GS R9Y1K7_9RETR/1-375    AC R9Y1K7.1
#=GS U5NH78_9RETR/1-375    AC U5NH78.1
#=GS U5NI85_9RETR/1-375    AC U5NI85.1
#=GS R9Y136_9RETR/1-375    AC R9Y136.1
#=GS R9Y0A5_9RETR/1-375    AC R9Y0A5.1
#=GS H6V7I7_SFV1/5-612     AC H6V7I7.1
#=GS B3FXD3_9RETR/1-204    AC B3FXD3.1
#=GS R9Y249_9RETR/1-373    AC R9Y249.1
#=GS U5NI19_9RETR/1-375    AC U5NI19.1
#=GS U5NLD4_9RETR/1-375    AC U5NLD4.1
#=GS R9Y0A8_9RETR/1-375    AC R9Y0A8.1
#=GS U5NLS4_9RETR/1-375    AC U5NLS4.1
#=GS R9Y1G3_9RETR/1-375    AC R9Y1G3.1
#=GS R9Y1R8_9RETR/1-375    AC R9Y1R8.1
#=GS R9Y0L1_9RETR/1-375    AC R9Y0L1.1
#=GS R9Y252_9RETR/1-373    AC R9Y252.1
#=GS U5NKD9_9RETR/1-375    AC U5NKD9.1
#=GS U5NKT8_9RETR/1-375    AC U5NKT8.1
#=GS U5NL49_9RETR/1-375    AC U5NL49.1
#=GS U5NIQ4_9RETR/1-375    AC U5NIQ4.1
#=GS R9Y2Q7_9RETR/1-375    AC R9Y2Q7.1
#=GS R9Y198_9RETR/1-373    AC R9Y198.1
#=GS R9Y0T7_9RETR/1-375    AC R9Y0T7.1
#=GS U5NHT6_9RETR/1-375    AC U5NHT6.1
#=GS R9Y0T9_9RETR/1-375    AC R9Y0T9.1
#=GS R9Y1M8_9RETR/1-375    AC R9Y1M8.1
#=GS U5NLC0_9RETR/1-375    AC U5NLC0.1
#=GS B3FXE7_9RETR/1-204    AC B3FXE7.1
#=GS U5NHZ2_9RETR/1-375    AC U5NHZ2.1
#=GS R9Y125_9RETR/1-375    AC R9Y125.1
#=GS R9Y1D9_9RETR/1-375    AC R9Y1D9.1
#=GS R9Y2C3_9RETR/1-375    AC R9Y2C3.1
#=GS U5NKL4_9RETR/1-375    AC U5NKL4.1
#=GS R9XY02_9RETR/1-375    AC R9XY02.1
#=GS B3FXF4_9RETR/1-204    AC B3FXF4.1
#=GS R9Y037_9RETR/1-375    AC R9Y037.1
#=GS U5NK82_9RETR/1-375    AC U5NK82.1
#=GS U5NHG7_9RETR/1-375    AC U5NHG7.1
#=GS U5NKI1_9RETR/1-375    AC U5NKI1.1
#=GS R9Y122_9RETR/1-375    AC R9Y122.1
#=GS R9XZX3_9RETR/1-375    AC R9XZX3.1
#=GS R9XZX8_9RETR/1-375    AC R9XZX8.1
#=GS R9XZ26_9RETR/1-375    AC R9XZ26.1
#=GS R9Y062_9RETR/1-375    AC R9Y062.1
#=GS R9Y1R4_9RETR/1-375    AC R9Y1R4.1
#=GS R9Y0J7_9RETR/1-375    AC R9Y0J7.1
#=GS R9XZU0_9RETR/1-375    AC R9XZU0.1
#=GS R9Y2M6_9RETR/1-375    AC R9Y2M6.1
#=GS U5NK78_9RETR/1-375    AC U5NK78.1
#=GS R9XZX7_9RETR/1-375    AC R9XZX7.1
#=GS U5NL04_9RETR/1-375    AC U5NL04.1
#=GS B3FXG1_9RETR/1-204    AC B3FXG1.1
#=GS U5NIJ5_9RETR/1-375    AC U5NIJ5.1
#=GS R9Y143_9RETR/1-373    AC R9Y143.1
#=GS R9Y1P9_9RETR/1-375    AC R9Y1P9.1
#=GS R9XZZ9_9RETR/1-375    AC R9XZZ9.1
#=GS U5NKJ7_9RETR/1-375    AC U5NKJ7.1
#=GS U5NLU2_9RETR/1-375    AC U5NLU2.1
#=GS R9Y1C8_9RETR/1-375    AC R9Y1C8.1
#=GS R9Y1B2_9RETR/1-373    AC R9Y1B2.1
#=GS B3FXD8_9RETR/1-204    AC B3FXD8.1
#=GS U5NLJ9_9RETR/1-375    AC U5NLJ9.1
#=GS R9Y1U2_9RETR/1-375    AC R9Y1U2.1
#=GS L7RYH3_FFV/158-506    AC L7RYH3.1
#=GS R9Y0F0_9RETR/1-375    AC R9Y0F0.1
#=GS R9XZ51_9RETR/1-375    AC R9XZ51.1
#=GS R9Y1I8_9RETR/1-375    AC R9Y1I8.1
#=GS U5NL83_9RETR/1-375    AC U5NL83.1
#=GS U5NIG8_9RETR/1-375    AC U5NIG8.1
#=GS U5NH48_9RETR/1-375    AC U5NH48.1
#=GS U5NHI3_9RETR/1-375    AC U5NHI3.1
#=GS R9Y140_9RETR/1-373    AC R9Y140.1
#=GS U5NKI5_9RETR/1-375    AC U5NKI5.1
#=GS U5NHK8_9RETR/1-375    AC U5NHK8.1
#=GS R9Y2L0_9RETR/1-375    AC R9Y2L0.1
#=GS U5NHA1_9RETR/1-375    AC U5NHA1.1
#=GS U5NL38_9RETR/1-375    AC U5NL38.1
#=GS R9Y086_9RETR/1-375    AC R9Y086.1
#=GS U5NHE2_9RETR/1-375    AC U5NHE2.1
#=GS R9XYA3_9RETR/1-375    AC R9XYA3.1
#=GS U5NI69_9RETR/1-375    AC U5NI69.1
#=GS U5NGY4_9RETR/1-375    AC U5NGY4.1
#=GS R9Y031_9RETR/1-375    AC R9Y031.1
#=GS K0GWL1_9RETR/1-99     AC K0GWL1.1
#=GS R9XZR9_9RETR/1-375    AC R9XZR9.1
#=GS B3FXG5_9RETR/1-204    AC B3FXG5.1
#=GS R9Y0L0_9RETR/1-375    AC R9Y0L0.1
#=GS R9Y0T3_9RETR/1-375    AC R9Y0T3.1
#=GS Q77YG5_FOAMV/9-617    AC Q77YG5.1
#=GS U5NHL1_9RETR/1-375    AC U5NHL1.1
#=GS R9Y1C1_9RETR/1-375    AC R9Y1C1.1
#=GS R9Y210_9RETR/1-375    AC R9Y210.1
#=GS R9Y1W7_9RETR/1-375    AC R9Y1W7.1
#=GS R9XYE8_9RETR/1-375    AC R9XYE8.1
#=GS R9Y0B9_9RETR/1-375    AC R9Y0B9.1
#=GS Q6XZS1_9RETR/1-204    AC Q6XZS1.1
#=GS U5NKQ2_9RETR/1-375    AC U5NKQ2.1
#=GS R9Y0K5_9RETR/1-375    AC R9Y0K5.1
#=GS R9Y1C3_9RETR/1-375    AC R9Y1C3.1
#=GS U5NHF3_9RETR/1-375    AC U5NHF3.1
#=GS U5NH93_9RETR/1-375    AC U5NH93.1
#=GS U5NKF4_9RETR/12-280   AC U5NKF4.1
#=GS U5NL52_9RETR/1-375    AC U5NL52.1
#=GS R9XXX9_9RETR/1-375    AC R9XXX9.1
#=GS B2CGB5_9RETR/1-375    AC B2CGB5.1
#=GS R9Y0F3_9RETR/1-375    AC R9Y0F3.1
#=GS R9Y0E2_9RETR/1-375    AC R9Y0E2.1
#=GS R9XZT5_9RETR/1-375    AC R9XZT5.1
#=GS U5NL27_9RETR/1-375    AC U5NL27.1
#=GS U5NLX7_9RETR/1-375    AC U5NLX7.1
#=GS R9Y1Q2_9RETR/1-375    AC R9Y1Q2.1
#=GS U5NL19_9RETR/1-375    AC U5NL19.1
#=GS U5NHB9_9RETR/1-375    AC U5NHB9.1
#=GS R9Y0I9_9RETR/1-375    AC R9Y0I9.1
#=GS B3FXC3_9RETR/1-204    AC B3FXC3.1
#=GS R9Y0X0_9RETR/1-375    AC R9Y0X0.1
#=GS U5NHB5_9RETR/1-375    AC U5NHB5.1
#=GS R9XZT9_9RETR/1-375    AC R9XZT9.1
#=GS R9Y121_9RETR/1-373    AC R9Y121.1
#=GS U5NLI9_9RETR/1-375    AC U5NLI9.1
#=GS U5NLC2_9RETR/1-375    AC U5NLC2.1
#=GS U5NHG3_9RETR/1-375    AC U5NHG3.1
#=GS U5NI22_9RETR/1-375    AC U5NI22.1
#=GS U5NHX5_9RETR/1-375    AC U5NHX5.1
#=GS R9Y028_9RETR/1-375    AC R9Y028.1
#=GS U5NHB4_9RETR/1-375    AC U5NHB4.1
#=GS R9Y139_9RETR/1-375    AC R9Y139.1
#=GS U5NGR1_9RETR/1-375    AC U5NGR1.1
#=GS R9Y0N0_9RETR/1-375    AC R9Y0N0.1
#=GS R9XZZ2_9RETR/1-375    AC R9XZZ2.1
#=GS U5NLP0_9RETR/1-375    AC U5NLP0.1
#=GS U5NH39_9RETR/12-280   AC U5NH39.1
#=GS R9Y163_9RETR/1-373    AC R9Y163.1
#=GS U5NHT4_9RETR/1-375    AC U5NHT4.1
#=GS R9XZQ5_9RETR/1-375    AC R9XZQ5.1
#=GS R9Y0K7_9RETR/1-375    AC R9Y0K7.1
#=GS R9Y0P1_9RETR/1-375    AC R9Y0P1.1
#=GS R9Y027_9RETR/1-375    AC R9Y027.1
#=GS R9Y113_9RETR/1-375    AC R9Y113.1
#=GS R9Y0A2_9RETR/1-375    AC R9Y0A2.1
#=GS R9XY26_9RETR/1-375    AC R9XY26.1
#=GS U5NHJ7_9RETR/1-375    AC U5NHJ7.1
#=GS R9Y199_9RETR/1-375    AC R9Y199.1
#=GS R9Y2P9_9RETR/1-375    AC R9Y2P9.1
#=GS R9Y175_9RETR/1-373    AC R9Y175.1
#=GS U5NI54_9RETR/1-375    AC U5NI54.1
#=GS U5NLV9_9RETR/1-375    AC U5NLV9.1
#=GS R9Y202_9RETR/1-375    AC R9Y202.1
#=GS R9Y1M9_9RETR/1-375    AC R9Y1M9.1
#=GS R9Y1Z8_9RETR/1-375    AC R9Y1Z8.1
#=GS R9Y2V8_9RETR/1-375    AC R9Y2V8.1
#=GS R9RTY9_SFV1/5-612     AC R9RTY9.1
#=GS R9Y1K3_9RETR/1-375    AC R9Y1K3.1
#=GS R9Y1J1_9RETR/1-375    AC R9Y1J1.1
#=GS R9Y277_9RETR/1-373    AC R9Y277.1
#=GS R9Y0S5_9RETR/1-375    AC R9Y0S5.1
#=GS U5NHX0_9RETR/1-375    AC U5NHX0.1
#=GS R9XZP5_9RETR/1-375    AC R9XZP5.1
#=GS U5NHZ9_9RETR/1-375    AC U5NHZ9.1
#=GS J9VBP6_9RETR/168-518  AC J9VBP6.1
#=GS R9XZW0_9RETR/1-375    AC R9XZW0.1
#=GS R9Y1K9_9RETR/1-375    AC R9Y1K9.1
#=GS U5NHY9_9RETR/1-375    AC U5NHY9.1
#=GS U5NGK7_9RETR/1-375    AC U5NGK7.1
#=GS R9Y085_9RETR/1-375    AC R9Y085.1
#=GS B3FXG6_9RETR/1-204    AC B3FXG6.1
#=GS U5NI55_9RETR/1-375    AC U5NI55.1
#=GS U5NI09_9RETR/1-375    AC U5NI09.1
#=GS R9Y082_9RETR/1-375    AC R9Y082.1
#=GS R9Y0J1_9RETR/1-375    AC R9Y0J1.1
#=GS R9Y2A5_9RETR/1-375    AC R9Y2A5.1
#=GS R9XZQ0_9RETR/1-375    AC R9XZQ0.1
#=GS R9Y2V1_9RETR/1-375    AC R9Y2V1.1
#=GS Q9J4C8_9RETR/178-550  AC Q9J4C8.1
#=GS R9XZM6_9RETR/1-375    AC R9XZM6.1
#=GS R9XZV5_9RETR/1-375    AC R9XZV5.1
#=GS R9Y0I0_9RETR/1-375    AC R9Y0I0.1
#=GS U5NIC4_9RETR/1-375    AC U5NIC4.1
#=GS U5NLD3_9RETR/1-375    AC U5NLD3.1
#=GS U5NI38_9RETR/1-375    AC U5NI38.1
#=GS U5NLE6_9RETR/1-375    AC U5NLE6.1
#=GS R9Y1N1_9RETR/1-375    AC R9Y1N1.1
#=GS R9Y011_9RETR/1-375    AC R9Y011.1
#=GS U5NIM2_9RETR/1-375    AC U5NIM2.1
#=GS U5NGX7_9RETR/1-375    AC U5NGX7.1
#=GS U5NH02_9RETR/1-375    AC U5NH02.1
#=GS Q8ALU2_9RETR/157-518  AC Q8ALU2.1
#=GS U5NHS9_9RETR/1-375    AC U5NHS9.1
#=GS R9Y1I5_9RETR/1-375    AC R9Y1I5.1
#=GS B3FXH8_9RETR/1-204    AC B3FXH8.1
#=GS U5NL86_9RETR/1-375    AC U5NL86.1
#=GS U5NLB3_9RETR/1-375    AC U5NLB3.1
#=GS R9Y120_9RETR/1-375    AC R9Y120.1
#=GS R9XZ99_9RETR/1-375    AC R9XZ99.1
#=GS U5NI33_9RETR/1-375    AC U5NI33.1
#=GS R9Y0S4_9RETR/1-375    AC R9Y0S4.1
#=GS U5NKC6_9RETR/1-375    AC U5NKC6.1
#=GS R9Y1H8_9RETR/1-375    AC R9Y1H8.1
#=GS R9Y1J9_9RETR/1-375    AC R9Y1J9.1
#=GS R9XZL6_9RETR/1-375    AC R9XZL6.1
#=GS R9Y1G1_9RETR/1-375    AC R9Y1G1.1
#=GS R9Y1M3_9RETR/1-375    AC R9Y1M3.1
#=GS R9Y1B3_9RETR/1-375    AC R9Y1B3.1
#=GS R9XY73_9RETR/1-375    AC R9XY73.1
#=GS R9Y0D9_9RETR/1-375    AC R9Y0D9.1
#=GS U5NKD4_9RETR/1-375    AC U5NKD4.1
#=GS R9Y009_9RETR/1-375    AC R9Y009.1
#=GS R9XYC1_9RETR/1-375    AC R9XYC1.1
#=GS U5NH20_9RETR/1-375    AC U5NH20.1
#=GS U5NIJ7_9RETR/1-375    AC U5NIJ7.1
#=GS R9Y1F9_9RETR/1-375    AC R9Y1F9.1
#=GS R9XZ55_9RETR/1-375    AC R9XZ55.1
#=GS U5NLR6_9RETR/1-375    AC U5NLR6.1
#=GS U5NHD1_9RETR/1-375    AC U5NHD1.1
#=GS B2CGC1_9RETR/1-374    AC B2CGC1.1
#=GS R9Y0W7_9RETR/1-375    AC R9Y0W7.1
#=GS R9XY12_9RETR/1-375    AC R9XY12.1
#=GS B3FXF1_9RETR/1-204    AC B3FXF1.1
#=GS U5NKG2_9RETR/1-375    AC U5NKG2.1
#=GS U5NHK7_9RETR/1-375    AC U5NHK7.1
#=GS U5NH96_9RETR/1-375    AC U5NH96.1
#=GS R9Y071_9RETR/1-375    AC R9Y071.1
#=GS R9Y0T0_9RETR/1-375    AC R9Y0T0.1
#=GS U5NGX1_9RETR/1-375    AC U5NGX1.1
#=GS U5NLA5_9RETR/1-375    AC U5NLA5.1
#=GS U5NL95_9RETR/1-375    AC U5NL95.1
#=GS U5NKE0_9RETR/10-278   AC U5NKE0.1
#=GS R9XY98_9RETR/1-375    AC R9XY98.1
#=GS R9Y2C8_9RETR/1-375    AC R9Y2C8.1
#=GS R9Y151_9RETR/1-375    AC R9Y151.1
#=GS R9Y159_9RETR/1-373    AC R9Y159.1
#=GS R9XZU3_9RETR/1-375    AC R9XZU3.1
#=GS R9Y2L5_9RETR/1-375    AC R9Y2L5.1
#=GS R9Y016_9RETR/1-375    AC R9Y016.1
#=GS U5NHN8_9RETR/1-375    AC U5NHN8.1
#=GS B2CGC3_9RETR/1-374    AC B2CGC3.1
#=GS R9XZF5_9RETR/1-375    AC R9XZF5.1
#=GS R9XYE0_9RETR/1-375    AC R9XYE0.1
#=GS R9Y0F2_9RETR/1-375    AC R9Y0F2.1
#=GS R9Y0F8_9RETR/1-375    AC R9Y0F8.1
#=GS R9XZH7_9RETR/1-375    AC R9XZH7.1
#=GS R9Y0G9_9RETR/1-375    AC R9Y0G9.1
#=GS U5NGZ1_9RETR/1-375    AC U5NGZ1.1
#=GS U5NLT4_9RETR/1-375    AC U5NLT4.1
#=GS R9XZ31_9RETR/1-375    AC R9XZ31.1
#=GS R9Y081_9RETR/1-375    AC R9Y081.1
#=GS R9Y194_9RETR/1-375    AC R9Y194.1
#=GS R9Y0V2_9RETR/1-375    AC R9Y0V2.1
#=GS R9Y2I7_9RETR/1-375    AC R9Y2I7.1
#=GS R9Y1D0_9RETR/1-373    AC R9Y1D0.1
#=GS R9Y1F5_9RETR/1-375    AC R9Y1F5.1
#=GS U5NID8_9RETR/1-375    AC U5NID8.1
#=GS U5NHR7_9RETR/1-375    AC U5NHR7.1
#=GS R9Y1J0_9RETR/1-375    AC R9Y1J0.1
#=GS U5NLR2_9RETR/1-375    AC U5NLR2.1
#=GS R9Y1H7_9RETR/1-375    AC R9Y1H7.1
#=GS R9Y1T8_9RETR/1-375    AC R9Y1T8.1
#=GS U5NLK2_9RETR/1-375    AC U5NLK2.1
#=GS R9XZP0_9RETR/1-375    AC R9XZP0.1
#=GS U5NLT8_9RETR/1-375    AC U5NLT8.1
#=GS U5NKU4_9RETR/1-375    AC U5NKU4.1
#=GS R9Y0T1_9RETR/1-375    AC R9Y0T1.1
#=GS Q6XZR2_9RETR/1-204    AC Q6XZR2.1
#=GS U5NIA5_9RETR/1-375    AC U5NIA5.1
#=GS U5NK88_9RETR/1-375    AC U5NK88.1
#=GS R9Y2U0_9RETR/1-375    AC R9Y2U0.1
#=GS U5NIM8_9RETR/1-375    AC U5NIM8.1
#=GS R9Y1I7_9RETR/1-375    AC R9Y1I7.1
#=GS R9Y138_9RETR/1-373    AC R9Y138.1
#=GS B2CGC5_9RETR/1-375    AC B2CGC5.1
#=GS U5NI25_9RETR/1-375    AC U5NI25.1
#=GS U5NKC2_9RETR/1-375    AC U5NKC2.1
#=GS U5NI70_9RETR/1-375    AC U5NI70.1
#=GS Q6XZR1_9RETR/1-204    AC Q6XZR1.1
#=GS B3FXF6_9RETR/1-204    AC B3FXF6.1
#=GS R9Y1L1_9RETR/1-375    AC R9Y1L1.1
#=GS R9Y2X4_9RETR/1-375    AC R9Y2X4.1
#=GS R9Y0N8_9RETR/1-375    AC R9Y0N8.1
#=GS R9XY21_9RETR/1-375    AC R9XY21.1
#=GS R9XZW1_9RETR/1-375    AC R9XZW1.1
#=GS U5NLU0_9RETR/1-375    AC U5NLU0.1
#=GS R9Y131_9RETR/1-373    AC R9Y131.1
#=GS U5NH14_9RETR/1-375    AC U5NH14.1
