GenomeNet

Database: Pfam
Entry: Hepatitis_core
LinkDB: Hepatitis_core
Original site: Hepatitis_core 
#=GF ID   Hepatitis_core
#=GF AC   PF00906.15
#=GF DE   Hepatitis core antigen
#=GF AU   Bateman A
#=GF SE   Pfam-B_8 (release 3.0)
#=GF GA   22.60 17.00;
#=GF TC   22.70 22.70;
#=GF NC   22.50 16.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   399329
#=GF RT   Hepatitis B virus genes and their expression in E. coli. 
#=GF RA   Pasek M, Goto T, Gilbert W, Zink B, Schaller H, Mckay P,
#=GF RA   Leadbetter G, Murray K; 
#=GF RL   Nature 1979;282:575-579.
#=GF RN   [2]
#=GF RM   2677399
#=GF RT   A recombinant hepatitis B core antigen polypeptide with the
#=GF RT   protamine-like domain deleted self-assembles into capsid
#=GF RT   particles but fails to bind nucleic acids. 
#=GF RA   Gallina A, Bonelli F, Zentilin L, Rindi G, Muttini M, Milanesi
#=GF RA   G; 
#=GF RL   J Virol 1989;63:4645-4652.
#=GF DR   INTERPRO; IPR002006;
#=GF DR   SCOP; 1qgt; fa;
#=GF CC   The core antigen of hepatitis viruses possesses a carboxyl
#=GF CC   terminus rich in arginine. On this basis it was predicted that
#=GF CC   the core antigen would bind DNA [1]. There is some experimental
#=GF CC   evidence to support this [2].
#=GF SQ   7177
#=GS C7DMT1_HBV/2-183     AC C7DMT1.1
#=GS Q8QXQ4_HBV/2-183     AC Q8QXQ4.1
#=GS B4Z2D9_HBV/2-37      AC B4Z2D9.1
#=GS H6V8B5_HBV/31-56     AC H6V8B5.1
#=GS G4XMN0_HBV/31-212    AC G4XMN0.1
#=GS B2CZU7_HBV/31-212    AC B2CZU7.1
#=GS D4I4R5_HBV/2-185     AC D4I4R5.1
#=GS B4Z664_HBV/2-41      AC B4Z664.1
#=GS B4X6M3_HBV/31-86     AC B4X6M3.1
#=GS Q80GY3_HBV/31-212    AC Q80GY3.1
#=GS C3W3U1_HBV/2-183     AC C3W3U1.1
#=GS Q09L00_HBV/2-20      AC Q09L00.1
#=GS Q8QSD2_HBV/2-183     AC Q8QSD2.1
#=GS B4Z3T4_HBV/2-39      AC B4Z3T4.1
#=GS Q80GX6_HBV/31-212    AC Q80GX6.1
#=GS Q2L5C6_HBV/2-20      AC Q2L5C6.1
#=GS B4Z3E7_HBV/31-71     AC B4Z3E7.1
#=GS C1K1K7_HBV/31-210    AC C1K1K7.1
#=GS B4Z2S5_HBV/31-70     AC B4Z2S5.1
#=GS G1C958_HBV/2-183     AC G1C958.1
#=GS D8VBQ5_HBV/2-51      AC D8VBQ5.1
#=GS I0DG74_HBV/31-212    AC I0DG74.1
#=GS Q6TYH7_HBV/31-182    AC Q6TYH7.1
#=GS Q7T4V4_HBV/2-183     AC Q7T4V4.1
#=GS Q9WJE5_HBV/31-212    AC Q9WJE5.1
#=GS B4Z2Y1_HBV/31-66     AC B4Z2Y1.1
#=GS A1YTM1_HBV/2-183     AC A1YTM1.1
#=GS B6D6C3_HBV/31-68     AC B6D6C3.1
#=GS C1K178_HBV/31-212    AC C1K178.1
#=GS D8VBU4_HBV/2-51      AC D8VBU4.1
#=GS D8V9T5_HBV/2-183     AC D8V9T5.1
#=GS B2CZI2_HBV/2-183     AC B2CZI2.1
#=GS Q60GX8_HBV/31-71     AC Q60GX8.1
#=GS B4Z3F7_HBV/2-42      AC B4Z3F7.1
#=GS E0ZRU6_HBV/2-183     AC E0ZRU6.1
#=GS Q2EGG9_HBV/31-99     AC Q2EGG9.1
#=GS D0UE71_HBV/2-183     AC D0UE71.1
#=GS D3TJB6_HBV/2-183     AC D3TJB6.1
#=GS B4X6K6_HBV/31-87     AC B4X6K6.1
#=GS D3YFZ0_HBV/2-183     AC D3YFZ0.1
#=GS Q778I9_HBV/2-183     AC Q778I9.1
#=GS Q2MLQ1_HBV/2-183     AC Q2MLQ1.1
#=GS D8VB94_HBV/31-203    AC D8VB94.1
#=GS D3J5R6_HBV/31-57     AC D3J5R6.1
#=GS B3VAW9_HBV/2-183     AC B3VAW9.1
#=GS A9CM65_HBV/2-183     AC A9CM65.1
#=GS C4P1J9_HBV/31-76     AC C4P1J9.1
#=GS B0FCS6_HBV/31-212    AC B0FCS6.1
#=GS G1EII6_HBV/2-153     AC G1EII6.1
#=GS Q8QP34_HBV/1-130     AC Q8QP34.1
#=GS Q77BF8_HBV/1-96      AC Q77BF8.1
#=GS B4Z610_HBV/2-41      AC B4Z610.1
#=GS B4Z1N5_HBV/31-71     AC B4Z1N5.1
#=GS D8VB73_HBV/31-212    AC D8VB73.1
#=GS D0EYW5_HBV/2-157     AC D0EYW5.1
#=GS Q09KV9_HBV/2-20      AC Q09KV9.1
#=GS G3E5C0_HBV/31-212    AC G3E5C0.1
#=GS B4Z301_HBV/2-37      AC B4Z301.1
#=GS D5LFH7_HBV/2-183     AC D5LFH7.1
#=GS D3J612_HBV/31-88     AC D3J612.1
#=GS Q09L37_HBV/2-20      AC Q09L37.1
#=GS B2Y6J0_HBV/2-185     AC B2Y6J0.1
#=GS Q2EX83_HBV/31-212    AC Q2EX83.1
#=GS B4Z2V7_HBV/31-70     AC B4Z2V7.1
#=GS B3VAT4_HBV/2-183     AC B3VAT4.1
#=GS H6V899_HBV/31-56     AC H6V899.1
#=GS B7TV83_HBV/2-183     AC B7TV83.1
#=GS D0EE65_HBV/31-214    AC D0EE65.1
#=GS C4P1G3_HBV/31-76     AC C4P1G3.1
#=GS D0ESR3_HBV/31-212    AC D0ESR3.1
#=GS Q2L5A2_HBV/2-20      AC Q2L5A2.1
#=GS C4P1D8_HBV/31-76     AC C4P1D8.1
#=GS B9VL59_HBV/2-183     AC B9VL59.1
#=GS B4Z213_HBV/2-41      AC B4Z213.1
#=GS C1K210_HBV/2-183     AC C1K210.1
#=GS C4P1T4_HBV/31-76     AC C4P1T4.1
#=GS Q8JSV1_HBV/1-130     AC Q8JSV1.1
#=GS B9VL47_HBV/31-212    AC B9VL47.1
#=GS D3J2Y8_HBV/31-212    AC D3J2Y8.1
#=GS B4Z635_HBV/31-70     AC B4Z635.1
#=GS Q89656_HBV/31-212    AC Q89656.1
#=GS E0ZP79_HBV/2-110     AC E0ZP79.1
#=GS Q00K93_HBV/2-183     AC Q00K93.1
#=GS Q09KY5_HBV/2-20      AC Q09KY5.1
#=GS Q68006_HBV/2-183     AC Q68006.1
#=GS B4X6J8_HBV/31-88     AC B4X6J8.1
#=GS A9QPV3_HBV/31-212    AC A9QPV3.1
#=GS A1KR50_HBV/2-25      AC A1KR50.1
#=GS C1K1P9_HBV/31-212    AC C1K1P9.1
#=GS D2U672_HBV/2-183     AC D2U672.1
#=GS B4Z3S1_HBV/31-68     AC B4Z3S1.1
#=GS Q80J67_HBV/2-81      AC Q80J67.1
#=GS C5WJY1_HBV/2-183     AC C5WJY1.1
