GenomeNet

Database: Pfam
Entry: HSV_VP16_C
LinkDB: HSV_VP16_C
Original site: HSV_VP16_C 
#=GF ID   HSV_VP16_C
#=GF AC   PF12149.3
#=GF DE   Herpes simplex virus virion protein 16 C terminal
#=GF AU   Mistry J, Gavin OL
#=GF SE   pdb_2k2u
#=GF GA   20.10 20.10;
#=GF TC   20.60 61.80;
#=GF NC   17.70 18.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   18630911
#=GF RT   NMR structure of the complex between the Tfb1 subunit of TFIIH
#=GF RT   and the activation domain of VP16: structural similarities
#=GF RT   between VP16 and p53.
#=GF RA   Langlois C, Mas C, Di Lello P, Jenkins LM, Legault P, Omichinski
#=GF RA   JG;
#=GF RL   J Am Chem Soc. 2008;130:10596-10604.
#=GF DR   INTERPRO; IPR021051;
#=GF CC   This domain is found in viruses, and is about 30 amino acids in
#=GF CC   length. It is found in association with Pfam:PF02232. This
#=GF CC   domain is the C terminal of the HSV virion protein 16. This
#=GF CC   protein is a transcription promoter. The C terminal domain is
#=GF CC   the carboxyl subdomain of the acidic transcriptional activation
#=GF CC   domain. The protein binds to DNA binding proteins to carry out
#=GF CC   its function. Such proteins include TATA binding protein, CBP,
#=GF CC   TBP-binding protein, etc.
#=GF SQ   19
#=GS F8RG79_HHV1/461-490   AC F8RG79.1
#=GS F8RF56_HHV1/461-490   AC F8RF56.1
#=GS G8HBG2_HHV1/461-490   AC G8HBG2.1
#=GS D3YPB2_HHV1/461-490   AC D3YPB2.1
#=GS VP16_HHV23/461-490    AC P68335.1
#=GS Q9ELS1_CHV16/462-491  AC Q9ELS1.1
#=GS F8RCZ3_HHV1/461-490   AC F8RCZ3.1
#=GS G9I270_HHV2/461-490   AC G9I270.1
#=GS Q5Y0Q4_9ALPH/459-488  AC Q5Y0Q4.1
#=GS Q805Y1_CHV1/457-487   AC Q805Y1.1
#=GS D3YPK6_HHV1/461-490   AC D3YPK6.1
#=GS Q3C1X7_9ALPH/460-489  AC Q3C1X7.1
#=GS F8REY2_HHV1/461-490   AC F8REY2.1
#=GS VP16_HHV2H/461-490    AC P68336.1
#=GS Q69113_HHV2/461-490   AC Q69113.1
#=GS F8RDE7_HHV1/461-490   AC F8RDE7.1
#=GS VP16_HHV1F/461-490    AC P04486.2
#=GS VP16_HHV1F/461-490    DR PDB; 2K2U B; 461-490;
#=GS VP16_HHV11/461-490    AC P06492.1
#=GS VP16_HHV11/461-490    DR PDB; 2PHG B; 465-490;
#=GS VP16_HHV11/461-490    DR PDB; 2PHE C; 465-490;
#=GS G8H933_HHV1/461-490   AC G8H933.1
F8RG79_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
F8RF56_HHV1/461-490              .DSAPYGALDTADFEFEQMFTDALGIDEYGG
G8HBG2_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
D3YPB2_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
VP16_HHV23/461-490               .DPVSYGALDVDDFEFEQMFTDAMGIDDFGG
Q9ELS1_CHV16/462-491             .DDAAYASLDMADFEFEQMFTDALGIDEFGG
F8RCZ3_HHV1/461-490              .DSAPYGALDTADFEFEQMFTDALGIDEYGG
G9I270_HHV2/461-490              .DPVSYGALDVDDFEFEQMFTDAMGIDDFGG
Q5Y0Q4_9ALPH/459-488             .DAAAYASLDMADFEFEQMFTDALGIDEFGG
Q805Y1_CHV1/457-487              dDAAAYASLDMADFEFEQMFTDALGIDDIGG
D3YPK6_HHV1/461-490              .DSTPYGALDMADFEFEQMFTDALGIDEYGG
Q3C1X7_9ALPH/460-489             .DPVPYGALDVADFEFEQMFTDALGIDDFGG
F8REY2_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
VP16_HHV2H/461-490               .DPVSYGALDVDDFEFEQMFTDAMGIDDFGG
Q69113_HHV2/461-490              .DPVSYGALDVDDFEFEQMFTDALGIDDFGG
F8RDE7_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
VP16_HHV1F/461-490               .DSAPYGALDMADFEFEQMFTDALGIDEYGG
#=GR VP16_HHV1F/461-490    SS    .---TTSS--THHHHHHHTTS------SS--
VP16_HHV11/461-490               .DSAPYGALDMADFEFEQMFTDALGIDEYGG
#=GR VP16_HHV11/461-490    SS    .XXXX-CCCTCCCCCHHCCHCCCCCTCCC--
G8H933_HHV1/461-490              .DSAPYGALDMADFEFEQMFTDALGIDEYGG
#=GC SS_cons                     .XXXTTCCCTCCCCCHHCCCCCCCCTCCC--
#=GC seq_cons                    .DuAPYGALDMADFEFEQMFTDALGIDEaGG
//
DBGET integrated database retrieval system