#=GS R9Y149_9RETR/1-373    AC R9Y149.1
#=GS U5NHJ4_9RETR/1-374    AC U5NHJ4.1
#=GS J9V869_9RETR/16-156   AC J9V869.1
#=GS R9Y1B8_9RETR/1-375    AC R9Y1B8.1
#=GS R9Y1D1_9RETR/1-375    AC R9Y1D1.1
#=GS R9Y2B1_9RETR/1-375    AC R9Y2B1.1
#=GS R9Y0L7_9RETR/1-375    AC R9Y0L7.1
#=GS R9XZS4_9RETR/1-375    AC R9XZS4.1
#=GS U5NH98_9RETR/1-375    AC U5NH98.1
#=GS B3FXD1_9RETR/1-204    AC B3FXD1.1
#=GS U5NLI3_9RETR/1-375    AC U5NLI3.1
#=GS R9Y039_9RETR/1-375    AC R9Y039.1
#=GS R9Y1L8_9RETR/1-375    AC R9Y1L8.1
#=GS R9Y2S9_9RETR/1-375    AC R9Y2S9.1
#=GS R9Y0I4_9RETR/1-375    AC R9Y0I4.1
#=GS R9XY32_9RETR/1-375    AC R9XY32.1
#=GS R9Y169_9RETR/1-375    AC R9Y169.1
#=GS R9Y263_9RETR/1-373    AC R9Y263.1
#=GS U5NKT3_9RETR/1-375    AC U5NKT3.1
#=GS B2CGB7_9RETR/1-375    AC B2CGB7.1
#=GS R9Y0X4_9RETR/1-375    AC R9Y0X4.1
#=GS R9XYX8_9RETR/1-375    AC R9XYX8.1
#=GS U5NLC4_9RETR/1-375    AC U5NLC4.1
#=GS B3FXH4_9RETR/1-204    AC B3FXH4.1
#=GS R9XYQ3_9RETR/1-375    AC R9XYQ3.1
#=GS U5NIA7_9RETR/1-375    AC U5NIA7.1
#=GS B3FXC5_9RETR/1-204    AC B3FXC5.1
#=GS R9Y0W6_9RETR/1-375    AC R9Y0W6.1
#=GS U5NLG0_9RETR/1-375    AC U5NLG0.1
#=GS U5NH61_9RETR/1-375    AC U5NH61.1
#=GS U5NL29_9RETR/1-375    AC U5NL29.1
#=GS B3FXF2_9RETR/1-204    AC B3FXF2.1
#=GS R9Y1M6_9RETR/1-375    AC R9Y1M6.1
#=GS U5NHE5_9RETR/1-375    AC U5NHE5.1
#=GS R9Y0T5_9RETR/1-375    AC R9Y0T5.1
#=GS U5NL09_9RETR/1-375    AC U5NL09.1
#=GS R9Y0E8_9RETR/1-375    AC R9Y0E8.1
#=GS U5NKY7_9RETR/1-375    AC U5NKY7.1
#=GS U5NHK5_9RETR/1-375    AC U5NHK5.1
#=GS U5NL78_9RETR/1-375    AC U5NL78.1
#=GS R9XYS2_9RETR/1-375    AC R9XYS2.1
#=GS R9XZQ7_9RETR/1-375    AC R9XZQ7.1
#=GS U5NLL2_9RETR/1-375    AC U5NLL2.1
#=GS U5NHL4_9RETR/1-375    AC U5NHL4.1
#=GS R9Y0P5_9RETR/1-375    AC R9Y0P5.1
#=GS R9XZC9_9RETR/1-373    AC R9XZC9.1
#=GS U5NLQ2_9RETR/1-375    AC U5NLQ2.1
#=GS R9Y1A0_9RETR/1-375    AC R9Y1A0.1
#=GS U5NKU1_9RETR/1-375    AC U5NKU1.1
#=GS U5NI79_9RETR/1-375    AC U5NI79.1
#=GS U5NLZ4_9RETR/1-375    AC U5NLZ4.1
#=GS R9XZL1_9RETR/1-375    AC R9XZL1.1
#=GS U5NIJ3_9RETR/1-375    AC U5NIJ3.1
#=GS GAG_SFV1/5-612        AC Q00071.1
#=GS R9XZK3_9RETR/1-375    AC R9XZK3.1
#=GS U5NHZ8_9RETR/1-375    AC U5NHZ8.1
#=GS R9Y1N6_9RETR/1-375    AC R9Y1N6.1
#=GS Q98826_9RETR/9-617    AC Q98826.1
#=GS Q98826_9RETR/9-617    DR PDB; 4JMR B; 9-179;
#=GS Q98826_9RETR/9-617    DR PDB; 4JMR D; 9-173;
#=GS Q98826_9RETR/9-617    DR PDB; 4JMR A; 9-179;
#=GS Q98826_9RETR/9-617    DR PDB; 4JMR C; 9-174;
#=GS R9Y0U1_9RETR/1-375    AC R9Y0U1.1
#=GS R9Y127_9RETR/1-373    AC R9Y127.1
#=GS R9Y0Y2_9RETR/1-375    AC R9Y0Y2.1
#=GS U5NKE5_9RETR/1-375    AC U5NKE5.1
#=GS J9V869_9RETR/169-516  AC J9V869.1
#=GS J9VBP6_9RETR/16-156   AC J9VBP6.1
#=GS R9XZ00_9RETR/1-375    AC R9XZ00.1
#=GS R9XXY3_9RETR/1-375    AC R9XXY3.1
#=GS R9Y174_9RETR/1-373    AC R9Y174.1
#=GS R9Y0Z0_9RETR/1-375    AC R9Y0Z0.1
#=GS U5NGP2_9RETR/1-375    AC U5NGP2.1
#=GS R9Y099_9RETR/1-375    AC R9Y099.1
#=GS U5NL00_9RETR/1-375    AC U5NL00.1
#=GS R9XZP3_9RETR/1-375    AC R9XZP3.1
#=GS R9Y0Z1_9RETR/1-375    AC R9Y0Z1.1
#=GS U5NGM1_9RETR/1-375    AC U5NGM1.1
#=GS R9Y1G4_9RETR/1-375    AC R9Y1G4.1
#=GS R9XXZ2_9RETR/1-375    AC R9XXZ2.1
#=GS R9Y030_9RETR/1-375    AC R9Y030.1
#=GS R9Y1G9_9RETR/1-375    AC R9Y1G9.1
#=GS Q8ALU2_9RETR/16-156   AC Q8ALU2.1
#=GS R9Y176_9RETR/1-375    AC R9Y176.1
#=GS R9XYP8_9RETR/1-375    AC R9XYP8.1
#=GS R9Y1I2_9RETR/1-375    AC R9Y1I2.1
#=GS R9Y0Y7_9RETR/1-375    AC R9Y0Y7.1
#=GS R9Y0N3_9RETR/1-375    AC R9Y0N3.1
#=GS R9Y1B9_9RETR/1-373    AC R9Y1B9.1
#=GS R9Y013_9RETR/1-375    AC R9Y013.1
#=GS U5NHV6_9RETR/1-375    AC U5NHV6.1
#=GS U5NL57_9RETR/1-375    AC U5NL57.1
#=GS R9Y124_9RETR/1-373    AC R9Y124.1
#=GS R9Y092_9RETR/1-375    AC R9Y092.1
#=GS U5NHS0_9RETR/1-375    AC U5NHS0.1
#=GS R9Y1X9_9RETR/1-375    AC R9Y1X9.1
#=GS R9Y0V3_9RETR/1-375    AC R9Y0V3.1
#=GS U5NLS8_9RETR/1-375    AC U5NLS8.1
#=GS U5NLH9_9RETR/1-375    AC U5NLH9.1
#=GS U5NHV4_9RETR/1-375    AC U5NHV4.1
#=GS Q6XZR4_9RETR/1-204    AC Q6XZR4.1
#=GS R9XZN8_9RETR/1-375    AC R9XZN8.1
#=GS U5NHS8_9RETR/1-375    AC U5NHS8.1
#=GS U5NKE9_9RETR/1-375    AC U5NKE9.1
#=GS B3FXE4_9RETR/1-204    AC B3FXE4.1
#=GS R9Y2S3_9RETR/1-375    AC R9Y2S3.1
#=GS U5NHS3_9RETR/1-375    AC U5NHS3.1
#=GS B2CGB4_9RETR/1-375    AC B2CGB4.1
#=GS R9Y1M1_9RETR/1-375    AC R9Y1M1.1
#=GS R9Y1I3_9RETR/1-375    AC R9Y1I3.1
#=GS R9XZY0_9RETR/1-375    AC R9XZY0.1
#=GS U5NH26_9RETR/1-373    AC U5NH26.1
#=GS R9XYM6_9RETR/1-375    AC R9XYM6.1
#=GS U5NI83_9RETR/1-375    AC U5NI83.1
#=GS U5NHW0_9RETR/1-375    AC U5NHW0.1
#=GS U5NHS5_9RETR/1-375    AC U5NHS5.1
#=GS U5NLP2_9RETR/1-375    AC U5NLP2.1
#=GS R9XZW2_9RETR/1-375    AC R9XZW2.1
#=GS U5NHX3_9RETR/1-375    AC U5NHX3.1
#=GS R9Y1A2_9RETR/1-373    AC R9Y1A2.1
#=GS R9XYW8_9RETR/1-375    AC R9XYW8.1
#=GS R9XYA8_9RETR/1-375    AC R9XYA8.1
#=GS R9Y1W5_9RETR/1-375    AC R9Y1W5.1
#=GS R9Y0H5_9RETR/1-375    AC R9Y0H5.1
#=GS R9XZV6_9RETR/1-375    AC R9XZV6.1
#=GS U5NIC9_9RETR/1-375    AC U5NIC9.1
#=GS U5NHI8_9RETR/1-375    AC U5NHI8.1
#=GS R9Y0C2_9RETR/1-375    AC R9Y0C2.1
#=GS R9Y107_9RETR/1-375    AC R9Y107.1
#=GS R9Y001_9RETR/1-375    AC R9Y001.1
#=GS U5NHA9_9RETR/1-375    AC U5NHA9.1
#=GS GAG_FFV/158-504       AC O56860.1
#=GS R9Y1D8_9RETR/1-375    AC R9Y1D8.1
#=GS R9XYW5_9RETR/1-375    AC R9XYW5.1
#=GS R9Y1W8_9RETR/1-372    AC R9Y1W8.1
#=GS R9Y1K6_9RETR/1-375    AC R9Y1K6.1
#=GS R9XZT1_9RETR/1-375    AC R9XZT1.1
#=GS R9XYT1_9RETR/1-375    AC R9XYT1.1
#=GS R9XY51_9RETR/1-375    AC R9XY51.1
#=GS R9Y0L3_9RETR/1-375    AC R9Y0L3.1
#=GS U5NKZ5_9RETR/1-375    AC U5NKZ5.1
#=GS U5NKH4_9RETR/1-375    AC U5NKH4.1
#=GS U5NIH3_9RETR/1-375    AC U5NIH3.1
#=GS R9Y0M3_9RETR/1-375    AC R9Y0M3.1
#=GS R9Y1J7_9RETR/1-375    AC R9Y1J7.1
#=GS U5NKF3_9RETR/1-375    AC U5NKF3.1
#=GS R9XYK5_9RETR/1-375    AC R9XYK5.1
#=GS U5NHH8_9RETR/1-375    AC U5NHH8.1
#=GS R9XZ39_9RETR/1-373    AC R9XZ39.1
#=GS U5NH15_9RETR/1-375    AC U5NH15.1
#=GS R9XZK7_9RETR/1-374    AC R9XZK7.1
#=GS R9Y1U5_9RETR/1-375    AC R9Y1U5.1
#=GS R9XZ85_9RETR/1-375    AC R9XZ85.1
#=GS R9Y0G5_9RETR/1-375    AC R9Y0G5.1
#=GS U5NLF5_9RETR/1-375    AC U5NLF5.1
#=GS Q6XZS6_9RETR/1-204    AC Q6XZS6.1
#=GS U5NLJ2_9RETR/1-375    AC U5NLJ2.1
#=GS U5NLE2_9RETR/1-375    AC U5NLE2.1
#=GS B2CGC0_9RETR/1-375    AC B2CGC0.1
#=GS U5NKN6_9RETR/1-375    AC U5NKN6.1
#=GS R9Y260_9RETR/1-373    AC R9Y260.1
#=GS R9Y186_9RETR/1-375    AC R9Y186.1
#=GS U5NM06_9RETR/1-375    AC U5NM06.1
#=GS R9Y2L8_9RETR/1-375    AC R9Y2L8.1
#=GS R9Y0C9_9RETR/1-375    AC R9Y0C9.1
#=GS U5NHW5_9RETR/1-374    AC U5NHW5.1
#=GS R9XYD4_9RETR/1-375    AC R9XYD4.1
#=GS U5NL07_9RETR/1-375    AC U5NL07.1
#=GS R9Y1A7_9RETR/1-373    AC R9Y1A7.1
#=GS U5NHK1_9RETR/1-375    AC U5NHK1.1
#=GS R9Y0Z3_9RETR/1-375    AC R9Y0Z3.1
#=GS R9XYN1_9RETR/1-375    AC R9XYN1.1
#=GS U5NLM8_9RETR/1-375    AC U5NLM8.1
#=GS U5NHG8_9RETR/1-375    AC U5NHG8.1
#=GS U5NH69_9RETR/1-375    AC U5NH69.1
#=GS U5NHL5_9RETR/1-375    AC U5NHL5.1
#=GS U5NHE9_9RETR/1-375    AC U5NHE9.1
#=GS R9Y0Y0_9RETR/1-375    AC R9Y0Y0.1
#=GS Q45QF2_SFV1/5-609     AC Q45QF2.1
#=GS U5NLS6_9RETR/1-375    AC U5NLS6.1
#=GS R9Y1M4_9RETR/1-375    AC R9Y1M4.1
#=GS R9Y1A8_9RETR/1-375    AC R9Y1A8.1
#=GS U5NIK9_9RETR/1-375    AC U5NIK9.1
#=GS U5NLP9_9RETR/1-375    AC U5NLP9.1
#=GS R9XZH6_9RETR/1-375    AC R9XZH6.1
#=GS R9Y1F8_9RETR/1-375    AC R9Y1F8.1
#=GS U5NLP6_9RETR/1-375    AC U5NLP6.1
#=GS R9XZW5_9RETR/1-375    AC R9XZW5.1
#=GS R9Y097_9RETR/1-375    AC R9Y097.1
#=GS U5NKD6_9RETR/1-375    AC U5NKD6.1
#=GS R9Y1G5_9RETR/1-375    AC R9Y1G5.1
#=GS P87702_FFV/158-482    AC P87702.1
#=GS R9Y162_9RETR/1-375    AC R9Y162.1
#=GS U5NHT2_9RETR/1-375    AC U5NHT2.1
#=GS U5NI15_9RETR/1-375    AC U5NI15.1
#=GS R9Y0W8_9RETR/1-375    AC R9Y0W8.1
#=GS U5NHD7_9RETR/1-375    AC U5NHD7.1
#=GS U5NIL4_9RETR/1-375    AC U5NIL4.1
#=GS R9Y1N7_9RETR/1-375    AC R9Y1N7.1
#=GS R9Y155_9RETR/1-375    AC R9Y155.1
#=GS R9Y0W0_9RETR/1-375    AC R9Y0W0.1
#=GS R9Y024_9RETR/1-375    AC R9Y024.1
#=GS B3FXH3_9RETR/1-204    AC B3FXH3.1
#=GS B3FXG3_9RETR/1-204    AC B3FXG3.1
#=GS Q6XZR9_9RETR/1-213    AC Q6XZR9.1
#=GS R9Y091_9RETR/1-375    AC R9Y091.1
#=GS U5NI63_9RETR/1-375    AC U5NI63.1
#=GS R9Y0R0_9RETR/1-375    AC R9Y0R0.1
#=GS R9Y195_9RETR/1-375    AC R9Y195.1
#=GS U5NLL9_9RETR/1-375    AC U5NLL9.1
#=GS U5NKP7_9RETR/1-375    AC U5NKP7.1
#=GS R9Y109_9RETR/1-373    AC R9Y109.1
#=GS E2GD56_9RETR/9-612    AC E2GD56.1
#=GS R9Y1X4_9RETR/1-375    AC R9Y1X4.1
#=GS B3FXD4_9RETR/1-204    AC B3FXD4.1
#=GS U5NHY2_9RETR/1-375    AC U5NHY2.1
#=GS U5NHA7_9RETR/1-375    AC U5NHA7.1
#=GS R9Y0R6_9RETR/1-375    AC R9Y0R6.1
#=GS R9Y0X3_9RETR/1-375    AC R9Y0X3.1
#=GS R9Y1Q5_9RETR/1-375    AC R9Y1Q5.1
#=GS R9XYR3_9RETR/1-375    AC R9XYR3.1
#=GS R9Y1B7_9RETR/1-375    AC R9Y1B7.1
#=GS R9XYI9_9RETR/1-375    AC R9XYI9.1
#=GS U5NKM3_9RETR/1-375    AC U5NKM3.1
#=GS R9Y0S3_9RETR/1-375    AC R9Y0S3.1
#=GS R9XZ04_9RETR/1-375    AC R9XZ04.1
#=GS U5NGU7_9RETR/1-375    AC U5NGU7.1
#=GS R9Y1T1_9RETR/1-375    AC R9Y1T1.1
#=GS U5NHN1_9RETR/1-375    AC U5NHN1.1
#=GS U5NHF7_9RETR/1-375    AC U5NHF7.1
#=GS R9Y0R7_9RETR/1-375    AC R9Y0R7.1
#=GS R9Y068_9RETR/1-375    AC R9Y068.1
#=GS R9Y0K3_9RETR/1-375    AC R9Y0K3.1
#=GS R9Y0E3_9RETR/1-375    AC R9Y0E3.1
#=GS R9Y1K5_9RETR/1-375    AC R9Y1K5.1
#=GS U5NHY8_9RETR/1-375    AC U5NHY8.1
#=GS R9Y184_9RETR/1-375    AC R9Y184.1
#=GS R9Y1Z0_9RETR/1-375    AC R9Y1Z0.1
#=GS R9XY83_9RETR/1-375    AC R9XY83.1
#=GS U5NLI4_9RETR/1-375    AC U5NLI4.1
#=GS U5NGL1_9RETR/12-280   AC U5NGL1.1
#=GS R9XZQ1_9RETR/1-375    AC R9XZQ1.1
#=GS U5NL31_9RETR/1-375    AC U5NL31.1
#=GS R9Y079_9RETR/1-375    AC R9Y079.1
#=GS R9XY87_9RETR/1-375    AC R9XY87.1
#=GS Q6XZS7_9RETR/1-204    AC Q6XZS7.1
#=GS R9Y0P6_9RETR/1-375    AC R9Y0P6.1
#=GS U5NHK3_9RETR/1-375    AC U5NHK3.1
#=GS U5NIL6_9RETR/1-375    AC U5NIL6.1
#=GS U5NHB3_9RETR/1-375    AC U5NHB3.1
#=GS U5NHP9_9RETR/1-375    AC U5NHP9.1
#=GS R9Y1M0_9RETR/1-375    AC R9Y1M0.1
#=GS U5NHR8_9RETR/1-375    AC U5NHR8.1
#=GS U5NHD8_9RETR/1-375    AC U5NHD8.1
#=GS U5NLN8_9RETR/1-375    AC U5NLN8.1
#=GS U5NIE5_9RETR/1-375    AC U5NIE5.1
#=GS U5NKL9_9RETR/1-375    AC U5NKL9.1
#=GS R9Y010_9RETR/1-375    AC R9Y010.1
#=GS U5NHD4_9RETR/1-375    AC U5NHD4.1
#=GS U5NL94_9RETR/1-375    AC U5NL94.1
#=GS R9Y1L6_9RETR/1-375    AC R9Y1L6.1
#=GS U5NLD8_9RETR/1-375    AC U5NLD8.1
#=GS R9Y145_9RETR/1-375    AC R9Y145.1
#=GS P87702_FFV/4-143      AC P87702.1
#=GS U5NHZ7_9RETR/1-375    AC U5NHZ7.1
#=GS U5NKX5_9RETR/1-375    AC U5NKX5.1
#=GS U5NKM6_9RETR/1-375    AC U5NKM6.1
#=GS U5NHZ3_9RETR/1-375    AC U5NHZ3.1
#=GS R9Y0G3_9RETR/1-375    AC R9Y0G3.1
#=GS U5NKH6_9RETR/1-375    AC U5NKH6.1
#=GS R9Y069_9RETR/1-375    AC R9Y069.1
#=GS U5NLB1_9RETR/1-375    AC U5NLB1.1
#=GS R9XYG3_9RETR/1-375    AC R9XYG3.1
#=GS U5NL14_9RETR/1-375    AC U5NL14.1
#=GS R9Y026_9RETR/1-375    AC R9Y026.1
#=GS R9XZE5_9RETR/1-373    AC R9XZE5.1
#=GS U5NLI8_9RETR/1-375    AC U5NLI8.1
#=GS U5NKB8_9RETR/1-375    AC U5NKB8.1
#=GS R9Y285_9RETR/1-373    AC R9Y285.1
#=GS R9Y2G7_9RETR/1-374    AC R9Y2G7.1
#=GS Q70LW5_FFV/4-143      AC Q70LW5.1