#=GS G1E8M3_HBV/31-212    AC G1E8M3.1
#=GS C4P1G8_HBV/31-76     AC C4P1G8.1
#=GS D8V9U6_HBV/58-159    AC D8V9U6.1
#=GS E0D3A4_HBV/31-82     AC E0D3A4.1
#=GS Q60H07_HBV/31-71     AC Q60H07.1
#=GS Q4W6F7_HBV/31-212    AC Q4W6F7.1
#=GS G1EIK1_HBV/2-153     AC G1EIK1.1
#=GS C4P1F3_HBV/31-76     AC C4P1F3.1
#=GS A9PLF3_HBV/1-39      AC A9PLF3.1
#=GS Q03731_HBV/31-212    AC Q03731.1
#=GS Q8B8Q4_HBV/31-212    AC Q8B8Q4.1
#=GS B4Z3K5_HBV/31-68     AC B4Z3K5.1
#=GS H6UGN7_HBV/2-183     AC H6UGN7.1
#=GS B4ZYV5_HBV/2-183     AC B4ZYV5.1
#=GS D3TK42_HBV/110-160   AC D3TK42.1
#=GS D5LDB2_HBV/31-212    AC D5LDB2.1
#=GS Q99HT2_HBV/2-183     AC Q99HT2.1
#=GS Q1MSM6_HBV/31-173    AC Q1MSM6.1
#=GS B6D6C6_HBV/31-142    AC B6D6C6.1
#=GS G1E7C8_HBV/2-183     AC G1E7C8.1
#=GS D0UE66_HBV/2-183     AC D0UE66.1
#=GS H9BMW3_HBV/24-182    AC H9BMW3.1
#=GS Q80AH5_HBV/2-183     AC Q80AH5.1
#=GS G1E7K2_HBV/2-183     AC G1E7K2.1
#=GS B4Z422_HBV/2-39      AC B4Z422.1
#=GS C7AY50_HBV/2-185     AC C7AY50.1
#=GS D8VBF0_HBV/2-130     AC D8VBF0.1
#=GS Q2L568_HBV/2-20      AC Q2L568.1
#=GS A1KR40_HBV/2-25      AC A1KR40.1
#=GS B4Z251_HBV/31-70     AC B4Z251.1
#=GS Q8VBI8_HBV/2-183     AC Q8VBI8.1
#=GS Q2L4M5_HBV/31-212    AC Q2L4M5.1
#=GS Q8VBK3_HBV/2-183     AC Q8VBK3.1
#=GS E0ZNT2_HBV/2-89      AC E0ZNT2.1
#=GS B4Z222_HBV/31-70     AC B4Z222.1
#=GS D9U5F4_HBV/2-183     AC D9U5F4.1
#=GS B5MEX2_HBV/2-183     AC B5MEX2.1
#=GS B4Z666_HBV/31-70     AC B4Z666.1
#=GS G1C8C6_HBV/2-183     AC G1C8C6.1
#=GS A9PLG4_HBV/1-39      AC A9PLG4.1
#=GS A8KQC0_HBV/31-212    AC A8KQC0.1
#=GS Q68070_HBV/31-212    AC Q68070.1
#=GS Q45F91_HBV/2-183     AC Q45F91.1
#=GS H9N874_HBV/2-183     AC H9N874.1
#=GS Q68075_HBV/31-212    AC Q68075.1
#=GS Q77BF6_HBV/1-96      AC Q77BF6.1
#=GS B4YKM2_HBV/2-185     AC B4YKM2.1
#=GS Q1MSK0_HBV/31-173    AC Q1MSK0.1
#=GS D0EDU6_HBV/31-212    AC D0EDU6.1
#=GS B4Z2Q3_HBV/31-70     AC B4Z2Q3.1
#=GS B4Z326_HBV/31-66     AC B4Z326.1
#=GS D4HMX8_HBV/1-77      AC D4HMX8.1
#=GS Q6X5H1_HBV/1-54      AC Q6X5H1.1
#=GS B3IVL9_HBV/2-183     AC B3IVL9.1
#=GS G9G9B7_HBV/2-183     AC G9G9B7.1
#=GS B4Z3F9_HBV/31-71     AC B4Z3F9.1
#=GS B4Z633_HBV/2-41      AC B4Z633.1
#=GS B9VKU6_HBV/31-212    AC B9VKU6.1
#=GS C1K173_HBV/2-181     AC C1K173.1
#=GS Q80H14_HBV/31-169    AC Q80H14.1
#=GS Q2EGE9_HBV/31-99     AC Q2EGE9.1
#=GS D0EE34_HBV/2-185     AC D0EE34.1
#=GS C4P1G6_HBV/31-76     AC C4P1G6.1
#=GS Q8B4H0_HBV/31-214    AC Q8B4H0.1
#=GS C7AYR7_HBV/2-185     AC C7AYR7.1
#=GS G1E7N3_HBV/2-183     AC G1E7N3.1
#=GS C7AYN3_HBV/31-212    AC C7AYN3.1
#=GS B4Z4U3_HBV/31-70     AC B4Z4U3.1
#=GS C0LKF3_HBV/2-183     AC C0LKF3.1
#=GS Q91A84_HBV/31-66     AC Q91A84.1
#=GS Q8B4C7_HBV/2-183     AC Q8B4C7.1
#=GS Q8JSW5_HBV/1-130     AC Q8JSW5.1
#=GS B4Z2N8_HBV/2-41      AC B4Z2N8.1
#=GS Q6I6T2_HBV/31-71     AC Q6I6T2.1
#=GS D3TJA3_HBV/74-118    AC D3TJA3.1
#=GS D8VCG6_HBV/2-51      AC D8VCG6.1
#=GS C4P1U2_HBV/31-76     AC C4P1U2.1
#=GS D3J6C3_HBV/31-70     AC D3J6C3.1
#=GS E5CZ15_HBV/2-183     AC E5CZ15.1
#=GS C7AYK0_HBV/2-185     AC C7AYK0.1
#=GS B4Z2Z3_HBV/2-37      AC B4Z2Z3.1
#=GS HBEAG_HBVA2/31-214   AC P0C692.1
#=GS D8VBP3_HBV/2-51      AC D8VBP3.1
#=GS B5TXU0_HBV/2-183     AC B5TXU0.1
#=GS D3GIM8_HBV/2-183     AC D3GIM8.1
#=GS H6UN87_HBV/2-185     AC H6UN87.1
#=GS E9L5E8_HBV/2-183     AC E9L5E8.1
#=GS Q45F31_HBV/2-183     AC Q45F31.1
#=GS Q2EX71_HBV/2-183     AC Q2EX71.1
#=GS E0ZNB1_HBV/2-147     AC E0ZNB1.1
#=GS A3RF49_HBV/31-205    AC A3RF49.1
#=GS D8VBN7_HBV/2-48      AC D8VBN7.1
#=GS Q2L5E6_HBV/2-24      AC Q2L5E6.1
#=GS B4Z5X1_HBV/2-42      AC B4Z5X1.1
#=GS F5C1D9_HBV/43-224    AC F5C1D9.1
#=GS B5B4D8_HBV/94-173    AC B5B4D8.1
#=GS C4P158_HBV/31-76     AC C4P158.1
#=GS B4Z369_HBV/2-37      AC B4Z369.1
#=GS B4Z1Z2_HBV/2-41      AC B4Z1Z2.1
#=GS B4Z249_HBV/2-38      AC B4Z249.1
#=GS H9BMT2_HBV/28-192    AC H9BMT2.1
#=GS C4P136_HBV/31-76     AC C4P136.1
#=GS B4Z2D0_HBV/2-37      AC B4Z2D0.1
#=GS H9BMW0_HBV/2-160     AC H9BMW0.1
#=GS Q6I6U8_HBV/31-71     AC Q6I6U8.1
#=GS B5M5A4_HBV/31-212    AC B5M5A4.1
#=GS B4Z5V4_HBV/31-71     AC B4Z5V4.1
#=GS Q9IHD2_HBV/2-183     AC Q9IHD2.1
#=GS H9BMT7_HBV/2-160     AC H9BMT7.1
#=GS Q91C44_HBV/31-214    AC Q91C44.1
#=GS G0Z2Y5_HBV/2-121     AC G0Z2Y5.1
#=GS Q2L5C0_HBV/2-20      AC Q2L5C0.1
#=GS C7AYE2_HBV/2-185     AC C7AYE2.1
#=GS E0ZNC4_HBV/31-171    AC E0ZNC4.1
#=GS C7DML1_HBV/31-212    AC C7DML1.1
#=GS Q60GU9_HBV/2-42      AC Q60GU9.1
#=GS C4P1N3_HBV/31-76     AC C4P1N3.1
#=GS D8VC41_HBV/31-80     AC D8VC41.1
#=GS G8Z909_HBV/2-139     AC G8Z909.1
#=GS E0ZNH7_HBV/31-182    AC E0ZNH7.1
#=GS B4Z371_HBV/31-66     AC B4Z371.1
#=GS A0MML2_HBV/2-183     AC A0MML2.1
#=GS D8VBR0_HBV/31-80     AC D8VBR0.1
#=GS B5B4Q7_HBV/2-183     AC B5B4Q7.1
#=GS Q2LCA5_HBV/2-183     AC Q2LCA5.1
#=GS B4Z6A6_HBV/2-41      AC B4Z6A6.1
#=GS Q30BH1_HBV/31-113    AC Q30BH1.1
#=GS B6ULI2_HBV/31-93     AC B6ULI2.1
#=GS D8VBC8_HBV/31-144    AC D8VBC8.1
#=GS Q09L40_HBV/2-20      AC Q09L40.1
#=GS C7DN80_HBV/31-212    AC C7DN80.1
#=GS Q9IGW2_HBV/2-183     AC Q9IGW2.1
#=GS G1EIH5_HBV/2-153     AC G1EIH5.1
#=GS C4P0Z8_HBV/31-76     AC C4P0Z8.1
#=GS B4Z621_HBV/2-41      AC B4Z621.1
#=GS G1ETT9_HBV/31-212    AC G1ETT9.1
#=GS B4Z6B8_HBV/2-41      AC B4Z6B8.1
#=GS C7DNK0_HBV/2-183     AC C7DNK0.1
#=GS B4Z660_HBV/31-70     AC B4Z660.1
#=GS B4Z1L9_HBV/2-42      AC B4Z1L9.1
#=GS Q75TM1_HBV/31-214    AC Q75TM1.1
#=GS B4Z1G6_HBV/2-40      AC B4Z1G6.1
#=GS D3TJB0_HBV/2-183     AC D3TJB0.1
#=GS G9G8U1_HBV/2-183     AC G9G8U1.1
#=GS C3W4B7_HBV/2-182     AC C3W4B7.1
#=GS C3W3P4_HBV/2-183     AC C3W3P4.1
#=GS B3VB90_HBV/31-212    AC B3VB90.1
#=GS C7DNJ4_HBV/2-183     AC C7DNJ4.1
#=GS D7NKV2_HBV/2-183     AC D7NKV2.1
#=GS Q2EGD4_HBV/31-99     AC Q2EGD4.1
#=GS G1E7Q8_HBV/2-183     AC G1E7Q8.1
#=GS D0E6L5_HBV/31-212    AC D0E6L5.1
#=GS G0Z2W5_HBV/2-121     AC G0Z2W5.1
#=GS B2CZW1_HBV/31-212    AC B2CZW1.1
#=GS D3J5T3_HBV/31-88     AC D3J5T3.1
#=GS Q2EGG6_HBV/31-99     AC Q2EGG6.1
#=GS D3K2D7_HBV/31-212    AC D3K2D7.1
#=GS H6UGC3_HBV/2-183     AC H6UGC3.1
#=GS A1KR47_HBV/2-25      AC A1KR47.1
#=GS Q68016_HBV/31-212    AC Q68016.1
#=GS C7DSJ8_HBV/2-183     AC C7DSJ8.1
#=GS Q4FDB2_HBV/31-212    AC Q4FDB2.1
#=GS Q98VI7_HBV/31-212    AC Q98VI7.1
#=GS B7TUP2_HBV/2-183     AC B7TUP2.1
#=GS Q9WMC1_HBV/31-212    AC Q9WMC1.1
#=GS H9BMW8_HBV/2-160     AC H9BMW8.1
#=GS B4Z693_HBV/31-70     AC B4Z693.1
#=GS Q7THR9_HBV/31-212    AC Q7THR9.1
#=GS Q991K4_HBV/31-212    AC Q991K4.1
#=GS Q67933_HBV/2-183     AC Q67933.1
#=GS I0DG24_HBV/31-212    AC I0DG24.1
#=GS B3VBA8_HBV/2-183     AC B3VBA8.1
#=GS B5MEV6_HBV/31-212    AC B5MEV6.1
#=GS Q9QRQ5_HBV/2-176     AC Q9QRQ5.1
#=GS Q67883_HBV/2-183     AC Q67883.1
#=GS B4Z3W0_HBV/2-39      AC B4Z3W0.1
#=GS B7TTX4_HBV/2-183     AC B7TTX4.1
#=GS G1C8B8_HBV/31-84     AC G1C8B8.1
#=GS E0ZNI0_HBV/31-182    AC E0ZNI0.1
#=GS B5ATD0_HBV/31-212    AC B5ATD0.1
#=GS I0DG29_HBV/31-212    AC I0DG29.1
#=GS D8VC47_HBV/2-51      AC D8VC47.1
#=GS D0E6H1_HBV/31-212    AC D0E6H1.1
#=GS Q9WMB6_HBV/31-212    AC Q9WMB6.1
#=GS B4Z1Q3_HBV/31-71     AC B4Z1Q3.1
#=GS B6ULL4_HBV/31-212    AC B6ULL4.1
#=GS I0DG34_HBV/31-212    AC I0DG34.1
#=GS Q2L582_HBV/2-20      AC Q2L582.1
#=GS B4Z4Q1_HBV/2-41      AC B4Z4Q1.1
#=GS D8VC46_HBV/31-80     AC D8VC46.1
#=GS Q6X5G2_HBV/1-119     AC Q6X5G2.1
#=GS Q2EIE8_HBV/31-212    AC Q2EIE8.1
#=GS H3K3C9_HBV/2-185     AC H3K3C9.1
#=GS E0ZNG2_HBV/2-142     AC E0ZNG2.1
#=GS D3YG38_HBV/2-183     AC D3YG38.1
#=GS Q9WMC8_HBV/31-212    AC Q9WMC8.1
#=GS D3J5X4_HBV/31-87     AC D3J5X4.1
#=GS E5RD36_HBV/31-212    AC E5RD36.1
#=GS B0FCJ7_HBV/2-183     AC B0FCJ7.1
#=GS Q80GV3_HBV/2-181     AC Q80GV3.1
#=GS B5A2F5_HBV/31-212    AC B5A2F5.1
#=GS A9PLC5_HBV/1-39      AC A9PLC5.1
#=GS B4Z4I3_HBV/2-41      AC B4Z4I3.1
#=GS Q7TF62_HBV/31-75     AC Q7TF62.1
#=GS Q8VBH2_HBV/2-183     AC Q8VBH2.1
#=GS H6UN71_HBV/2-183     AC H6UN71.1
#=GS B4Z4S6_HBV/2-41      AC B4Z4S6.1
#=GS Q9E6T3_HBV/2-183     AC Q9E6T3.1
#=GS Q9E0V7_HBV/2-123     AC Q9E0V7.1
#=GS Q7TED0_HBV/31-163    AC Q7TED0.1
#=GS B4YKX5_HBV/2-183     AC B4YKX5.1
#=GS D8VBH4_HBV/2-24      AC D8VBH4.1
#=GS D0EYV7_HBV/2-158     AC D0EYV7.1
#=GS D8VC66_HBV/31-65     AC D8VC66.1
#=GS B5M521_HBV/31-212    AC B5M521.1
#=GS H9BMQ6_HBV/2-121     AC H9BMQ6.1
#=GS Q81130_HBV/2-183     AC Q81130.1
#=GS D3J5W1_HBV/31-73     AC D3J5W1.1
#=GS Q6TYF0_HBV/31-182    AC Q6TYF0.1
#=GS D8VCG9_HBV/2-48      AC D8VCG9.1
#=GS Q9QB17_HBV/2-183     AC Q9QB17.1
#=GS D3J634_HBV/31-88     AC D3J634.1
#=GS CAPSD_HBVB1/2-183    AC P17391.1
#=GS B7TUL6_HBV/2-183     AC B7TUL6.1
#=GS Q81146_HBV/2-82      AC Q81146.1
#=GS D3J5N8_HBV/31-57     AC D3J5N8.1
#=GS Q8JSW0_HBV/1-130     AC Q8JSW0.1
#=GS D3TKD5_HBV/2-183     AC D3TKD5.1
#=GS D8V9V2_HBV/2-51      AC D8V9V2.1
#=GS CAPSD_HBVCP/2-183    AC P12901.1
#=GS CAPSD_HBVCP/2-183    DR PDB; 1HHH C; 1-10;
#=GS D5LFJ5_HBV/2-183     AC D5LFJ5.1
#=GS B3V3R4_HBV/2-183     AC B3V3R4.1
#=GS Q784R8_HBV/2-183     AC Q784R8.1
#=GS E0ZN78_HBV/2-153     AC E0ZN78.1
#=GS B4X6M9_HBV/31-86     AC B4X6M9.1
#=GS Q45F24_HBV/2-183     AC Q45F24.1
#=GS A9PLD1_HBV/1-39      AC A9PLD1.1
#=GS D3J615_HBV/31-88     AC D3J615.1
#=GS Q8QP16_HBV/1-130     AC Q8QP16.1
#=GS B4Z651_HBV/31-70     AC B4Z651.1
#=GS B4Z1G8_HBV/31-71     AC B4Z1G8.1
#=GS Q60GY2_HBV/2-42      AC Q60GY2.1
#=GS B4Z641_HBV/31-70     AC B4Z641.1
#=GS B4Z3E4_HBV/31-71     AC B4Z3E4.1
#=GS D8VCG8_HBV/31-77     AC D8VCG8.1
#=GS B4Z1G3_HBV/2-40      AC B4Z1G3.1
#=GS B3VAK6_HBV/2-183     AC B3VAK6.1
#=GS D3TK67_HBV/31-86     AC D3TK67.1
#=GS B0YK30_HBV/31-214    AC B0YK30.1
#=GS B4Z2D4_HBV/2-37      AC B4Z2D4.1
#=GS C4P131_HBV/31-76     AC C4P131.1