#=GS U5NIL0_9RETR/1-375    AC U5NIL0.1
#=GS R9Y0P3_9RETR/1-375    AC R9Y0P3.1
#=GS R9Y017_9RETR/1-375    AC R9Y017.1
#=GS U5NGS2_9RETR/1-375    AC U5NGS2.1
#=GS Q6XZT0_9RETR/1-204    AC Q6XZT0.1
#=GS R9Y0I5_9RETR/1-375    AC R9Y0I5.1
#=GS L7RYH3_FFV/4-143      AC L7RYH3.1
#=GS R9Y1S5_9RETR/1-375    AC R9Y1S5.1
#=GS B3FXE2_9RETR/1-204    AC B3FXE2.1
#=GS R9XZT3_9RETR/1-375    AC R9XZT3.1
#=GS U5NIF4_9RETR/1-375    AC U5NIF4.1
#=GS R9Y029_9RETR/1-375    AC R9Y029.1
#=GS B3FXE0_9RETR/1-204    AC B3FXE0.1
#=GS B3FXG7_9RETR/1-204    AC B3FXG7.1
#=GS R9Y116_9RETR/1-373    AC R9Y116.1
#=GS R9Y057_9RETR/1-375    AC R9Y057.1
#=GS A8HC77_9RETR/8-238    AC A8HC77.1
#=GS R9Y1U3_9RETR/1-375    AC R9Y1U3.1
#=GS U5NHR3_9RETR/1-375    AC U5NHR3.1
#=GS U5NI77_9RETR/1-375    AC U5NI77.1
#=GS R9Y0V5_9RETR/1-375    AC R9Y0V5.1
#=GS R9Y2J7_9RETR/1-375    AC R9Y2J7.1
#=GS U5NHC0_9RETR/1-375    AC U5NHC0.1
#=GS R9Y0U4_9RETR/1-375    AC R9Y0U4.1
#=GS R9XZG2_9RETR/1-373    AC R9XZG2.1
#=GS R9Y2D3_9RETR/1-375    AC R9Y2D3.1
#=GS S4U0P9_9RETR/5-40     AC S4U0P9.1
#=GS R9Y0H2_9RETR/1-375    AC R9Y0H2.1
#=GS U5NI04_9RETR/1-375    AC U5NI04.1
#=GS B3FXH6_9RETR/1-204    AC B3FXH6.1
#=GS R9Y061_9RETR/1-375    AC R9Y061.1
#=GS R9Y1S4_9RETR/1-375    AC R9Y1S4.1
#=GS U5NI47_9RETR/1-375    AC U5NI47.1
#=GS U5NHF6_9RETR/1-375    AC U5NHF6.1
#=GS R9Y129_9RETR/1-375    AC R9Y129.1
#=GS R9Y2H8_9RETR/1-375    AC R9Y2H8.1
#=GS R9XZ23_9RETR/1-375    AC R9XZ23.1
#=GS U5NLS3_9RETR/1-375    AC U5NLS3.1
#=GS U5NL34_9RETR/1-375    AC U5NL34.1
#=GS R9Y0C8_9RETR/1-375    AC R9Y0C8.1
#=GS K0H3S4_9RETR/1-99     AC K0H3S4.1
#=GS R9XZR1_9RETR/1-375    AC R9XZR1.1
#=GS R9XYM0_9RETR/1-375    AC R9XYM0.1
#=GS R9Y093_9RETR/1-375    AC R9Y093.1
#=GS R9Y0R1_9RETR/1-375    AC R9Y0R1.1
#=GS R9Y0N4_9RETR/1-375    AC R9Y0N4.1
#=GS R9Y0J4_9RETR/1-375    AC R9Y0J4.1
#=GS GAG_FOAMV/9-617       AC P14349.2
#=GS GAG_FOAMV/9-617       DR PDB; 4JNH B; 9-179;
#=GS GAG_FOAMV/9-617       DR PDB; 4JNH A; 9-179;
#=GS U5NKS3_9RETR/1-375    AC U5NKS3.1
#=GS U5NIP5_9RETR/1-375    AC U5NIP5.1
#=GS U5NLG1_9RETR/1-375    AC U5NLG1.1
#=GS R9Y112_9RETR/1-375    AC R9Y112.1
#=GS R9Y148_9RETR/1-375    AC R9Y148.1
#=GS Q45QF6_SFV1/5-613     AC Q45QF6.1
#=GS R9Y1I6_9RETR/1-374    AC R9Y1I6.1
#=GS R9Y067_9RETR/1-375    AC R9Y067.1
#=GS U5NKW5_9RETR/1-375    AC U5NKW5.1
#=GS R9XXZ7_9RETR/1-375    AC R9XXZ7.1
#=GS R9Y0B6_9RETR/1-375    AC R9Y0B6.1
#=GS B2CGB3_9RETR/1-375    AC B2CGB3.1
#=GS B3FXE8_9RETR/1-204    AC B3FXE8.1
#=GS U5NGU0_9RETR/1-375    AC U5NGU0.1
#=GS U5NI36_9RETR/1-375    AC U5NI36.1
#=GS R9Y1D6_9RETR/1-375    AC R9Y1D6.1
#=GS B2CGC2_9RETR/1-374    AC B2CGC2.1
#=GS B3FXH9_9RETR/1-204    AC B3FXH9.1
#=GS R9Y1S7_9RETR/1-375    AC R9Y1S7.1
#=GS U5NL77_9RETR/1-375    AC U5NL77.1
#=GS R9Y0G8_9RETR/1-375    AC R9Y0G8.1
#=GS U5NHN0_9RETR/1-375    AC U5NHN0.1
#=GS R9Y1N4_9RETR/1-375    AC R9Y1N4.1
#=GS R9XYB5_9RETR/1-375    AC R9XYB5.1
#=GS U5NHA4_9RETR/1-375    AC U5NHA4.1
#=GS R9XZ47_9RETR/1-375    AC R9XZ47.1
#=GS R9XZR6_9RETR/1-375    AC R9XZR6.1
#=GS R9Y1J6_9RETR/1-375    AC R9Y1J6.1
#=GS U5NL63_9RETR/1-375    AC U5NL63.1
#=GS U5NI49_9RETR/1-375    AC U5NI49.1
#=GS U5NGK3_9RETR/9-278    AC U5NGK3.1
#=GS R9Y170_9RETR/1-373    AC R9Y170.1
#=GS U5NHQ9_9RETR/1-375    AC U5NHQ9.1
#=GS R9XZU8_9RETR/1-375    AC R9XZU8.1
#=GS R9Y0J5_9RETR/1-375    AC R9Y0J5.1
#=GS U5NHV2_9RETR/1-375    AC U5NHV2.1
#=GS R9XYJ9_9RETR/1-375    AC R9XYJ9.1
#=GS K7Z293_9RETR/9-617    AC K7Z293.1
#=GS R9XZG7_9RETR/1-373    AC R9XZG7.1
#=GS R9XZW8_9RETR/1-375    AC R9XZW8.1
#=GS U5NKG8_9RETR/11-280   AC U5NKG8.1
#=GS U5NHJ9_9RETR/1-375    AC U5NHJ9.1
#=GS U5NLG4_9RETR/1-375    AC U5NLG4.1
#=GS B3FXE5_9RETR/1-204    AC B3FXE5.1
#=GS U5NL81_9RETR/1-375    AC U5NL81.1
#=GS R9Y0L4_9RETR/1-375    AC R9Y0L4.1
#=GS U5NL24_9RETR/1-375    AC U5NL24.1
#=GS U5NID3_9RETR/1-375    AC U5NID3.1
#=GS R9Y036_9RETR/1-375    AC R9Y036.1
#=GS U5NIA0_9RETR/1-375    AC U5NIA0.1
#=GS R9XZA7_9RETR/1-375    AC R9XZA7.1
#=GS R9Y1E7_9RETR/1-375    AC R9Y1E7.1
#=GS U5NLE9_9RETR/1-375    AC U5NLE9.1
#=GS R9Y0P2_9RETR/1-375    AC R9Y0P2.1
#=GS U5NH72_9RETR/12-280   AC U5NH72.1
#=GS R9XY55_9RETR/1-375    AC R9XY55.1
#=GS U5NIF3_9RETR/1-375    AC U5NIF3.1
#=GS U5NIC8_9RETR/1-375    AC U5NIC8.1
#=GS R9Y0K0_9RETR/1-375    AC R9Y0K0.1
#=GS R9Y181_9RETR/1-374    AC R9Y181.1
#=GS R9XZA3_9RETR/1-375    AC R9XZA3.1
#=GS U5NI10_9RETR/1-375    AC U5NI10.1
#=GS R9Y2N1_9RETR/1-375    AC R9Y2N1.1
#=GS R9XZ60_9RETR/1-375    AC R9XZ60.1
#=GS R9Y0R2_9RETR/1-375    AC R9Y0R2.1
#=GS U5NKB3_9RETR/1-375    AC U5NKB3.1
#=GS R9Y0T4_9RETR/1-375    AC R9Y0T4.1
#=GS U5NHG2_9RETR/1-375    AC U5NHG2.1
#=GS B3FXG8_9RETR/1-204    AC B3FXG8.1
R9XZM2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZI9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGRNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ19_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVCELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1V3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIAILYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXE3_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y144_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYFLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLVRVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHYITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y161_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PTAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHW4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TTQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSA-----PPAA..P.PL.L..Pl....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y207_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY42_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYI0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..V..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHT9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQ---...--S..RGLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPTTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKX1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQT....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVV..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLSLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSGGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH90_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLTDDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....SPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAVATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH62_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVRQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMAKVAYNPFLP.GpS....D....G..SGVAPVQPSAP----PAAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.K..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------ipa...................................................
R9Y1G6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGTMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGN9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHQ3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PA...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIB4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEVAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI06_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNALTNPRDIPMWIGRNASAIEGVFPMTTPNLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI95_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFSPPAMQEIAQ..MQRD.ELENALDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y165_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFRPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH35_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELGNVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPLLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..SpllplpP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTIPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVAISEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZN1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRELE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y290_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0B4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ72_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKK5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIVRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0X6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRDNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPGLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLC7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......L......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXI0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y1A9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ95_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI74_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y188_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVTAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLT1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLADGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.G.P....S....D..GSEVAPVQ--PSAPPVASP..L.LL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS3_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....PGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NH83_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV-QSSAPPVASPLL..P.L-.-..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1N9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELENVLDIVGQI.TIQM....SDLIGMQDAQIRELK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKY3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQETSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZR7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHX7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..SSSPYV-..A..PAPSV.PAAPAA.AADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDVRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QF0_SFV1/5-609                .......................................................................eg--DLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTVLLQDDQ.GQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLE..P..AA.PS..PYV----..A..SAPLA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..P.AsggqttagT...SA.....G.......R..G.A......RGRR.S.Q....Q...GTP...G...RQ.SS...G...QS.QQQGR...RS..SqgQ.S..R........Q........S.DsSD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQPARSDNQ.QR....SQ...SQ.QP.--.----QLEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