#=GS G9G9S9_HBV/31-80     AC G9G9S9.1
#=GS D5LEG7_HBV/2-183     AC D5LEG7.1
#=GS D5LDZ2_HBV/2-183     AC D5LDZ2.1
#=GS C4P1N2_HBV/31-76     AC C4P1N2.1
#=GS G9G8M5_HBV/2-183     AC G9G8M5.1
#=GS D3J665_HBV/31-68     AC D3J665.1
#=GS B5B4E9_HBV/2-85      AC B5B4E9.1
#=GS Q09KV1_HBV/2-20      AC Q09KV1.1
#=GS B5B4Q0_HBV/2-183     AC B5B4Q0.1
#=GS C4P138_HBV/31-76     AC C4P138.1
#=GS Q2EGD3_HBV/31-99     AC Q2EGD3.1
#=GS Q09KU0_HBV/2-20      AC Q09KU0.1
#=GS Q9DUH6_HBV/2-183     AC Q9DUH6.1
#=GS C4P109_HBV/31-76     AC C4P109.1
#=GS D3TJC2_HBV/2-183     AC D3TJC2.1
#=GS Q6J328_HBV/31-212    AC Q6J328.1
#=GS F4MJH0_HBV/31-81     AC F4MJH0.1
#=GS D3YGD6_HBV/2-183     AC D3YGD6.1
#=GS C4P1I9_HBV/31-76     AC C4P1I9.1
#=GS C1KT91_HBV/31-212    AC C1KT91.1
#=GS Q91T00_HBV/31-212    AC Q91T00.1
#=GS G9G8Y3_HBV/2-40      AC G9G8Y3.1
#=GS D3J5L1_HBV/31-57     AC D3J5L1.1
#=GS H2ER95_HBV/2-183     AC H2ER95.1
#=GS B4Z4V2_HBV/31-70     AC B4Z4V2.1
#=GS Q19SZ9_HBV/2-183     AC Q19SZ9.1
#=GS D3YGJ0_HBV/2-183     AC D3YGJ0.1
#=GS C9WDI3_HBV/31-214    AC C9WDI3.1
#=GS D3J624_HBV/31-88     AC D3J624.1
#=GS B5B4H5_HBV/2-183     AC B5B4H5.1
#=GS B5B499_HBV/31-212    AC B5B499.1
#=GS D0U3X6_HBV/31-214    AC D0U3X6.1
#=GS B4Z3K2_HBV/31-68     AC B4Z3K2.1
#=GS D8VBK4_HBV/2-51      AC D8VBK4.1
#=GS D3J5S7_HBV/31-57     AC D3J5S7.1
#=GS C4P1S1_HBV/31-71     AC C4P1S1.1
#=GS H2E6Z2_HBV/31-193    AC H2E6Z2.1
#=GS B4Z3V3_HBV/31-68     AC B4Z3V3.1
#=GS D6P594_HBV/31-212    AC D6P594.1
#=GS D0EEJ6_HBV/2-185     AC D0EEJ6.1
#=GS Q68020_HBV/31-212    AC Q68020.1
#=GS E5D5P1_HBV/1-174     AC E5D5P1.1
#=GS C4P171_HBV/31-76     AC C4P171.1
#=GS D0EEP3_HBV/31-214    AC D0EEP3.1
#=GS B4Z1G0_HBV/2-40      AC B4Z1G0.1
#=GS D6P5A2_HBV/2-183     AC D6P5A2.1
#=GS B4YL35_HBV/31-212    AC B4YL35.1
#=GS B4Z2G8_HBV/31-66     AC B4Z2G8.1
#=GS B4Z5T1_HBV/2-42      AC B4Z5T1.1
#=GS C4P1T0_HBV/31-76     AC C4P1T0.1
#=GS H9BMV0_HBV/25-191    AC H9BMV0.1
#=GS B4Z4S5_HBV/31-70     AC B4Z4S5.1
#=GS B7TUG1_HBV/2-183     AC B7TUG1.1
#=GS Q60GZ2_HBV/31-71     AC Q60GZ2.1
#=GS D3J642_HBV/31-88     AC D3J642.1
#=GS G9G962_HBV/2-183     AC G9G962.1
#=GS D3J5W7_HBV/31-77     AC D3J5W7.1
#=GS B5BPM4_HBV/2-183     AC B5BPM4.1
#=GS D3J6B0_HBV/31-70     AC D3J6B0.1
#=GS E0D3A0_HBV/31-82     AC E0D3A0.1
#=GS C4P1E5_HBV/31-76     AC C4P1E5.1
#=GS B4Z2Y4_HBV/31-66     AC B4Z2Y4.1
#=GS B9W3Z4_HBV/2-185     AC B9W3Z4.1
#=GS I0DG53_HBV/31-212    AC I0DG53.1
#=GS F4MJH9_HBV/31-81     AC F4MJH9.1
#=GS D0EE66_HBV/2-185     AC D0EE66.1
#=GS B9VKU2_HBV/31-212    AC B9VKU2.1
#=GS B4Z4R0_HBV/31-70     AC B4Z4R0.1
#=GS D3J5M5_HBV/31-70     AC D3J5M5.1
#=GS G0XT53_HBV/31-193    AC G0XT53.1
#=GS C4P1Q5_HBV/31-76     AC C4P1Q5.1
#=GS Q9E0S9_HBV/2-123     AC Q9E0S9.1
#=GS B7TUE0_HBV/2-183     AC B7TUE0.1
#=GS G4XMF8_HBV/31-212    AC G4XMF8.1
#=GS E0ZP70_HBV/2-29      AC E0ZP70.1
#=GS H6V5R3_HBV/2-183     AC H6V5R3.1
#=GS C4P193_HBV/31-76     AC C4P193.1
#=GS G9G8Q8_HBV/31-93     AC G9G8Q8.1
#=GS B4Z476_HBV/2-39      AC B4Z476.1
#=GS Q1MSV2_HBV/31-173    AC Q1MSV2.1
#=GS B3VBA1_HBV/2-183     AC B3VBA1.1
#=GS Q2F513_HBV/31-212    AC Q2F513.1
#=GS Q1MSK9_HBV/31-173    AC Q1MSK9.1
#=GS B6D6F0_HBV/2-113     AC B6D6F0.1
#=GS H9BMV9_HBV/23-181    AC H9BMV9.1
#=GS G1EIH2_HBV/2-153     AC G1EIH2.1
#=GS Q60GU8_HBV/31-71     AC Q60GU8.1
#=GS E0ZNE7_HBV/2-153     AC E0ZNE7.1
#=GS Q507F5_HBV/31-163    AC Q507F5.1
#=GS B5LIK0_HBV/2-162     AC B5LIK0.1
#=GS D2JMV2_HBV/2-183     AC D2JMV2.1
#=GS D6QVZ7_HBV/2-183     AC D6QVZ7.1
#=GS A8R7F9_HBV/31-117    AC A8R7F9.1
#=GS D3YGE2_HBV/2-183     AC D3YGE2.1
#=GS Q1MSP5_HBV/31-173    AC Q1MSP5.1
#=GS B4Z2E5_HBV/2-37      AC B4Z2E5.1
#=GS D3J6G3_HBV/31-70     AC D3J6G3.1
#=GS CAPSD_HBVD3/2-183    AC P03146.1
#=GS D8V9T8_HBV/2-51      AC D8V9T8.1
#=GS B4X6L8_HBV/31-86     AC B4X6L8.1
#=GS B4Z2C1_HBV/31-66     AC B4Z2C1.1
#=GS Q2L5E0_HBV/2-20      AC Q2L5E0.1
#=GS C7DMW5_HBV/2-183     AC C7DMW5.1
#=GS B4Z3Z7_HBV/31-68     AC B4Z3Z7.1
#=GS E5RPM2_HBV/2-183     AC E5RPM2.1
#=GS Q8UYJ2_HBV/2-183     AC Q8UYJ2.1
#=GS Q9WIK6_HBV/31-212    AC Q9WIK6.1
#=GS B4Z2V2_HBV/2-41      AC B4Z2V2.1
#=GS B4Z268_HBV/2-37      AC B4Z268.1
#=GS D6P598_HBV/2-183     AC D6P598.1
#=GS D3XGI0_HBV/2-183     AC D3XGI0.1
#=GS B4Z5U5_HBV/2-42      AC B4Z5U5.1
#=GS C6F5D1_HBV/2-185     AC C6F5D1.1
#=GS Q5G3A1_HBV/2-25      AC Q5G3A1.1
#=GS B4Z4U6_HBV/31-70     AC B4Z4U6.1
#=GS Q45F83_HBV/2-183     AC Q45F83.1
#=GS Q68051_HBV/31-212    AC Q68051.1
#=GS C7AYZ2_HBV/2-185     AC C7AYZ2.1
#=GS B4Z2I4_HBV/2-37      AC B4Z2I4.1
#=GS E3Q0P7_HBV/2-183     AC E3Q0P7.1
#=GS D5LDL4_HBV/2-183     AC D5LDL4.1
#=GS C4P142_HBV/31-76     AC C4P142.1
#=GS D0U3X7_HBV/2-185     AC D0U3X7.1
#=GS H6V879_HBV/31-56     AC H6V879.1
#=GS G1EIG8_HBV/2-153     AC G1EIG8.1
#=GS Q6UE45_HBV/31-212    AC Q6UE45.1