R9Y0V9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSA-PPVASPLL..P.LS.-..L......A......-......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGIMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAAKIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH82_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1T0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y190_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYLPGDEYSLEFIPPVMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..P..T-SSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHM3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0G2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRPDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QE9_SFV1/5-612                .......................................................................eg--DLDVQALTNMFNDLGINRDPRHREVIALRMTGGWWGPATRYNLVTILLQDDQ.GQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMPFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIVSFITHLNGVYELLGLNARGQSL.R..I..P.TsggqttagT...SA.....G.......R..G.A......RGRR.S.Q....Q...GAP...G...RQ.ST...G...QS.QQQGRrtsQG..Q..S.R..Q........P........D.N.SD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQSARSDN-.--....--...-P.QR.SQ.SQQPQSEARG..DQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
U5NIE3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..P..ASPAP.AA-PVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPTHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2N9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0M1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SG---------VAPVQPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0K1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPQDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0C0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIN3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHX4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVGPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKV5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.G.S...sD....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NID4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDLEISDAARVASFINHLNGVYELLSLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0I2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Q1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLIGVANSEGVSAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLE5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIL8_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..AIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINLLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIN7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQISGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXH2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZU4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PVASPLL..P.--.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNRGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXF8_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
B3FXI1_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSALGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....S.......R..P.S......RGRG.R.G....Q...NSS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZE3_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPRDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0B0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLG..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH95_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHD3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLVGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRNYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI90_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGIFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...NTS...R...PA.QG...P...AN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQS....Q...G.......NT...G.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
B3FXF5_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RE.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
Q6XZS4_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...GAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....PGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NGM6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYKPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLELQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y182_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIN8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIM7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y153_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y074_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......LlplpptQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQRRLDQEINDAARIASFTNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKR7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQVVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2W7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSERVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHF8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
GAG_FFV/4-142                    ..........................................................elnplqlqqlyinng-----------------LQPNPGHGDIIAVRFTGGPWGPGDRWARVTIRLQDNT.GQPLQVPGYDLEP.GIINLRED..ILIAGPYNLIRTAFLDLEPARGPERHGPFGDGRLQPGDGLSEGFQPITDEEI--..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------qaevgtigaarnei........................................
R9Y105_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLKPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0P8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQVVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ90_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRDNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGB9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....XDLIGMQDAQIRGLE...GQLR-...---..-GLQGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPFVA..P..LPPA-.PAASAA.AADLGWFAG-.--GPSSGSVDPRLARVAYNPFLP.GpS....D....X..TGAAPV---------QPSA..P.PA.A..S......P......L......P......SlqpaqpM...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGSAPTNPREIPMWIGRNASAIEGVFPIPTPDIRCRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPIHQLAEVLRGVSNSEGXAAAWQLGMMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEVNDPARIVSFTNHLNAVYELLGLNARGQSL.R..L..S.V........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y1V1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGAPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZN7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGW-------.--FAGGPGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0P9_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATPYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2Z0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPGSGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL90_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZP7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDTQIRGLE...GQLR-...---..-GQRGNLPVAGAPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PVASPLL..P.--.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAAKIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y049_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..V..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPANPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2Z8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYV-..A..PASSA.PAAPVA.PADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVCELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1A5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.KLENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLPgL.S....D....G..SGVAPVQPSAPP----AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAVEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSKGVATAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDATRIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ81_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPNLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHS7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y102_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLD7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZR8_9RETR/1-237               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------IRAVTGEPPRNPREIPIWLGRNAPAIEGVFPVNSPEVRCRVINAIIGGNLGLALTPTECATWDSAVATLFIRTHGTYPMHQLGNVIKGIVDQEGVATGYTLGMMLSGQNFPLVYGIIRGFLPGQAVVTAIQQRLDQEIDDQTRSDTFIQHLNAVYEILGLNARGQSI.R..T..G.A........N...ST.....P.......R..P.T......RGRG.R.G....I...SR-...-...QS.QS...A...PG.AGRGR...QR..S..D.G..N........L........Q.D.NN.P.S.S.Q.NQG....Q...S.......NN...N.....QRG......YNLRPRTYQPAR-----.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NI18_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y141_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEMLDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1M5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.PNPGS---VDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRGIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q9J4C8_9RETR/18-138              ..................................................................aggilad------------------------NDIINIRFTSGQWGIGDRWLQVRLRLVDPNtGQPLAQPEYEDTG.LPAENRGI..VVAVSHNA-ARNIFNNVQPAGGPNRHGPLHDGQFQVGDDPSEHFVPI-------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------eenlipqeivnlgaar......................................
U5NI39_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL41_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELENILDIVGQI.TMQV....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHJ6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y297_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLGDDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLTRVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0F5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZL5_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGRI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARDKA-.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------lgy...................................................
R9XZL0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMTLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1L2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Z4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEMLDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNLFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y115_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIRRNASAIEGVFPMTTPDLRCRVINALLGGNLRLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI65_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYMPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYH4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIM4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHLPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAVAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKN0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFVPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSMDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSA-PPAASPLL..P.LL.-..-......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFTNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------la....................................................