#=GS Q7T445_HBV/31-212    AC Q7T445.1
#=GS Q765D8_HBV/31-214    AC Q765D8.1
#=GS D8VCD2_HBV/2-37      AC D8VCD2.1
#=GS B4Z2F6_HBV/2-37      AC B4Z2F6.1
#=GS Q76B06_HBV/31-212    AC Q76B06.1
#=GS D8VCA8_HBV/31-80     AC D8VCA8.1
#=GS Q5G3F7_HBV/2-25      AC Q5G3F7.1
#=GS I0DG51_HBV/31-212    AC I0DG51.1
#=GS G3XGU7_HBV/2-183     AC G3XGU7.1
#=GS B3VBC6_HBV/2-183     AC B3VBC6.1
#=GS D9U5B0_HBV/111-175   AC D9U5B0.1
#=GS Q0PMK8_HBV/31-107    AC Q0PMK8.1
#=GS B2CZG8_HBV/31-212    AC B2CZG8.1
#=GS D3J5V7_HBV/31-89     AC D3J5V7.1
#=GS D3TK08_HBV/2-89      AC D3TK08.1
#=GS Q7TEE5_HBV/31-163    AC Q7TEE5.1
#=GS Q19SX7_HBV/2-183     AC Q19SX7.1
#=GS Q45F23_HBV/2-183     AC Q45F23.1
#=GS B0FCB1_HBV/2-80      AC B0FCB1.1
#=GS Q9WIK3_HBV/31-212    AC Q9WIK3.1
#=GS Q8VBG0_HBV/2-185     AC Q8VBG0.1
#=GS G1E8K4_HBV/31-212    AC G1E8K4.1
#=GS D8VBQ8_HBV/2-51      AC D8VBQ8.1
#=GS Q45F18_HBV/2-183     AC Q45F18.1
#=GS D7R740_HBV/2-76      AC D7R740.1
#=GS Q2L5F7_HBV/2-24      AC Q2L5F7.1
#=GS B2Y6J3_HBV/2-185     AC B2Y6J3.1
#=GS B2WSQ7_HBV/31-212    AC B2WSQ7.1
#=GS H9BMV7_HBV/1-133     AC H9BMV7.1
#=GS D8VBJ5_HBV/89-138    AC D8VBJ5.1
#=GS E5D5P0_HBV/1-174     AC E5D5P0.1
#=GS D3TKC9_HBV/2-183     AC D3TKC9.1
#=GS B4Z3M7_HBV/2-39      AC B4Z3M7.1
#=GS I0DG50_HBV/31-212    AC I0DG50.1
#=GS D8VC50_HBV/2-51      AC D8VC50.1
#=GS G1C899_HBV/2-183     AC G1C899.1
#=GS B4Z339_HBV/2-37      AC B4Z339.1
#=GS Q7TEE1_HBV/31-163    AC Q7TEE1.1
#=GS Q89719_HBV/31-212    AC Q89719.1
#=GS C0IMV4_HBV/2-185     AC C0IMV4.1
#=GS C4P1V4_HBV/31-76     AC C4P1V4.1
#=GS C4P1H0_HBV/31-76     AC C4P1H0.1
#=GS Q8JSW3_HBV/1-130     AC Q8JSW3.1
#=GS D8VC55_HBV/31-80     AC D8VC55.1
#=GS Q6I6W2_HBV/31-74     AC Q6I6W2.1
#=GS C1JZ00_HBV/2-183     AC C1JZ00.1
#=GS Q80J84_HBV/31-212    AC Q80J84.1
#=GS H6UGC9_HBV/2-183     AC H6UGC9.1
#=GS Q00K81_HBV/2-181     AC Q00K81.1
#=GS Q9E0R7_HBV/2-123     AC Q9E0R7.1
#=GS D8VCM4_HBV/1-148     AC D8VCM4.1
#=GS Q6TYE8_HBV/31-182    AC Q6TYE8.1
#=GS B3VAR1_HBV/2-183     AC B3VAR1.1
#=GS Q60GU5_HBV/31-71     AC Q60GU5.1
#=GS B4Z2Q9_HBV/31-70     AC B4Z2Q9.1
#=GS Q8VBJ9_HBV/2-183     AC Q8VBJ9.1
#=GS D0EYW1_HBV/2-157     AC D0EYW1.1
#=GS Q6X5G4_HBV/1-130     AC Q6X5G4.1
#=GS D8VBZ0_HBV/2-50      AC D8VBZ0.1
#=GS B5ATB3_HBV/2-183     AC B5ATB3.1
#=GS C4P0Y5_HBV/31-76     AC C4P0Y5.1
#=GS Q09KX0_HBV/2-20      AC Q09KX0.1
#=GS B2LRX4_HBV/31-212    AC B2LRX4.1
#=GS Q60GV5_HBV/2-42      AC Q60GV5.1
#=GS Q991J7_HBV/31-212    AC Q991J7.1
#=GS B4Z2L6_HBV/31-70     AC B4Z2L6.1
#=GS D0EE91_HBV/31-214    AC D0EE91.1
#=GS D8VBZ3_HBV/2-51      AC D8VBZ3.1
#=GS CAPSD_HBVB2/2-183    AC P69707.1
#=GS A0A877_HBV/31-212    AC A0A877.1
#=GS Q910W2_HBV/2-183     AC Q910W2.1
#=GS H6UGN1_HBV/2-183     AC H6UGN1.1
#=GS C0LKE1_HBV/2-183     AC C0LKE1.1
#=GS Q9WP95_HBV/101-193   AC Q9WP95.1
#=GS Q8QSC9_HBV/31-212    AC Q8QSC9.1
#=GS D3J5U6_HBV/31-88     AC D3J5U6.1
#=GS Q60H31_HBV/31-71     AC Q60H31.1
#=GS B4Z204_HBV/2-41      AC B4Z204.1
#=GS G9I483_9HEPA/45-293  AC G9I483.1
#=GS B4Z2T6_HBV/31-70     AC B4Z2T6.1
#=GS B4Z6A3_HBV/2-41      AC B4Z6A3.1
#=GS D0EED7_HBV/31-214    AC D0EED7.1
#=GS C7G2Z6_HBV/2-183     AC C7G2Z6.1
#=GS C4P1K9_HBV/31-76     AC C4P1K9.1
#=GS Q45F66_HBV/31-212    AC Q45F66.1
#=GS B4Z5R7_HBV/31-71     AC B4Z5R7.1
#=GS B0B367_HBV/2-183     AC B0B367.1
#=GS C4P161_HBV/31-76     AC C4P161.1
#=GS G1ETU3_HBV/31-212    AC G1ETU3.1
#=GS C4P1D4_HBV/31-76     AC C4P1D4.1
#=GS D7R741_HBV/31-212    AC D7R741.1
#=GS C7DY75_HBV/2-183     AC C7DY75.1
#=GS D4I4R3_HBV/2-185     AC D4I4R3.1
#=GS D4P3T3_HBV/14-194    AC D4P3T3.1
#=GS B7TTJ9_HBV/31-212    AC B7TTJ9.1
#=GS E0ZN99_HBV/31-182    AC E0ZN99.1
#=GS B4Z5S0_HBV/30-70     AC B4Z5S0.1
#=GS Q7THR4_HBV/31-212    AC Q7THR4.1
#=GS B4Z3D9_HBV/2-42      AC B4Z3D9.1
#=GS D9U5K6_HBV/2-183     AC D9U5K6.1
#=GS B5BPT0_HBV/2-183     AC B5BPT0.1
#=GS E5RDA4_HBV/31-212    AC E5RDA4.1
#=GS D3J5R2_HBV/31-57     AC D3J5R2.1
#=GS B4Z5W4_HBV/31-71     AC B4Z5W4.1
#=GS C4P147_HBV/31-76     AC C4P147.1
#=GS Q9E0P7_HBV/2-123     AC Q9E0P7.1
#=GS Q1PCY9_HBV/31-212    AC Q1PCY9.1
#=GS Q8JSW8_HBV/1-130     AC Q8JSW8.1
#=GS Q68040_HBV/31-212    AC Q68040.1
#=GS Q80AH2_HBV/2-183     AC Q80AH2.1
#=GS C4P1N8_HBV/31-76     AC C4P1N8.1
#=GS B4Z2F5_HBV/31-66     AC B4Z2F5.1
#=GS D3YGS6_HBV/2-183     AC D3YGS6.1
#=GS B4Z2P8_HBV/2-41      AC B4Z2P8.1
#=GS E0ZR99_HBV/2-183     AC E0ZR99.1
#=GS C7AYA7_HBV/2-185     AC C7AYA7.1
#=GS Q8JSV7_HBV/1-130     AC Q8JSV7.1
#=GS H6V8A7_HBV/31-56     AC H6V8A7.1
#=GS D3J5W0_HBV/31-73     AC D3J5W0.1
#=GS B4Z3H5_HBV/31-71     AC B4Z3H5.1
#=GS Q5EDT2_HBV/2-183     AC Q5EDT2.1
#=GS D0EZ15_HBV/2-183     AC D0EZ15.1
#=GS D5LBR6_HBV/31-212    AC D5LBR6.1
#=GS B4Z5T4_HBV/2-42      AC B4Z5T4.1
#=GS B4Z3A8_HBV/2-37      AC B4Z3A8.1
#=GS C4P159_HBV/31-76     AC C4P159.1