U5NH89_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEHSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH54_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTRNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVIAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPGASTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAA.PVASAD.LGWFAEG---.---PGPRSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGINLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIASFITHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Z7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNVIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIA3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPNVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Y9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMRM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..V..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL17_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y007_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0H8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGPNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMTLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGW----.--FAGGPGPGPVDPRMARVAYNP.F.L....P....G..PSD--GSGVAPVQPSAPPA..A.SP.L..L......P......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pt....................................................
U5NIG3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPIITPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIVSFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1U7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPGASTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAA.PVASAD.LGWFAEG---.---PGPRSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIASFITHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y110_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NII0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKF0_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPVTTPDLRCRVINALLGGNLGLNLKPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWRIIRPLLPGQAVVTAMQHRLDQEINDATRIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIK1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQYCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGFNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..V.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHU5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.SV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PS.QG...P...AN.SGRGR...QR..P..T.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZV3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLVRVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.T..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKU6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZQ6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSA-----PPVA..P.PL.LplS......P......A......Q......P......V...Q......PV...IQYVHPPPT.....NPAQQ..IIPIQRIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y098_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQPSV-----PPVA..P.PL.L..-......P......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL61_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAGVLRGVANSEGVAATYQLGRMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGJ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFAGG---.---PGPGSLDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPS-APPVASPSL..P.L-.-..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0B1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEEIAAAYQLGMMLTNRDYNLIWEIIRPLLPGQAVVTAMQHRLDQKINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHW1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1S3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHG6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPGLRCRVINALLGGNLGLNLEPQHCITWASAIATLDVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0P0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLNIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPSPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIKPLLPGQAVATAMQHRLDQEINNTARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1X2_9RETR/1-372               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAH..MQRD.ELENVLDIVGQI.IMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIVRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI03_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K0H5P0_9RETR/1-99                .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-------------PPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLS-------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZZ1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLTWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1C7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLA0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHM6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZF4_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSSEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGKMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y088_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLPgL.S....D....G..SGVAPVQPSAPP----AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDATRIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZQ9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPSSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SAELGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI53_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYI5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELKNILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAITGNAPTNPRDIPMWIGRNASTIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLNQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0T8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SG---------VAPVQPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH09_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL22_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANVNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYVLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZI1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..PSDGSRVAPVQPSAPPAAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1J4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAMATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZZ7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLN1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIN0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZD3_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.T-..AASPPYA..A..PTPSA.PPAPAV.SADLGWFTGE.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIKGVFPMTTPDLKCRVINALLGGNLGLNLEPQHCITWASAITTLYVRTHGSYPIHQLAEVLRGVANSEEVATAYQLDMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQKINDAARIASFINHLNSVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZR3_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NLF8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIH9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPLPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHCLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0E5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y156_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLG8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLSPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZN3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQETAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VMPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0A9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y185_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..P.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------v.....................................................
R9Y052_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1F1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.GLENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
O41893_9RETR/16-156              ...................................................................paprvl----------------------QHNDIIICRATSGPWGIGDRYNLIRIHLQDPA.GQPLPIPQWEPIPnRTANPRTQpyPVVSAPMATLENILNNFHIPHGVSRYGPLEGGDYQPGEQYSQGFCPVTQAEIAL..LNGQ.HLEEEITILREI.THRL....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------mqgvr.................................................
R9Y1E9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIK3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGR6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLD...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0X2_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXE1_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..T..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XY07_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYAHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPSPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRVVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXG4_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNXVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...VS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZ69_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------EVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEVLDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLPgL.S....D....G..SGVAPV---------QPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVITAMQHRLDQKINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y042_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVTAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAVQHRLDQEISGAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLN5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHU1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLVRVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGT4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXG9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NSS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y1B5_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLESQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPGLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-----PVA..S.PL.L..P......P......P......P......A......Q...Pv....qPV...IQYVHPPPI.....NPAHQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y134_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPIAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPNLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2F1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLTNGDYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGIQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..P..T-SSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNALAIKGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAIQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD5_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NIH4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNASTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHG9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI59_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1D4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZM7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWMGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNTRGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZJ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLM4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y187_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIB8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVYPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGGNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZS1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y023_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPGSGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAHQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0N1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI86_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLGFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------la....................................................
R9Y171_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELKNILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAITGNAPTNPRDIPMWIGRNASTIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLNQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLV4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNTRGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHU9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQEIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NSS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQS....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NLU6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDECSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAANQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLV2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIRHIRAVTGNAPTNPRDIPMWMGRNASAIEGVFPMTTLDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZJ1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASLINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0V6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILGIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPARQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINGAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZN2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEVLDVVGQI.TMQM....NDLIGMQDAQIRGLE...GRLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSIDPRLARVAYNPFLPgL.S....D....G..SGVAPV---------QPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAVQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHN4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.------LSPGSVDPRLARVAYNP.F.L....P....G..P----SDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKG4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSMDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSA-PPAASPLL..P.LL.-..-......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIQAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLA3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZV4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0R9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI20_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIG9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGPYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEIDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..T.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKK8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZD5_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZS0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y167_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1L9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLF0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL84_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGKAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPTHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY37_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DLAGDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VMPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K7Z2A0_9RETR/9-612               .........................................................................EYLLDVEALVDILRERDIPRNPMHQEIIGLRMTEGWWGQMERFQMTRLILQDDD.GEPLQQPRYEVVP.RAVNPRTQ..FVISGTLAELRLAFLELDLPEGALRYGPLANGHYIQGDPYSLSYRPVTMAETAH..MTRD.ELEDVLNVQSEI.EIQL....INILELQEVEVRALR...RQLAE...SSS..VRRGGMSPGAPIPRPPVSSYA..G..LP.SL..PPVPGIF..P..SAPSP.PQASST.PGQRPWSLGN.D-LDQSVIPGPSQPRVSFHPSNP.F.Q....I....D..SVPRPRSASRER-------..P.AV.-..G......T......Q......P......S......A...P......PL...IQYVPVPPPv..fpPSVNT..VIPIQHIRAVTGEPPRNPREIPIWLGRNAPAIEGVFPVNSPEVRCRVINAIIGGNLGLALTPTECATWDSAVATLFIRTHGTYPMHQLGNVIKGIVDQEGVATGYTLGMMLSGQNFPLVYGIIRGFLPGQAVVTAIQQRLDQEIDDQTRSDTFIQHLNAVYEILGLNARGQSI.R..T..G.A........N...SM.....P.......R..P.T......RGRG.R.G....I...SR-...-...QS.QS...A...PG.AGRGR...QR..S..D.G..N........L........Q.D.NN.P.S.S.Q.NQG....Q...S.......NS...N.....QRG......YNLRPRTYQPARYGGGR.G....RRW..SDNTQTS--R.QT....ES...ST.QN.PR.QAQTGQGVRG..DQSRAPRSGASRGGRGNQNRNQRPSGSGDS......................................................
U5NI23_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV-Q-----PGAPPAasP.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
D5JWV0_9RETR/227-598             .........................................................qppaqlpsappialpv------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..---------------IPSA..P.LA.P..A.....vP......L......P.....qS......Q...P......PQ...PMYNPYMMA....gNLQGN..VLPISQIKAVIGETPTDHKAVPLWVAKHAAAIEGVFPTGSPEVRCRVLNSLLTGHGGMMLHPVDCVSWTNAASVLFQRVHGVVPLHQLPKTLEEVAKTEGLLVAYNIGMTFTSNNFDLIWGIIRPLVPGQAAVAMLQGYLDQYPRPQDKIEHFPRFLRRTFEVLGLNFLGQSI.R..S..T.Q........A...PS.....R.......P..N.S......A--N.R.G....T...NTA...R...GR.GG...N...RG.RGRGR...GV..P..P.G..P........P........P.G.RG.T.A.TpQ.AAG....T...S.......RS...S.....SGSfgeqprYNLRPQVNRPSRYGGGP.N...pARN..NPEPQGGDTS.ST....PR...GQ.GE.RS.GRQRNNNARQ..NQQPPRRP----------------------drtvntvrtaqpnptvasgsqddn..............................
U5NI34_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZR5_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...GAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XY93_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2U3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAIQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1X1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPGSGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFLMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLD0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQL--...---..IGLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGW4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIYQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQGL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Y5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1S1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPRHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y104_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVATAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y051_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..P..-----.--ASSA.PAVPVASAGL.GWFAGGPGPGSVDPRMARVAYNP.F.L....P....G..P-----SDGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRAINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLLGQAVVTAMQHRLDQEINDAARVASFINHLNSVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLL0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLRGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.K..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------ipa...................................................
U5NIF9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGTMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXF9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYFPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......KGRG.R.G....Q...SIS...R...PS.SG...P...AN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZR4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQVRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y050_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..TGVAPV---------QPSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAKVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZM9_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI58_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..PSD----GSRVAPVQ-PGA..P.PV.A..Sp...llP......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHE8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV------R---PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLVGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AT..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLDMMLTNRDYNLIWGVIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1K2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y056_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGPNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0U3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRDNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLM3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI81_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SA----DLGWfAEGPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKI0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQI....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1J2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Z9_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZU9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PVASPLL..P.--.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS8_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NTS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.N.RG.S.N.T.Q.NQN....Q...D.......NL...N.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XYW0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2K2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SAELGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYL5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGW-------.--FAGGPGPGSVDPRMAKVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y019_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIKGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....GDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSK-IAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAVEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEEVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINRLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHQ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZF0_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDKYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZG1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QL.A-..AAFSPYV..A..PASSA.PAAPVV.SADLGWFA--.----GGPSPGPVDPRLARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPRQAVVTAMQHRLDQEINDTARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLY2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y070_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVEQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRNIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2E0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITRASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHC5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC8_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.SG...P...AN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHU3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL54_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL68_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLH1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKE6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVRQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYA-..A..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMAKVAYNPFLP.GpS....D....G..SGVAPVQPSAP----PAAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.K..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------ipa...................................................
R9XZW9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAR..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHX9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPSPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY71_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANVNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPQDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NK98_9RETR/12-280              .........qpaaasspyvapassapaapvasadlgwfaggpgpgsvdprmarvaynpflpgpsdgsgvapvq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..----------------PSA..P.PA.A..S......Pl...lpL......P......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NLS0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHR2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAR..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKV1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K7Z286_9RETR/9-617               .........................................................................EYELDVEALVVILRDRNIGRNPLHGEIIGLRLTEGWWGQIERFQMVRLILQDDD.NEPLQRPRYEVIP.RAVNPHTM..FMISGPLAELQLAFQDLDLPEGPLRFGPLANGHYVQGDPYSSSYRPVTMAETAQ..MTRD.ELEDILNTQSEI.EIQM....INLLELYEVETRALR...RQLAE...RSS..IGQGGISPGAPRPRPPVSSFS..G..LP.SL..PSIPGIH..P..RVPSP.PRATST.PGNIPWSLGD.DSPPSSSFPGPSQPRVSFHPGNP.F.V....E....D..EGHRPRSQSRERRRDNPPA..-.--.-..-......P......I......P......S......A...P......PM...IQYVPVPPP.....PPVGT..VIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...VS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......YNLRPRTYQPQRYGGGR.G....RRW..NENINSQESR.PS....DH...GS.QT.PR.PNQAGSGVRG..NQSQTPRPAAGRGGRGNQNRNQRSSGAGDS......................................................
B3FXG2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y012_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHH9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..ITPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y035_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADNTLRFGPLANGNYIPGDEYSLKFIPPAMQEIAQ..IQRD.ELENILDIVEQI.TMQM....SDLIGMQDAQIRGLK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRNIPMWIGKNASAIEGVFPMTTPDLRCKVINALLGENLGLNLEPQHCITWTSAIATLYVRTHGSYPIHQLAEVLRGVANSEGITAAYQLDMMLTNQNYNLIWEIIRPLLPGQAVVTAIQHRLDQEINDAARIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0U2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVVNSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLW5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY78_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y191_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQVAQIRGLE...GQLR-...---..-GLRGNLPVAGTLPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPFQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHH2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGIAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNVRGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXI2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y2H4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYN7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XXX2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIG4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASSINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHN6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNPGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1F2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLTNGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..P..T-SSA.PAAPVV.SADLGWFAG-.-----GPSPGSVDPRLAREAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAIQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGB1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NM00_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.G.-....-....-..--PSDGSGVAPVRPSAPPA..A.SP.L..L......P......L......P......P......A...Qp...vqPV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGDAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLQ7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELGNILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHM1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV-QSSAPPAASPLL..P.L-.-..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHW9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S7_9RETR/1-372               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVTNALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y034_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYV-..A..PASSA.PAAPVT.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLYGVYELLGLNARGQSL.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------gip...................................................
R9XZS3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIP3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHY4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPTHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NID9_9RETR/1-375               ........................................................................t------------------------------------------------------.-------------.--------..-----------------DLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPLHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZH3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHPNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPIA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y021_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLELQHCITWASAIATLYVRTHGSYPIHQLAKVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZQ2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XXY7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP----PAAS..P.LL.S..L......P.....pA......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHH4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..SSSPYV-..A..PAPSV.PAAPAA.AADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDVRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI14_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLAGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLU9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLGFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------la....................................................