#=GS B3VAY6_HBV/2-183     AC B3VAY6.1
#=GS D3YGA0_HBV/2-183     AC D3YGA0.1
#=GS Q9IHC9_HBV/31-212    AC Q9IHC9.1
#=GS Q991J8_HBV/31-212    AC Q991J8.1
#=GS B4Z670_HBV/2-41      AC B4Z670.1
#=GS D6R3X0_HBV/31-212    AC D6R3X0.2
#=GS B5B4L3_HBV/2-183     AC B5B4L3.1
#=GS Q67872_HBV/31-212    AC Q67872.1
#=GS D6QW31_HBV/2-183     AC D6QW31.1
#=GS Q67894_HBV/31-214    AC Q67894.1
#=GS D3GIM0_HBV/2-183     AC D3GIM0.1
#=GS Q2F4Z8_HBV/31-212    AC Q2F4Z8.1
#=GS A9PLE2_HBV/1-39      AC A9PLE2.1
#=GS Q5G3J4_HBV/31-54     AC Q5G3J4.1
#=GS D3J5X7_HBV/31-88     AC D3J5X7.1
#=GS C7AYV8_HBV/2-185     AC C7AYV8.1
#=GS Q9J1L7_HBV/2-183     AC Q9J1L7.1
#=GS B4YLK6_HBV/31-212    AC B4YLK6.1
#=GS D3J5Z7_HBV/31-79     AC D3J5Z7.1
#=GS G9G9C4_HBV/2-183     AC G9G9C4.1
#=GS B1NYC1_HBV/2-183     AC B1NYC1.1
#=GS Q507G5_HBV/31-163    AC Q507G5.1
#=GS D0EDZ3_HBV/2-185     AC D0EDZ3.1
#=GS Q91EH4_HBV/2-185     AC Q91EH4.1
#=GS C4P1P1_HBV/31-76     AC C4P1P1.1
#=GS Q91A66_HBV/31-66     AC Q91A66.1
#=GS Q7TED7_HBV/31-163    AC Q7TED7.1
#=GS CAPSD_HBVC2/2-183    AC P0C6H4.1
#=GS B4Z2M2_HBV/31-70     AC B4Z2M2.1
#=GS Q8VBI3_HBV/2-183     AC Q8VBI3.1
#=GS H6V8D1_HBV/31-56     AC H6V8D1.1
#=GS Q917I3_HBV/2-183     AC Q917I3.1
#=GS Q80JA2_HBV/2-183     AC Q80JA2.1
#=GS A6MGB3_HBV/2-183     AC A6MGB3.1
#=GS B6D6D2_HBV/2-67      AC B6D6D2.1
#=GS Q5R2P1_HBV/31-212    AC Q5R2P1.1
#=GS B5BPW1_HBV/2-183     AC B5BPW1.1
#=GS G0YVM6_HBV/2-183     AC G0YVM6.1
#=GS Q60GZ1_HBV/31-71     AC Q60GZ1.1
#=GS D6P595_HBV/2-183     AC D6P595.1
#=GS C0LKP9_HBV/2-183     AC C0LKP9.1
#=GS F4MJH7_HBV/31-81     AC F4MJH7.1
#=GS Q910L4_HBV/31-212    AC Q910L4.1
#=GS B4Z4P9_HBV/2-41      AC B4Z4P9.1
#=GS G0Z307_HBV/2-121     AC G0Z307.1
#=GS H6UN83_HBV/2-183     AC H6UN83.1
#=GS B4Z4Q7_HBV/2-41      AC B4Z4Q7.1
#=GS Q765F0_HBV/31-214    AC Q765F0.1
#=GS B4Z308_HBV/31-66     AC B4Z308.1
#=GS G8H3F9_HBV/2-131     AC G8H3F9.1
#=GS D3J5P2_HBV/31-57     AC D3J5P2.1
#=GS Q1MST3_HBV/31-173    AC Q1MST3.1
#=GS Q1MSL2_HBV/20-162    AC Q1MSL2.1
#=GS C7AYZ8_HBV/2-185     AC C7AYZ8.1
#=GS B4Z4K2_HBV/31-70     AC B4Z4K2.1
#=GS B5B4M9_HBV/2-183     AC B5B4M9.1
#=GS D3J6F1_HBV/31-70     AC D3J6F1.1
#=GS O39876_HBV/1-165     AC O39876.1
#=GS C4P1A7_HBV/31-76     AC C4P1A7.1
#=GS CAPSD_WHV1/2-188     AC P69709.1
#=GS H6V5T7_HBV/2-183     AC H6V5T7.1
#=GS C4P0Z3_HBV/31-76     AC C4P0Z3.1
#=GS Q4FDE4_HBV/31-212    AC Q4FDE4.1
#=GS D3J626_HBV/31-88     AC D3J626.1
#=GS D3J666_HBV/31-68     AC D3J666.1
#=GS B7TU16_HBV/31-212    AC B7TU16.1
#=GS Q7T7X5_HBV/31-212    AC Q7T7X5.1
#=GS B5ATF9_HBV/2-80      AC B5ATF9.1
#=GS Q99HT3_HBV/31-212    AC Q99HT3.1
#=GS D3TIJ8_HBV/2-183     AC D3TIJ8.1
#=GS Q7TEC4_HBV/31-163    AC Q7TEC4.1
#=GS C7DNL3_HBV/31-212    AC C7DNL3.1
#=GS E3Q0P6_HBV/31-212    AC E3Q0P6.1
#=GS A9PLH1_HBV/1-39      AC A9PLH1.1
#=GS A7L354_HBV/2-161     AC A7L354.1
#=GS Q60GW4_HBV/31-71     AC Q60GW4.1
#=GS B4Z1V2_HBV/31-70     AC B4Z1V2.1
#=GS Q9E0S5_HBV/2-123     AC Q9E0S5.1
#=GS D8VB68_HBV/2-51      AC D8VB68.1
#=GS B7TTX3_HBV/31-212    AC B7TTX3.1
#=GS B4Z1M3_HBV/31-71     AC B4Z1M3.1
#=GS B4Z257_HBV/31-70     AC B4Z257.1
#=GS Q2L5G8_HBV/2-24      AC Q2L5G8.1
#=GS B4Z3G9_HBV/31-71     AC B4Z3G9.1
#=GS B2CSD2_HBV/2-183     AC B2CSD2.1
#=GS A1KR49_HBV/2-25      AC A1KR49.1
#=GS B4Z5X3_HBV/31-71     AC B4Z5X3.1
#=GS C1K1U1_HBV/31-120    AC C1K1U1.1
#=GS Q58VZ5_HBV/31-212    AC Q58VZ5.1
#=GS G8Z911_HBV/2-139     AC G8Z911.1
#=GS Q5G3H6_HBV/2-25      AC Q5G3H6.1
#=GS C4P105_HBV/31-76     AC C4P105.1
#=GS Q8AYY3_HBV/31-117    AC Q8AYY3.1
#=GS D3GIK8_HBV/2-183     AC D3GIK8.1
#=GS A0FDK3_HBV/2-81      AC A0FDK3.1
#=GS Q2L590_HBV/2-20      AC Q2L590.1
#=GS HBEAG_HBVD5/31-212   AC P0C6I1.1
#=GS E0ZP56_HBV/2-110     AC E0ZP56.1
#=GS D8VBN2_HBV/2-51      AC D8VBN2.1
#=GS E3Q0L3_HBV/2-183     AC E3Q0L3.1
#=GS B4Z2N7_HBV/31-70     AC B4Z2N7.1
#=GS Q60GX1_HBV/31-71     AC Q60GX1.1
#=GS G1C8S1_HBV/2-183     AC G1C8S1.1
#=GS D3J608_HBV/31-88     AC D3J608.1
#=GS HBEAG_DHBV3/45-305   AC P0C6J9.1
#=GS Q6XGP2_HBV/2-185     AC Q6XGP2.1
#=GS B4Z3Z3_HBV/2-39      AC B4Z3Z3.1
#=GS Q77N75_HBVF4/2-183   AC Q77N75.1
#=GS C1JYZ8_HBV/2-183     AC C1JYZ8.1
#=GS Q60H23_HBV/31-71     AC Q60H23.1
#=GS F5C1P8_HBV/2-183     AC F5C1P8.1
#=GS Q7TED8_HBV/31-163    AC Q7TED8.1
#=GS D3TIL3_HBV/2-183     AC D3TIL3.1
#=GS C4P0X2_HBV/31-76     AC C4P0X2.1
#=GS B4Z3Z5_HBV/31-68     AC B4Z3Z5.1
#=GS D3J5N3_HBV/31-70     AC D3J5N3.1
#=GS H6V8A9_HBV/31-56     AC H6V8A9.1
#=GS E0ZP28_HBV/31-139    AC E0ZP28.1
#=GS B4X6I7_HBV/31-87     AC B4X6I7.1
#=GS B4X6M0_HBV/31-86     AC B4X6M0.1
#=GS Q2TJG2_HBV/2-131     AC Q2TJG2.1
#=GS C4P172_HBV/31-76     AC C4P172.1
#=GS D5MSF8_HBV/31-212    AC D5MSF8.1
#=GS Q68048_HBV/2-183     AC Q68048.1
#=GS Q4FD92_HBV/31-212    AC Q4FD92.1
#=GS H9BMR6_HBV/2-168     AC H9BMR6.1