U5NHU6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..PpVV.S..Pl....lP......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGL6_9RETR/12-280              qpaaasspyvapassapaapvasadlgwfaggpgpgsvdprlarvaynpflpgpsdgfgvapaqpsappaasp------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.-L.L..P......P......P......P......A......Q...Pv....qPV...IQYVHPPPY.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPLATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHV7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMTLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y234_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEMLDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNLFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLCVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPSANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZC0_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASSINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYH1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLVRVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..SpllplpP......A......Q......R......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y002_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLVRVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Q0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPA...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMLIGRNASAIEGVFPMTTPDLRCRVINALLGGSLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIDMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHV0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRIINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSERVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGQ7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP---PVAS-..P.LLpL..P......P......A......Q......S......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLNQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZJ9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1F7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIQ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHVRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQGISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y080_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH65_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQI....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..T..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI42_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSSYV-..A..PASSA.PAVPVA.SADLGWFAGG.---PGPGSVAPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHA5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI64_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2I2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQGIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHYITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0C6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGPYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIB5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQTRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPTHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHA0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGRI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAKATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ15_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SG---------VAPVQPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y043_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRRRVIIALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXH5_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NSS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKX9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRGIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ35_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKH0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.G.P....-....-..------SDGSEVAPVQPSA..P.PV.A..S......PllllppA......Q......P......A...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QF3_SFV1/5-609                .......................................................................eg--DLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTVLLQDDQ.GQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLE..P..AA.PS..PYV----..A..SAPLA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..P.AsggqttagT...SA.....G.......R..G.T......RGRR.S.Q....Q...GTP...G...RQ.SS...G...QS.QQQGR...RS..SqgQ.S..R........Q........S.DsSD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQPARSDNQ.QR....SQ...SQ.Q-.--.---PQSEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
R9Y0B7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAP------VR---PSA..P.PV.A..Sp...llP......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZR5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGN3_9RETR/12-280              .........qpaaasspyvapassapaapvasadlgwfaggpgpgsvdprmarvaynpflpgpsdgsgvapvq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..----------------PSA..P.PA.A..S......Pl...lpL......P......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPQDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLRGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZ76_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PASSA.PAAPVV.SADLGWSAGG.---PSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFANHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0A4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIKGLE...GQLR-...---..-GLRGDLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLK5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGTMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYL0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVTAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ64_9RETR/1-372               .........................................................................------------------------------------------------------.-------------.--------..----------------IDIADGTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2W1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPATQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGMIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH76_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGPE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NII4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH68_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPVTTPDLRCRVINALLGGNLGLNLKPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWRIIRPLLPGQAVVTAMQHRLDQEINDATRIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1B0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZS9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K7Z296_9RETR/9-612               .........................................................................EYLLDVEALVDILRERDIPRNPMHQEIIGLRMTEGWWGQMERFQMTRLILQDDD.GEPLQQPRYEVVP.RAVNPRTQ..FVISGTLAELRLAFLELDLPEGALRYGPLANGHYIQGDPYSLSYRPVTMAETAH..MTRD.ELEDVLNVQSEI.EIQL....INILELQEVEVRALR...RQLAE...SSS..VRRGGMSPGAPIPRPPVSSYA..G..LP.SL..PPVPGIL..P..SAPSP.PQASST.PGQRPWSMGD.D-LDQSVIPGPSQPRVSFHPSNP.F.Q....I....D..SVPRLRSASRER-------..P.AV.-..G......T......Q......P......S......A...P......PL...IQYVPVPPPv..lpPSVNT..VIPIQHIRAVTGEPPRNPREIPIWLGRNAPAIEGVFPVNSPEVRCRVINAIIGGNLGLALTPTECATWDSAVATLFIRTHGTYPMHQLGNVIKGIVDQEGVATGYTLGMMLSGQNFPLVYGIIRGFLPGQAVVTAIQQRLDQEIDDQTRSDTFIQHLNAVYEILGLNARGQSI.R..I..G.A........N...ST.....P.......R..P.T......RGRG.R.G....I...S--...R...QS.QG...A...PG.AGRGR...QR..S..D.G..N........L........Q.D.NN.P.S.S.Q.NQG....Q...S.......NS...N.....QRG......YNLRPRTYQPARYGGGR.G....RRW..SDNTQI--NR.QT....ES...ST.QN.PR.QAQTGQGVRG..DQSRAPRSGASRGGRGNQNRNQRPSGPGDS......................................................
B3FXF7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
Q6XZR6_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..D........Q........N.N.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKI7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPSLPgL.S....D....G..SGVAPVQPSAPP-A---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEALRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLQ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRGIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYY3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSERVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYJ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLRG...L--..--RGNLSV-AGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHU8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYVPGDEYSPEFIPPAMQEIAQ..MQRD.ELENVLDIVGRI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHW2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y152_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY59_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PAFSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
O41893_9RETR/157-518             ........................................................ppavpqgpapppppaqp------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-----------------PA..P.LP.A..P......P......I......G......P......-...P......PP...AAPAPAPGP.....MPVPQ..HLPITHIRAVIGETPANIREVPLWLARAVPALQGVYPVQDAVMRSRTVNALTVRHPGLALEPLECGSWQECLAALWQRTFGATALHALGDTLGQIANSDGIVMAIELGLLFSDDNWDLVWGICRRFLPGQAVCVAVQARLDPLPDNATRIVMISHIIRDVYAILGLDPLGRPM.Q..Q..T.Lprr..nnqP...PR.....Q.......Q..P.Q......RRQQ.P.R....R...TGN...Q...EE.RG...Q...RN.RGRQN...-A..Q..T.P..R........Q........EgN.RL.Q.N.S.Q.LPGprdcP...N.......NS...N.....QPR......YPLRPNPQQPQRYGQEQ.N....RGN..NPNPYRQPTP.GNgnqnRN...FS.RG.PA.PVNEQSRGRG..RSSQGT------------------------nntgssavhsvrl.........................................
U5NLH4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2B4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL48_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNAGGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLJ6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSMDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y158_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXE6_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NL36_9RETR/1-375               ........................................................................t------------------------------------------------------.-------------.--------..-----------------DLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..P.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------v.....................................................
B3FXC1_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCITWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....S.......R..P.S......RGRG.R.G....Q...NSS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y1F3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSGGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZS7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLN3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..APSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPTWIGRNALAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHC9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y266_9RETR/1-373               .......................................................................ig------------------------------------------------------.-------------.--------..------------------LADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MRRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHV3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCGVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.K..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------ipa...................................................
R9Y0F9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZH1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP---PVASP..L.LP.L..P......P......V......Q......P......V...Q......PI...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1U4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.P---GPGSVDLRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXD6_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
B3FXE9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.SG...P...AT.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHE0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....S..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGIFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAKVLRGVANSEGVTAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0K6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.G.P....S...gG..SGVAPVQPSA-PPA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL13_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIC0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SNLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLDARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYU6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLDARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1J5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1G7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELKNILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSVD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....-..-G--PRDGSGVA-PVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAR..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y005_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTATQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0H0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL67_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPTWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI76_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0W1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHH7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKW0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPLPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY29_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWF------.---AGGPGPGSVDPRIARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y022_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAHQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0F7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHC8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAMEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC6_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...GAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NLK9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAVRVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLGGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL99_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKA3_9RETR/9-280               .....ldiqpaaasspyvapassapaapvasadlgwfaggpgpgsvdprlarvacnpflpgpsdgfgvapaqp------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-----------------SA..P.PA.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPY.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPLATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYDLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y018_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGGEYSLEFIPPAMQEIAQ..MQRG.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIP0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAVEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKW8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNSVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NK93_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPVTTPDLRCRVINALLGGNLGLNLKPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWRIIRPLLPGQAVVTAMQHRLDQEINDATRIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QF5_SFV1/5-613                .......................................................................eg--DLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDDQ.GQPLQQPRWRAEG.RAANPAVM..LTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVADIPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.G.P....S...gG..SGVAPVQPSA-PPA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PI...VQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVVNALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVATSEGVAAAWQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIVSFITHLNGVYELLGLNARGQSL.R..I..S.AsggqttagT...SA.....G.......R..G.A......RGRR.S.Q....Q...GAP...GrqsSR.QS...Q...PQ.GGRSS...QG..Q..S.R..Q........S........D.N.SD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQPARSDNQ.QR....SQ...SQ.Q-.--.---PQSEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nadr..................................................
R9Y2F4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0J9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTTMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI50_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGAPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTATQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHR1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K7Z2A6_9RETR/3-606               ........................................................................d-HNLNVQELLNLFQNLGIPGQPNHREVFGLRMTGGWWGLGTRYNLVSIFIQDDS.GQPLQQPRWRAEN.RPVNPMVH..NTIEAPWGDLRLAFEDLDVAEGALRFGPLANGNWIPGDQYSMEFQAPLVQEIAM..MQQA.ELEEILDVVGQI.CMQV....IDIVDMQEVQIRGLQ...RQAQE...R--..-GNGSNIPVAGIQAPPSSPVS..Q..QP.FA..SSLP---..-..---QP.PPASSS.A------LAD.LGW-GSGAPGQVDPRLSRVAYNP.F.LpgpgD....G..SGGSVPVQPSAPPAILPSA..P.AL.P..A......P......A......P......-......-...Q......PV...VQYVAQP-L.....VPVPQ..AIPIQHIRAVTGNTPTNPRDIPMWLGRHSAAIEGVFPITTPDIRCRVVNALLGGSLGLSLEPIHCVNWAAVVAALYVRTHGSYPAHELANVLRAVVSQEGVATGFSLGNMLSNQNFDLIWGILRPLLPGQAVVTAMQQRLDQEPNDAARAANFNRHLNDIYGLLGLNARGQSI.S..G..SrS........V...PS.....T.......G..P.S......ASAG.R.G....R...SGR...R...NQ.QQ...SgqqQQ.QRRSN...QG..P..R.G..Q........Snn....qnN.Q.RQ.S.E.G.N.NQG....Q...-.......-G...G.....QGR......YNLRPRTYQPQRFGGGR.G....RRW..NENSQQ-QAP.PG....RS...SD.QFrSQ.SQQPQSEARG..DQSRTSGAGRGQQGRGNQNRNQRRGEAS--as....................................................
U5NH73_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMHHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGP9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GRLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDMPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAHQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLKARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHB0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPAPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSKGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXF0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...VS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NI92_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKZ9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV-QSSAPPAASPLL..P.L-.-..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIQQSAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y273_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...VQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCIAWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGRAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIJ0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKN1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.GLENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARIAYNPFLP.GpS....D....G..SGVAPVQPSAP----PAAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGIYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2M3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGFEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIVRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY47_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1T5_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLD..M..QP.AA..SSSPYVA..-..PAPLA.PAAPAA.AADLGWFAG-.-----GSGPGSVDPRLARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPVQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQSAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGVIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y055_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMRM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..V..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHX1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIKDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1I1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHI7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..FGAAPV---------QPSA..P.PV.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y135_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWAPAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH21_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PS---PGSMDPRLARAAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXF3_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZI2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPAAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL45_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYTPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Z4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPNLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLESQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL73_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGIQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQGL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y117_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLD1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZK4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..LAPAA.PVASAD.LGWFAGG---.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPM.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLX1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDFRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHL8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y000_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.EPENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHRITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYP2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZU5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.EPENVLDIVGQI.TIQM....SDLIGMQDAQIRELK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRNIPMWIKRNASAIEGVFPMTTPNLKCRVINALLGENLGLNLKPQHCITWTSAIATLYVRTHGSYPIHQLTEVLRGVTNSEGVVAAYQLGMMLTNRDYNLIWKIIRPLLPGQAVVTTMQHRLDQEISDTTRVASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pt....................................................
R9Y0Y3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGIQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1C2_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIQ2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELVNVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2E7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDVVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AT..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLDMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGV3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFISHLNGVCELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKP2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHQ5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0A3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TTQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Y5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1A4_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0E7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQDINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0E4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLKPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVASSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------la....................................................
R9Y0I8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLG5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH57_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELKNILDIVGQI.TIQI....SDLIGIQDTQIRGLE...GQLRG...---..--LRDNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAA.PVASAD.LGWF------.AEGPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....SPTQQ..IIPIQHIRTVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCIIWASAIATLYVRTHGSYPIHQSAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWKIIRPLLPGQTVVTTMQHRLDQKINDATRIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXH7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFIRTHGQFPMHQLGTVLQGIVNQEGVATAYTLGMMLSGQNYQLVSGIIRGFLPGQAVVTALQQRLDQEVDDQARAETYIHHLNAVYEILGLNTRGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NSS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.E.RG.S.N.T.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y1C5_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIIGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYF7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NII9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZR0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPSSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYF2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGAFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHH3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2P3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMREIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..PSDGPGVAPVQ-----PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWKIIRPLLPGQAVVTTMQHRLDQEISDTTRVASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pt....................................................
U5NL89_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVGPXMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLQ3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENALDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPIITPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIVSFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0W5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PVASPLL..P.--.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGILRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLKFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS2_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKJ1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVGTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0R4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGV8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDVIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLANRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKN5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IHYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFISHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Q7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLISMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWF---.---AGGSGPGSVDPRVARVAYNP.F.L....P....G..P-----SDGSGVAPVQPSA..P.PV.A..S......P......L......P......P......L...PpaqpvqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRIINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSERVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS5_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAS...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
Q70LW5_FFV/158-506               ................................................................grpipgail------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...------QPQ.....PVIGP..VIPINHLRSVIGNTPPNPRDVALWLGRSTAAIEGVFPIVDQITRMRVVNALVASHPGLTLTENEAGSWNAAISALWRKAHGAAAQHELAGVLSDINKKEGIQTAFNLGMQFTDGNWSLVWGIIRTLLPGQALVTNAQSQFDLMGDDIQRAENFPRVINNLYTMLGLNIHGQSI.R..P..R.V........Q...TQ.....Q.......Q..Q.P......RSRN.Q.G....R...SQQ...G...QL.NQ...P...RP.QNRNN...QS..Y..RpP..R........Q........Q.Q.QH.S.D.V.P.EQR....D...SrgpsqppRG...S.....GGG......YNFRRNPQQPQRYGQGPpGpnpyRRF..GDGGNPQQQGpPP....NR...GPdQG.PR.PGGN------..------------------------------prgggrgqgprngggsaaavhtvktsenetkngsaeavd...............
R9Y066_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XXW4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVVNALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHQ7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMHM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..M..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEGSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1T3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRDASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL03_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIVRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHI2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYILGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTRNAPTNPRDIPMWIGRNASTIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHSSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0M6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQVAQIRGLE...GQLR-...---..-GLRGNLPVAGTPLPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.-----GPGPGSVDPRLARAAYNP.F.L....P....G..PSD--GSGVALVQPSAPPA..A.SP.L..L......P......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIC3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLSPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y180_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y015_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHU2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINGAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKL7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV------R---PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRPDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y059_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZX4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0M7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....GDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITRASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
D5JWV0_9RETR/10-240              .......................................................................qg--DLNVVELTHLLRENGLPGNPRNGQTYAIAMTEGWWGDHPRYRIIRVVFQDTS.GNPLSQPQWMDED.RQMNPLQD..PVVGCTFNQASRVFDQIDIGEGPSRFGPLADGMFLITDNAWMDFVPLSAMEITD..INNErTLRDHLTFCCTL.LENM....MADIIVTQRENRDLN...TTINN..lRAT..IPV------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------asqalphsslpatpmaastpggpsglppstfnigavgpsyqppaqlpsappial
R9Y0U0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEVLDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLPgL.S....D....G..SGVAPV---------QPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI28_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLTDDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y257_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIRR...L--..--R-GNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YT..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLSLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNSVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHT3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLY7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2Y2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PA.A..S......P......L......P......P......L...PpaqpvqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVASSEGVAAAYQLGMMLINRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLSGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHQ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDHNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1H1_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q7SIS7_9RETR/5-595               ........................................................................n-FELDVQELLNLFQDNGVTRNPRHLETIGLRMLGGWWGEQERYQSARIILQDDD.GEPLQVPRWEEVL.RPVNPLAH..FVISAPWDQLRRAFHDLDVGNGALRFGPLANGNYIPEDPYSTSYRPVNPQEMAQ..MQRD.ELEEVLEVQGEI.ELQM....IDLIEMQTIEIRGLR...QLVNElqrERD..SGRGASIPGASSSPPP-QSYV..G..LP.GM..PSVSGLS..S..L---Q.PEASST.PGG-------.-----------RAPRVSFHPSNP.F.V....R....P.pSPERPRARSSER-------..-.--.-..I......P......L......P......L......Q...P......PV...IQYVPVPQPvlapaPAPSP..VIPIQHIRAVTGEVPNNPRDIPMWIGRNAPAIEGVYPVTTPDLRARIINALIGGKSGIHLTAPEAVTWASAVAAIFTRTHGSFPMHNLSAILTGIANGEGVESAYNLGMMLSNGDFNLVYGIVRGLLPGQAAVAYMQQRLDAEPSDALRAQNFIQHLHLVYEILGLNHRGQSI.R..T..S.L........P...TS.....T.......R..P.R.....gQGRG.R.G....QgqgSIP...S...TP.RR...-...PQ.SGRGL...ST..P..N.R..G........S........N.N.AN.N.N.T.Q.SNV....Q...T.......ETprrS.....FGG......YNLRPNTFRPQRYGGGQ.G....QRR..DSQP----DR.RS....QG...SS.QN.NR.PS-APLESRG..EQSRGPGGGGRAGGRRNQNRNSG-------qgnesss...............................................
R9Y0T2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEVLDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLPgL.S....D....G..SGVAPV---------QPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIK7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZM4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1C6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPSPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.LAAPVA.SA----DLGWfAGGPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQPGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI30_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFTPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGTQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYTPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDARIGGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Rp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASATATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZX2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYX3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLKFGPLANENYIPGDKFSLEFLPPAMQEITQ..IQRD.ELEEILDVVGQI.TIQI....NNLIGIQDAQIRGLK...GQLR-...---..-GLRGNLPVAGTSPPPPPSLD..I..QP.TA..-------..T..SSPYV.APASST.PTAPVASTDL.EWFAGGPGPGSVDPRLARVTYNP.F.L....P....G..PSD-----GSGVAPVQPSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPTHQ..VIPIQHIRAVTGNAPTNPRNIPMWIGKNTSAIKGVFPMTTPDLRCKVINTLLGENLKLNLKPQHCITWTSAITTLYVRTHGSYPIHQLAEVLRGVTNSERVTTAYQLGIMLTNQNYNLIWGIIRPLLPGQAVVTAIQHRLNQEINDTTRIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH27_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYDPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL43_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMTLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0I3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPIA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZT8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....GDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
D5JWU5_9RETR/213-567             .................................................................iqpsrpmq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......P......S......A...P......PL...PLMGD--LG.....SGILS..VLPISQIRTVIGNTPVDPKKVPLWIAKSASAIEGVMPTNTPDIRCRLVNALLPQHGGLILQPHECNSWTQIASALYTRVNGMIPLHALPQTLSQVTKEEGILVAYQIGMTFTGQNFPLTWGILRPLLPGQAVVAMMQGYLDQYPTDDLKAVNFASILRRVFDILGLNYMGQNI.R..N..Q.S........S...PSltvssA.......R..G.A......TGRG.R.G....R...SRN...IgrgRG.TT...P...NF.QGRGQ...PA..T..T.P..T........V........T.T.SG.S.T.S.StTES....Q...G.......RN...S.....NPN......YNFRPRVNQPPRYGGGP.N...pYRN..REPLNNPPNR.EN....TT...QN.NT.RR.PGSQGQNRNR..NQNRTVNAVQVVPNQDNTN-----------qpninpnqnvstpasa......................................
B3FXH1_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...NIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZW4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHS2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYDLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1V8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSADPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQR..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y197_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASSINHLNGAYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH80_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYDPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKS2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYDPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZ10_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SG---------VAPVQPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLP5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGFNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..IQRD.ELENVLDIVGQI.TIQM....SDLIGMQDAQIRELK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRNIPMWIKRNASAIEGVFPMTTPNLKCRVINALLGENLGLNLKPQHCITWTSAIATLYVRTHGSYPIHQLTEVLRGVTNSEGVAAAYQLGMMLTNRDYNLIWKIIRPLLPGQAVVTTMQHRLDQEISDTTRVASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pt....................................................
R9Y075_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2R2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHR5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.G.P....S....D..GSEVAPV--QPSAPPVASP..L.LL.L..P......P......V......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPVTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y095_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH52_9RETR/13-280              ..........paaasspyvapassapaapvasadlgwfaggpgpgsvdprmakvaynpflpgpsdgsgvapvq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..----------------PSA..P.PA.A..S......Pl...lpL......P......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y132_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLT5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYT4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRSASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYZ5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0U9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZI5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSCPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Rp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPWDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1P0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZP4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAATGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH43_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSCPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLA8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..FGAAPV---------QPSA..P.PV.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKJ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.GLENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIE8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NGZ7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLREVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y076_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0U7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCTTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Z5_9RETR/1-371               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------gip...................................................
U5NKA8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIVDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NTS...R...PS.QG...P...AN.SGRGR...QR..P..A.S..G........Q........N.N.RG.S.N.T.Q.NQN....Q...D.......NS...N.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHQ2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYMPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHRITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLE1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMRM....SDLIGMQDVQIRGLE...GQLRG..lRSN..LPVAG------TPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFAGG---.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y100_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEVLDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLPgL.S....D....G..SGVAPV---------QPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....SPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIM0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVNDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NII5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZE0_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0M9_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSPY-A..A..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVVPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHJ2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PG---PGSVDPRMARVAYNP.F.L....S....G..PS--DGSGVAPVQPSAPPA..A.SP.L..L......P......L......P......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMLIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKV7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVNNALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI02_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1D2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHJ1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0L8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
A8HC77_9RETR/222-594             .......................................................ipsappapipvapaaapp------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-----------------LG..P.LP.S..A......P......A......P......P......V...L......PV...IQPNTFGTDgn.gyTAVGPvpVLPIAQIKAVIGEAPTDARQIPLWVAKHAAAIEGTFPTGSADVRCRVLNALLTSHGGMTLSPNECGTWSLAAAALYQRIYGVIPLHDLPHTMAEVARREGILVAFNMGMTFTNNSFDVVWGIIRPLLPGQASVAMLQGYLDQYQGQQQKAQAFPTLLRRTFETLGLNYLGQSI.R..S..N.Q........P...AR.....T.......S..G.SvagsitQGRG.R.G....Q...PRS...R...PP.NR...A...SNrSNNPP...RP..P..P.P..R........S........Q.E.QQ.P.S.P.A.GRG....S...S.......SS...Sap.pqRSG......YNLRQQINRPQRLGGGP.N...pYRNleNRNIPRSETV.PS....SRraeTS.ET.NR.PNQARGGQQGssNRNQT-------------------------rsintvrasdsq..........................................
R9XZN6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGIYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYC7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QF4_SFV1/5-612                .......................................................................eg--DLDVQALANLFNDLGINRNPRHREIIALRMTGGWWGPAVRYNLVTLLLQDDQ.GQPLQQPRWRAEG.RPANPVVM..FTLEAPWQDIRLAFDNIDMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPGAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PAAPAA.SADLGWFAGG.PNLGSV---DPRLARVAYNPFLP.GpS....D....G..SGTAPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..P.AsggqttagT...SA.....G.......R..G.A......RGRR.S.Q....Q...GTP...G...RQ.SS...G...QS.QQQGR...RS..SqgQ.S..R........Q........S.DsSD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQSARSDNQ.QR....SQ...SQ.Q-.--.---PQSEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
U5NH58_9RETR/11-278              .........lqpaaasspyaapapsappapavsadlgwfaggpgprsvdprlarvaynpflpgpsdgsgvapa------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..---------------QPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XYT9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
K0HDB2_9RETR/1-99                .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-------------PPRNPREIPIWLGRNAPAIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLS-------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZZ5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI45_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKP8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS9_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NGS9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGAAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZT0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI87_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYAHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL72_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASATEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI43_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------gy....................................................
R9Y0R5_9RETR/1-372               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKV0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAAKIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1N0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..TQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVISALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDCNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
GAG_SFVCP/9-622                  .........................................................................EYELDVEALVVILRDRNIGRNPLHGEIIGLRLTEGWWGQLERFQMVRLILQDED.NEPLQRPRHEIIP.RAVNPHTM..FVLSGPLAELQLAFQDLDLPEGPLRFGPLANGHYVEGDPYSRSYRPVTMAETAQ..MTRD.ELEDTLNTQSEI.EIQM....INLLELYEVETRALR...RQLAE...RSS..IGQGGISPGASHSRPPVSSFS..G..LP.SL..PAIPGIH..T..RAPSP.PRATST.PGNIPRSLGD.DNMPSSSFAGPSQPRVSFHPGNP.F.A....E....A..EGHRPRSQSRERRRDIPSA..P.VI.S..A......P......V......P......S......A...P......PM...IQYIPVPPP.....PPVGA..VIPIQHIRSVTGEPPRNPREIPIWLGRNAPAIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...E...PS.QG...P...VN.SGRGR...QC..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...E.......NS...S.....QGG......YNLRSRTYQPQRYGGGR.G....RRW..NENTNNSETR.PT....EQ...SP.QT.PR.PIQAGSGVRG..NQSQTYKPAAGRGGRGNQNRNQRSSGAGDS......................................................
U5NL59_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPRLD..L..QP.AA..ASSPYV-..A..PAPSA.PAAPVA.SADLGWFAGG.---PSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINGAARVASFINHLNGVYELLGLNARGQSL.R..I..S.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------a.....................................................
U5NKY1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGE.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPTHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYY8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLG...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..LASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV-QSSAPPAASPLL..P.L-.-..P......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VTPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..M..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0G4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Hp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y166_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..V..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0U5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELEDVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDHNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZK6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGSAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2G2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q6XZS0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.D.RG.S.N.I.Q.NQG....Q...G.......NS...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKF8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLH6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLSPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E1_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLTDDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDTQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHKQAVTENAPTNPRDIPMWIGRNASAIEGVFPITTPDLRCRVINTLLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSKGVAAAYQLDMMLTNRDYNLIWGIIRPLLPEQAVVTAIQHRLDQEINDAAKIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0X9_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------NMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKP0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYDPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y118_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
Q45QF1_SFV1/5-610                .......................................................................eg--DLDVQALTDLFNNLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDDQ.GQPLQQPRWRAEG.RAANPAVM..FTLEAPWQDLRMAFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLEpaA..AP.SP..YVAP--A..P..LAPAA.PVASAD.LGWF---AGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCVTWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..P.AsggqttagT...SA.....G.......R..G.A......RGRR.S.Q....Q...GTP...G...RQ.SS...G...QA.QQQGR...RSsqG..Q.S..R........Q........S.DsSD.Q.N.V.Q.RQS....Q...G.......GN...G.....RGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQPARSDNQ.QR....SQ...SQ.QP.--.----QLEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
GAG_SFV3L/3-606                  ........................................................................d-HNLNVQELLNLFQNLGIPRQPNHREVIGLRMLGGWWGPGTRYILVSIFLQDDS.GQPLQQPRWRPEG.RPVNPLVH..NTIEAPWGELRQAFEDLDVAEGTLRFGPLANGNWIPGDEYSMEFQPPLAQEIAQ..MQRD.ELEEILDITGQI.CAQV....IDLVDMQDAQIRGLE...RRIQD...RLG..LR--DNLPVAGIQAPPSSPI-..G..QP.--..-----IA..S..SSLQPiPGSSSS.PADL------.DGIWTPRQIDPRLSRVAYNPFLP.G.S...sD....G..SGGSIPVQPSAPPAVLPSL..P.SL.P..A......P......V......-......-......S...Q......PI...IQYVAQPPV.....P-APQ..AIPIQHIRAVTGNTPTNPRDIPMWLGRHSAAIEGVFPMTTPDLRCRVVNALIGGSLGLSLEPIHCVNWAAVVAALYVRTHGSYPIHELANVLRAVVTQEGVATGFQLGIMLSNQDYNLVWGILRPLLPGQAVVTAMQQRLDQEVNDAARITSFNGHLNDIYQLLGLNARGQSIaR..AqsA.S........T...SG.....N.......S..A.S......AGRG.RrG....Q...R-T...Q...QQ.AG...R...QQ.QQQTR...RT..N..Q.GnqG........Qr.....dnN.Q.RQ.S.S.G.G.NQG....Q...-.......-R...G.....QGG......YDLRPRTYQPQRYGGGR.G....RRW..NDNQQQQQAQ.PG....RS...SD.QP.RSqSQQPQPEARG..DQSRTSGAGRGQQGRGNQNRNQRRADAN--nt....................................................
R9Y1U0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0P7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFSP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0D2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHSPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKK3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLL3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PA.A..S......P......L......P......P......L...PpalpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLSLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHW6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZX6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZZ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQ---...--P..RGLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
D5JWU5_9RETR/3-234               .......................................................................rg--NLDIARLTVLLQENSLSGNPPHLTHYVLRMTEGWWGPFPRYTRVRIILQDES.GNPLSQPRWELVD.RMFNPLRD..PILETTLDEMDRVFDGINLSPGTERYGPLCDGNFLYTDDAWNDFNPMSALEVADveLTPA.LYREHLNFLSRV.AEGM....LGDIIMLKQENEDAHetiTRLRE...R-I..INQPTSAP-IITSTPG--GVS..G..LPpSV..YQPTGLH..E..TY---.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------iqpsrpmqpsapplplmgdlgs................................