#=GS B5B4A6_HBV/2-183     AC B5B4A6.1
#=GS Q5G3G5_HBV/31-54     AC Q5G3G5.1
#=GS E5CZ06_HBV/2-183     AC E5CZ06.1
#=GS Q8QP39_HBV/1-132     AC Q8QP39.1
#=GS B5M549_HBV/31-212    AC B5M549.1
#=GS Q30BG8_HBV/31-113    AC Q30BG8.1
#=GS Q1MSN7_HBV/31-141    AC Q1MSN7.1
#=GS H2ERJ7_HBV/2-183     AC H2ERJ7.1
#=GS B4Z289_HBV/2-37      AC B4Z289.1
#=GS Q2EGE5_HBV/31-99     AC Q2EGE5.1
#=GS Q80AH0_HBV/2-183     AC Q80AH0.1
#=GS B4Z478_HBV/31-68     AC B4Z478.1
#=GS B5M5Q4_HBV/31-212    AC B5M5Q4.1
#=GS Q6IT66_9HEPA/39-225  AC Q6IT66.1
#=GS G0Z2X8_HBV/2-121     AC G0Z2X8.1
#=GS G9G9U9_HBV/2-183     AC G9G9U9.1
#=GS B4Z463_HBV/31-68     AC B4Z463.1
#=GS B4Z5U3_HBV/31-71     AC B4Z5U3.1
#=GS D3J652_HBV/31-88     AC D3J652.1
#=GS B3VB82_HBV/31-212    AC B3VB82.1
#=GS B3V3S0_HBV/31-212    AC B3V3S0.1
#=GS C7DN02_HBV/31-212    AC C7DN02.1
#=GS Q8JSV5_HBV/1-130     AC Q8JSV5.1
#=GS Q91SY2_HBV/31-212    AC Q91SY2.1
#=GS C7DNE1_HBV/2-182     AC C7DNE1.1
#=GS C3W4E2_HBV/31-212    AC C3W4E2.1
#=GS D8VBS8_HBV/2-51      AC D8VBS8.1
#=GS Q91IP4_HBV/31-212    AC Q91IP4.1
#=GS D3J5T8_HBV/31-88     AC D3J5T8.1
#=GS B6ULG7_HBV/31-90     AC B6ULG7.1
#=GS D8VBR9_HBV/2-51      AC D8VBR9.1
#=GS Q68RP4_HBV/2-183     AC Q68RP4.1
#=GS D3J5Q2_HBV/31-57     AC D3J5Q2.1
#=GS D8VBK2_HBV/2-51      AC D8VBK2.1
#=GS Q9E0U5_HBV/31-152    AC Q9E0U5.1
#=GS B2LSK8_HBV/2-183     AC B2LSK8.1
#=GS G1E8E6_HBV/2-183     AC G1E8E6.1
#=GS B4Z1L2_HBV/31-71     AC B4Z1L2.1
#=GS Q67903_HBV/2-166     AC Q67903.1
#=GS D2JMZ7_HBV/2-183     AC D2JMZ7.1
#=GS B9VK81_HBV/31-212    AC B9VK81.1
#=GS B4Z448_HBV/31-68     AC B4Z448.1
#=GS E0ZP21_HBV/31-139    AC E0ZP21.1
#=GS B4Z4P0_HBV/2-41      AC B4Z4P0.1
#=GS H6V5Q1_HBV/2-183     AC H6V5Q1.1
#=GS B4ZYW7_HBV/2-183     AC B4ZYW7.1
#=GS G1EIH4_HBV/2-153     AC G1EIH4.1
#=GS C7DSN0_HBV/31-212    AC C7DSN0.1
#=GS Q1MSW3_HBV/31-173    AC Q1MSW3.1
#=GS D6P5A1_HBV/2-183     AC D6P5A1.1
#=GS B5B4L2_HBV/31-212    AC B5B4L2.1
#=GS Q2L4J7_HBV/31-214    AC Q2L4J7.1
#=GS Q2L5F6_HBV/2-23      AC Q2L5F6.1
#=GS B2MUE1_HBV/31-212    AC B2MUE1.1
#=GS D3J6H1_HBV/31-69     AC D3J6H1.1
#=GS Q68010_HBV/31-212    AC Q68010.1
#=GS B4Z3G6_HBV/31-71     AC B4Z3G6.1
#=GS A9PLI0_HBV/1-39      AC A9PLI0.1
#=GS G1E7H7_HBV/2-183     AC G1E7H7.1
#=GS D3TK80_HBV/31-212    AC D3TK80.1
#=GS Q1XHG6_HBV/31-214    AC Q1XHG6.1
#=GS B6D6B2_HBV/31-211    AC B6D6B2.1
#=GS H6UGP9_HBV/2-183     AC H6UGP9.1
#=GS D8VB80_HBV/2-183     AC D8VB80.1
#=GS Q60H20_HBV/2-42      AC Q60H20.1
#=GS C3W3R7_HBV/2-183     AC C3W3R7.1
#=GS B0YK39_HBV/2-183     AC B0YK39.1
#=GS F1CFD4_HBV/31-212    AC F1CFD4.1
#=GS C3W4B1_HBV/2-183     AC C3W4B1.1
#=GS B4Z1E9_HBV/2-40      AC B4Z1E9.1
#=GS B5TXV3_HBV/2-183     AC B5TXV3.1
#=GS Q1MSL0_HBV/31-173    AC Q1MSL0.1
#=GS B4Z303_HBV/31-66     AC B4Z303.1
#=GS E0ZP15_HBV/31-57     AC E0ZP15.1
#=GS Q4FDI4_HBV/31-212    AC Q4FDI4.1
#=GS B4Z3E1_HBV/31-71     AC B4Z3E1.1
#=GS Q2L4I8_HBV/31-214    AC Q2L4I8.1
#=GS Q91IP2_HBV/144-325   AC Q91IP2.1
#=GS C1KTA5_HBV/31-210    AC C1KTA5.1
#=GS B0YK71_HBV/2-183     AC B0YK71.1
#=GS D8VBA1_HBV/2-51      AC D8VBA1.1
#=GS Q6X5G0_HBV/1-130     AC Q6X5G0.1
#=GS D9U589_HBV/2-183     AC D9U589.1
#=GS D7R730_HBV/2-183     AC D7R730.1
#=GS B4Z2M8_HBV/31-70     AC B4Z2M8.1
#=GS D3J5V4_HBV/31-88     AC D3J5V4.1
#=GS C7DM36_HBV/31-212    AC C7DM36.1
#=GS B5TXM3_HBV/2-183     AC B5TXM3.1
#=GS A7L353_HBV/2-161     AC A7L353.1
#=GS C3W499_HBV/2-183     AC C3W499.1
#=GS B4Z1L6_HBV/2-42      AC B4Z1L6.1
#=GS Q8JXG8_HBV/2-185     AC Q8JXG8.1
#=GS B4Z3D8_HBV/31-71     AC B4Z3D8.1
#=GS G3E5I3_HBV/31-212    AC G3E5I3.1
#=GS C7DMB6_HBV/2-183     AC C7DMB6.1
#=GS Q917J4_HBV/31-212    AC Q917J4.1
#=GS B4Z3X7_HBV/31-68     AC B4Z3X7.1
#=GS D6QVQ2_HBV/2-183     AC D6QVQ2.1
#=GS Q45F50_HBV/2-183     AC Q45F50.1
#=GS A6MGA7_HBV/2-183     AC A6MGA7.1
#=GS D6QVM0_HBV/2-183     AC D6QVM0.1
#=GS B4Z2W1_HBV/2-41      AC B4Z2W1.1
#=GS C9W201_HBV/2-183     AC C9W201.1
#=GS Q09KX3_HBV/2-20      AC Q09KX3.1
#=GS E0ZNW5_HBV/2-20      AC E0ZNW5.1
#=GS B4Z4J2_HBV/2-41      AC B4Z4J2.1
#=GS B4Z1K6_HBV/31-71     AC B4Z1K6.1
#=GS Q5Q0Z3_HBV/2-183     AC Q5Q0Z3.1
#=GS B0B352_HBV/2-183     AC B0B352.1
#=GS Q09KV7_HBV/2-20      AC Q09KV7.1
#=GS Q6I6Q6_HBV/31-74     AC Q6I6Q6.1
#=GS B4Z2T1_HBV/31-70     AC B4Z2T1.1
#=GS D3TIG0_HBV/2-183     AC D3TIG0.1
#=GS C7DSN7_HBV/31-201    AC C7DSN7.1
#=GS Q2TJE4_HBV/31-212    AC Q2TJE4.1
#=GS C1KTA1_HBV/31-210    AC C1KTA1.1
#=GS Q8QP27_HBV/1-130     AC Q8QP27.1
#=GS B4Z5V3_HBV/2-41      AC B4Z5V3.1
#=GS B4Z2W3_HBV/31-70     AC B4Z2W3.1
#=GS B0FCQ7_HBV/2-183     AC B0FCQ7.1
#=GS D3J5V1_HBV/31-87     AC D3J5V1.1
#=GS B7TU94_HBV/2-183     AC B7TU94.1
#=GS B4Z3S7_HBV/31-68     AC B4Z3S7.1
#=GS Q80GW7_HBV/2-86      AC Q80GW7.1
#=GS Q1MSQ6_HBV/31-173    AC Q1MSQ6.1
#=GS G0Z308_HBV/2-121     AC G0Z308.1