U5NH87_9RETR/13-280              ..........paaasspyvapassapaapvasadlgwfaggpgpgsvdprmakvaynpflpgpsdgsgvapvq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..----------------PSA..P.PA.A..S......Pl...lpL......P......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XZP8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKF7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....S..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGIFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAKVLRGVANSEGVTAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZJ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNAGGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI98_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.AMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1K8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDTVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
S4TZZ6_9RETR/5-40                .......................................................................nq--RLDIAQLAVLLRENGLPTNPPHGEEYALRMTEGW------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
B3FXH0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIRHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NIS...R...PS.PG...P...AN.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NI...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9XYV3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFAG-.-----GSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHT8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PAFSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHB8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1T6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKZ1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPIQPSAPP----AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHR6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXG0_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......KGRG.R.G....Q...SIS...R...PS.SG...P...AN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y147_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZV8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAETPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..SpllplpP......A......Q......L......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1E8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AT..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLDMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYKLLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1V5_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..-----------------DLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGDLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0B3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTIPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLSPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1N3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SA----DLGWfAEGPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCGVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKQ6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y154_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEMLDVVGQI.TMQM....SDSIGMQDAQVRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASLINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZV0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PM.A..S......P......LlplppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1V6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVD..P..-ASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1N5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1K0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFSP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIJ9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZY5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNVIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXC4_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNIGLSLTPGDCLTWDSAVATLFIRTHGTFPMHQLGNVIKGIIDQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTALQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...NTS...R...PS.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.N.RG.S.N.T.Q.NQN....Q...D.......NS...N.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NLB5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y083_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKR3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLRG...L--..--RGNLSVAGTPS-PPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1F4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZZ6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y048_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0H7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHZ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH07_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHC4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQTVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1A3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPIQPSAPP----AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHI4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYDPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEIDDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHC3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELEDVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGB6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y173_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y064_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDTQIRGLE...GQLR-...---..-GQRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PAPPA.PAAPAA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PVASPLL..P.--.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPITTPDLRCRVINALLGGNLGLNLEPQHCVTWASSIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWRILRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1V2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLNIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPVTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRSHGSYPIHQLAEVLRGVANSEGVAAAYQLDMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1S9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQPSAP---PVA-S..P.LL.P.lP......P......A......Q......P......A...Q......PV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHG1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAGVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI72_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHE4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFVNHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZS6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLK...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEALRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHE3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLGQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y004_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGAAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIB0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......LlllppaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y193_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWSAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0N5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.MMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGIPPPPPPSLD..I..QP.AA..SSSPYV-..A..PAPSA.PAAPAA.AADLGWFAGG.---PGPGSVDPRLARVAY---NP.F.L....P....G..P----SDGSRVAP-VQPSA..P.PV.A..S......P......LlplspaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLREVSNSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y006_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIRRNASAIEGVFPMTTPDLRCRVINALLGGNLRLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGB8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLQGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPFVA..P..LPPA-.PAASAA.AADLGWFAG-.--GPSSGSVDPRLARVAYNPFLP.GpS....D....G..TGAAPV---------QPSA..P.PA.A..S......P......L......P......SlqpaqpM...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGSAPTNPREIXMWIGRNASAIEGVXPIPTPDIRCRVINALLGGQLGLTLDPQHCITWASAIATLYVRTHGAYPIHQLAEVLRGVSNSEXVAAAWQLGMMLTNRDYNLVWGIIRPLLPGQAVVTAMQHRLDQEVNDPARIVSFTNHLNAVYELLGLNARGQSL.R..L..S.V........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NKD0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-X..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGAYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0V0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.MMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGIPPPPPPSLD..I..QP.AA..SSSPYV-..A..PAPSA.PAAPAA.AADLGWFAGG.---PGPGSVDPRLARVAY---NP.F.L....P....GpsDGSRVA-PVRPSAPPVASP..L.LP.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVSNSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1B4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y215_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------NMGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0X7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..PasSAPAT.PVASAD.LG---WFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....N....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGRSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZF8_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPSAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLTRVAYNPFLP.GpS....D....G..SGVAPAQPS-----APPVA..P.PL.L..S......P......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLQ0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQI....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPARQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINAPLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0M2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.VVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PSDG-----SGVAPVQPSA..P.PV.A..SpllplpP......A......Q......P......V...P......PI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZL4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..T..PASSA.PAVPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLR1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGRI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIAALYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1D3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLKCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0L6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHN3_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AAssPYVAP-A..S..SAPAA.PVASAD.LGWF---AGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y281_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHF1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFISHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIF0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTIPDLRCRVINALLGGNLGLNLEPQHCITWASAIATFYVRTYGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARVASFINHLDGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y047_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVV..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLNQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1W2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLG...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASST.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP----PAAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQYRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI29_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y128_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRDNLPVAGTPLPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDISMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI60_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZL9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..AFSPYV-..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0S9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQL....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDILMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0H4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLL7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AV..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDLRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-PA---AS..P.LL.P..L.....pP......A......L......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIP9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKJ9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAL..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTENAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYR7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGIAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI13_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPCVA..-..PASSA.PAAPVA.SADLGWFAGG.---PS---PGPVDPRLARVAYNP.F.L....P....G..PSD-----GSGAAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLKCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y178_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0C3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y041_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0J2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZM5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMREAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLKFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQKD.ELENVLDIVGQI.TIQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..P..-ASSA.PATPV-.---VSADLGWfAGGPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPTQQ..VIPIQHIRAVTGNAPTNPRDIPMWIERNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLREVANSEGVAAAYQLGMMLTNRDYNLIWEIIRPLLPGQAVVTAMQHRLDQEINDTARVTSFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y044_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Rp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZJ5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLR7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPTQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLG9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIK5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1L4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.G.P....-....-..------SDGSEVAPVQPSA..P.PV.A..S......P......Llp..llP......A......Q...Pv....qPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAVYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY65_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVIGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1G0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQRRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1W1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSMDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYPLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLB8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGB2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..PSDGSRVAPVQPSAPPXAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1L5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.G.P....S...gG..SGVAPVQPSA-PPA---AS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNVSAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKL1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMREIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQTVVTAMQHRLDQEISDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLU5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0Q7_9RETR/1-372               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PVAAAD.LGWFAGG---.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B2CGC4_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVADGSLRFGPLANGNYIPGDEYSLEFIPPAMQEIVQ..MQRD.EMEEILDIVGQI.MMQM....SDLIGMQDVQIRGLE...NQVR-...---..-GLRGNLPVAGTPPPPPPSLD..M..QP.AA..ASSPFV-..-..-APIP.PPVASAaAADLGWFAG-.--GPSSGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQPSA-----PPAA..S.PL.P..A......L......Q......P......A......Q...Pf....qPI...IQYVHPPPV.....NPAQQ..IIPIQHIRAVTGNAPSNPRDIPMWIGRNASAIEGVFPIPTPDIRSRVINALLGGQLGLTLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVSNSEGVAAAWQLGMMLTNQDYNLVWGIVRPLLPGQAVVTALQHRLDQEVSDPARIVSFINHLNAVYEILGLNARGQSL.R..L..S.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------a.....................................................
U5NH86_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPSPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYAHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY16_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGSAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLF4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSFD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIYQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y090_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQGIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0C4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIF8_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DLAGDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRGIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH32_9RETR/4-280               .ppppsfdlqpaaasspyvapapsapaapvasadlgwfaggpgpgsvdprmarvaynpflpgpsdgsgvapvq------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..----------------PSA..P.PA.A..Sp...llP......L......P......P......A...Qp...vqPV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNAR----.-..-..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y0W2_9RETR/1-375               ........................................................................i------------------------------------------------------.-------------.--------..-----------------DIADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNLPVAGTPPPPPPSLD..M..QP.AA..SSSPYVA..-..PAPLA.PAAPAA.AADLGWFAG-.-----GSGPGSVDPRLARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLNQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKS7_9RETR/1-374               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..S-SPY-V..A..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPV.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XYQ8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQNAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPY-A..A..PAPSA.PAAPAA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZT4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PSPGSVDPRLARVAYNPFLP.G.P....S....D..GSWA--------APVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVISALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1Q6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SG---------VAPVQPSA..P.PV.A..S......P......L......P......P......P...PpaqpvqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHY7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRNYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHY3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2B8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMREIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2R8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFVPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIGPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZX0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLS1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTHRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZG6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHL9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLSPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XZI7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLJ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDVQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRRVANPEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHP1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMRM....SDLIGMQDAQVRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARAASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1K7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDVGEGTLRFGPLANGNYIPGDEFSLEFLPPAMQEITQ..MQRD.ELEEILDVVGQI.TMQM....NDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Llp..ppP......A......Q...Pv....qPV...IQYVHPPPI.....NPAHQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NH78_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMITPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI85_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQM.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y136_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAIQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PAASAA.AVDLGWFA--.----GGSGPGSVDPRVARVAYNP.F.L....P....G..PS-----DGSGVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPI...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPITTPDIRCRVINALLGRNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0A5_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....N....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
H6V7I7_SFV1/5-612                .......................................................................eg--DLDVQALTNLFNDLGINRDPRHREVIALRMTGGWWGPATRYNLVTLLLQDDQ.GQPLPQPRWRAEG.RAANPAVM..FTLEAPWQDLRMPFDNIDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLGGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYV-..A..PAPSA.PSAPAA.AADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPVQ---------PSA..L.PV.A..S......P......L......P......S......L...PpaqpmqPV...IQYVPPPPY.....NPAQQ..VIPIQHIRAVTGNAPTNPREIPMWIGRNASAIEGVFPMATPDLRCRVINALLGGNLGLNLEPQHCITWASAVATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAWQLGMMLTNRDYNLIWGIVRPLLPGQAVVTAMQHRLDQEINDAARIVSFINHLNGVYELLGLNARGQSL.R..I..P.Asg...gqtTagaSA.....G.......R..G.T......RGRR.S.Q....Q...GAP...G..rQS.SG...P...SQqQGRRS...SQ..G..Q.P..R........Q........S.D.FSdQ.N.N.Q.RQA....Q...G.......GN...G.....GGG......YNLRPRTYQPQRYGGGR.G....RRW..NDQPARSDNQ.QR....SQ...SQ.Q-.PR.-----SEARG..EQSRTSGAGRGQGGRGNQNRNQRSAGG---nad...................................................
B3FXD3_9RETR/1-204               ........................................................................v------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..-------------------------------IDGVFPTTTPDLRCRIINALLGGNLGLSLTPGDCITWDSAVATLFIRTYGQYPLHQLGNVLKGIADQEGVATAYTLGMMLSGQNYQLVSGIIRGYLPGQAVVTAMQQRLDQEIDDQTRAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...SAP...R...PP.QG...P...AN.SGRGR...QR..P..A.P..G........Q........N.Y.RG.S.N.I.Q.NQG....Q...G.......NL...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y249_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIG-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..A..PAPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGSAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NI19_9RETR/1-375               .......................................................................iy------------------------------------------------------.-------------.--------..------------------LADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLD4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCIIWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0A8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVEQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRNIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLS4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAR..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIDQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTTMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1G3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1R8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0L1_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.MMQM....SDLIGMQDAQIRGLE...GQIRG..lRGN..LPVAGIPPL------PPPSLD..I..QP.AA..SSSPYV-..A..PAPSA.PAAPAA.AADLGWFAGG.---PGPGSVDPRLARVAY---NP.F.L....P....G..P----SDGSRVAP-VQPSA..P.PV.A..S......P......LlplspaQ......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGPYPIHQLAEVLRGVSNSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEVSDAARIASFINHPNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y252_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AA..ASSP-YA..T..PVPSA.PPAPAV.SADLGWFAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKD9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKT8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..T..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIAILYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NL49_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSMDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLTEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NIQ4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2Q7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y198_9RETR/1-373               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQIR-...---..-GLRGNIPVAGTPPPPPPSLD..L..QP.AT..ASSP-YA..A..PAPSA.PPAPAV.SADLGWLAGG.---PGPGSVDPRLARVAYNPFLP.GpS....D....G..SGV---------APAQPSA..P.PV.A..S......P......L.....lP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNSVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0T7_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..V..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NHT6_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPSPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSMDPRLARVAYNPFLP.GpS....D....G..SGVTPVQ---------PSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y0T9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNHIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDIIGMQDVQIRGLE...GQLR-...---..-GLSGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVApaS..SAPAV.PVASAD.LGWFA---GG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1M8_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..-----PSDGSEVAPVQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVSPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYEPLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NLC0_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFSG-.--GPSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXE7_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...PQ.....P.......R..P.S......RGRG.R.G....Q...STP...R...PS.QG...P...AS.SGRGR...QR..P..A.S..G........Q........Y.D.RG.S.N.N.Q.NQN....Q...G.......NT...S.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
U5NHZ2_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y125_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENILDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGAAPV---------QPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..IIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNQDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y1D9_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHCLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9Y2C3_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAG-.--GPSPGSVDPRLARVAYNPFLP.GpS....D....G..SGVAPVQ---------PSA..P.PV.A..S......P......Ll...plPp...aqP......V...Q......PV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGIMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
U5NKL4_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLNIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....TPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
R9XY02_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SNLIGMQDAQIRGLE...GQLR-...---..-GLRGNLPVAGAPPPPPPSLD..I..QP.AA..ASSPYVA..-..PASSA.PAAPVV.SADLGWFAGG.---PSPGSVDPRLARVAY---NP.F.L....P....G..----PSDGSRVAP-VQPSA..P.PV.A..S......P......Ll...plP......P......A...Qp...vqPV...IQYVHPPPI.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEINDAARVASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-....-...---...-...--.--...-...--.-----...--..-..-.-..-........-........-.-.--.-.-.-.-.---....-...-.......--...-.....---......-----------------.-....---..----------.--....--...--.--.--.----------..------------------------------pa....................................................
B3FXF4_9RETR/1-204               .........................................................................------------------------------------------------------.-------------.--------..------------------------------------------------------..----.------------.----....---------------...-----...---..---------------------..-..--.--..-------..-..-----.------.----------.-----------------------.-.-....-....-..-------------------..-.--.-..-......-......-......-......-......-...-......--...---------.....-----..------------------------------AIDGVFPVTTPDLRCRIINAILGGNLGLSLTPADCVTWDSAVGTLFVRTHGQFPMHQLGTVIQGIVNQEGVATAYTLGMMLSGQNYPLVSGIIRGYLPGQAVVTALQQRLDQEVDDQARAETFIQHLNAVYEILGLNARGQSI.R..A..S.V........T...SQ.....P.......R..P.S......RGRG.R.G....Q...SIS...R...PS.SG...P...TN.SGRGR...QR..P..A.S..G........Q........F.D.RG.S.N.N.Q.NQN....Q...G.......NI...X.....QGG......Y----------------.-....---..----------.--....--...--.--.--.----------..------------------------------......................................................
R9Y037_9RETR/1-375               .........................................................................------------------------------------------------------.-------------.--------..----------------IDLADDTLRFGPLANGNYIPGDEYSLEFIPPAMQEIAQ..MQRD.ELENVLDIVGQI.TMQM....SDLIGMQEAQIRGLE...GQLR-...---..-GLRGNLPVAGTPPPPPPSLD..L..QP.AA..ASSPYVA..-..PASSA.PAAPVA.SADLGWFAGG.---PGPGSVDPRMARVAYNPFLP.GpS....D....G..SGVAPVQPSAP-P---AAS..P.LL.P..L.....pP......A......Q......P......V...Q......PV...IQYVHPPPF.....NPAQQ..VIPIQHIRAVTGNAPTNPRDIPMWIGRNASAIEGVFPMTTPDLRCRVINALLGGNLGLNLEPQHCITWASAIATLYVRTHGSYPIHQLAEVLRGVANSEGVAAAYQLGMMLTNRDYNLIWGIIRPLLPGQAVVTAMQHRLDQEISDAARIASFINHLNGVYELLGLNARGQSL.R..I..-.-........-...--.....-.......-..-.-......----.-.-.