#=GS C7DSN8_HBV/2-172     AC C7DSN8.1
#=GS Q80H39_HBV/2-183     AC Q80H39.1
#=GS Q2TJD8_HBV/31-214    AC Q2TJD8.1
#=GS B4Z3G3_HBV/31-71     AC B4Z3G3.1
#=GS Q9QRR2_HBV/2-64      AC Q9QRR2.1
#=GS Q6RSF8_9HEPA/2-262   AC Q6RSF8.1
#=GS Q89247_9HEPA/2-188   AC Q89247.1
#=GS B4Z3D3_HBV/2-37      AC B4Z3D3.1
#=GS Q09KY8_HBV/2-20      AC Q09KY8.1
#=GS C7DM64_HBV/2-183     AC C7DM64.1
#=GS C4P1H2_HBV/31-76     AC C4P1H2.1
#=GS D8VC73_HBV/2-51      AC D8VC73.1
#=GS D3J5X1_HBV/31-79     AC D3J5X1.1
#=GS Q9QB20_HBV/2-183     AC Q9QB20.1
#=GS Q1MSJ9_HBV/31-173    AC Q1MSJ9.1
#=GS D0EEL6_HBV/31-214    AC D0EEL6.1
#=GS F5C093_HBV/2-183     AC F5C093.1
#=GS B4Z2L1_HBV/31-70     AC B4Z2L1.1
#=GS B4Z3T1_HBV/2-39      AC B4Z3T1.1
#=GS Q9E0N7_HBV/31-152    AC Q9E0N7.1
#=GS Q80J99_HBV/2-183     AC Q80J99.1
#=GS E5KUG1_9HEPA/45-305  AC E5KUG1.1
#=GS Q9E0Q7_HBV/2-123     AC Q9E0Q7.1
#=GS G1EIJ8_HBV/2-153     AC G1EIJ8.1
#=GS B4Z3U0_HBV/2-39      AC B4Z3U0.1
#=GS D0EEC4_HBV/31-214    AC D0EEC4.1
#=GS Q8QSA7_HBV/31-212    AC Q8QSA7.1
#=GS D8VCF5_HBV/2-36      AC D8VCF5.1
#=GS G1C8M3_HBV/2-183     AC G1C8M3.1
#=GS B5BPS6_HBV/31-212    AC B5BPS6.1
#=GS F1AEV8_HBV/14-195    AC F1AEV8.1
#=GS Q3LTX1_HBV/2-183     AC Q3LTX1.1
#=GS C4P1P2_HBV/31-76     AC C4P1P2.1
#=GS B4Z372_HBV/2-37      AC B4Z372.1
#=GS Q6I6W6_HBV/31-74     AC Q6I6W6.1
#=GS C0LKK8_HBV/2-183     AC C0LKK8.1
#=GS I0DG30_HBV/31-212    AC I0DG30.1
#=GS D8V9V1_HBV/31-80     AC D8V9V1.1
#=GS F2WS99_HBV/31-212    AC F2WS99.1
#=GS B4Z2J5_HBV/2-37      AC B4Z2J5.1
#=GS I0DG79_HBV/31-212    AC I0DG79.1
#=GS B4Z638_HBV/31-70     AC B4Z638.1
#=GS Q6J323_HBV/31-214    AC Q6J323.1
#=GS G0Z2Y8_HBV/2-121     AC G0Z2Y8.1
#=GS D3J663_HBV/31-79     AC D3J663.1
#=GS D8VCF8_HBV/2-37      AC D8VCF8.1
#=GS B4Z3W6_HBV/2-39      AC B4Z3W6.1
#=GS B4Z3R0_HBV/2-39      AC B4Z3R0.1
#=GS CAPSD_HPBDB/2-262    AC P0C6K3.1
#=GS D2JMW5_HBV/2-183     AC D2JMW5.1
#=GS E0ZND8_HBV/31-182    AC E0ZND8.1
#=GS G1C979_HBV/2-183     AC G1C979.1
#=GS D3J5R7_HBV/31-57     AC D3J5R7.1
#=GS Q9E0W5_HBV/2-123     AC Q9E0W5.1
#=GS D3J5Z3_HBV/31-79     AC D3J5Z3.1
#=GS E5RN28_HBV/1-162     AC E5RN28.1
#=GS Q8QSD3_HBV/31-212    AC Q8QSD3.1
#=GS C4P123_HBV/31-76     AC C4P123.1
#=GS B4X6L6_HBV/31-87     AC B4X6L6.1
#=GS H6V883_HBV/31-56     AC H6V883.1
#=GS D2JMD4_HBV/31-212    AC D2JMD4.1
#=GS D3J660_HBV/31-79     AC D3J660.1
#=GS B0FCS7_HBV/2-183     AC B0FCS7.1
#=GS Q80JB0_HBV/2-79      AC Q80JB0.1
#=GS HBEAG_HHBV/45-305    AC P13845.1
#=GS B0YK45_HBV/2-183     AC B0YK45.1
#=GS D8VBS4_HBV/31-212    AC D8VBS4.1
#=GS Q3LTZ6_HBV/2-183     AC Q3LTZ6.1
#=GS A9CM32_HBV/2-183     AC A9CM32.1
#=GS Q60GY9_HBV/31-71     AC Q60GY9.1
#=GS Q9QMJ4_HBV/31-212    AC Q9QMJ4.1
#=GS B4Z4S9_HBV/2-41      AC B4Z4S9.1
#=GS Q80GX1_HBV/31-210    AC Q80GX1.1
#=GS Q6I6U6_HBV/31-71     AC Q6I6U6.1
#=GS E0ZP45_HBV/2-110     AC E0ZP45.1
#=GS G1E8F2_HBV/2-183     AC G1E8F2.1
#=GS E3Q0I1_HBV/2-183     AC E3Q0I1.1
#=GS G1EIH7_HBV/2-153     AC G1EIH7.1
#=GS F5C1C3_HBV/2-173     AC F5C1C3.1
#=GS F5C1S6_HBV/29-212    AC F5C1S6.1
#=GS Q917I1_HBV/2-183     AC Q917I1.1
#=GS I0DG82_HBV/31-212    AC I0DG82.1
#=GS G8H3F7_HBV/2-131     AC G8H3F7.1
#=GS B3VAY2_HBV/2-183     AC B3VAY2.1
#=GS CAPSD_HBVB3/2-183    AC Q9QAB9.1
#=GS Q8JSW2_HBV/1-130     AC Q8JSW2.1
#=GS G0Z2W8_HBV/2-121     AC G0Z2W8.1
#=GS C7AYW4_HBV/2-185     AC C7AYW4.1
#=GS C3W3Z0_HBV/2-183     AC C3W3Z0.1
#=GS C7DN74_HBV/2-183     AC C7DN74.1
#=GS H6UG98_HBV/2-183     AC H6UG98.1
#=GS G1C8F4_HBV/2-183     AC G1C8F4.1
#=GS B4Z400_HBV/31-68     AC B4Z400.1
#=GS C9WD99_HBV/31-212    AC C9WD99.1
#=GS Q2VAD4_9HEPA/45-305  AC Q2VAD4.1
#=GS Q2PWX7_HBV/2-185     AC Q2PWX7.1
#=GS C1KTC3_HBV/31-210    AC C1KTC3.1
#=GS D3J6D1_HBV/31-70     AC D3J6D1.1
#=GS B4Z3W2_HBV/31-68     AC B4Z3W2.1
#=GS Q5U7L1_HBV/2-134     AC Q5U7L1.1
#=GS G1C8Y4_HBV/2-183     AC G1C8Y4.1
#=GS C4P0Y2_HBV/31-76     AC C4P0Y2.1
#=GS C3W4D6_HBV/2-185     AC C3W4D6.1
#=GS B4Z1U6_HBV/31-80     AC B4Z1U6.1
#=GS B8PTD6_HBV/31-212    AC B8PTD6.1
#=GS B7TV52_HBV/2-183     AC B7TV52.1
#=GS D0EZ03_HBV/2-183     AC D0EZ03.1
#=GS Q6XEA1_HBV/2-183     AC Q6XEA1.1
#=GS Q60GU6_HBV/31-71     AC Q60GU6.1
#=GS C3W475_HBV/2-183     AC C3W475.1
#=GS Q8JJN8_HBV/33-70     AC Q8JJN8.1
#=GS HBEAG_WHV5/32-218    AC P0C6J6.1
#=GS Q2L5A1_HBV/2-20      AC Q2L5A1.1
#=GS B4Z237_HBV/31-70     AC B4Z237.1
#=GS B5LXZ7_HBV/2-183     AC B5LXZ7.1
#=GS G1E7Q7_HBV/31-212    AC G1E7Q7.1
#=GS B7TTA2_HBV/2-183     AC B7TTA2.1
#=GS Q60GW7_HBV/31-71     AC Q60GW7.1
#=GS F1CFD5_HBV/2-183     AC F1CFD5.1
#=GS B4Z464_HBV/2-39      AC B4Z464.1
#=GS Q77BG9_HBV/1-96      AC Q77BG9.1
#=GS C4P1E0_HBV/31-76     AC C4P1E0.1
#=GS Q67995_HBV/2-181     AC Q67995.1
#=GS D4QGI6_HBV/31-212    AC D4QGI6.1
#=GS D6P5A3_HBV/2-183     AC D6P5A3.1
#=GS D3J636_HBV/31-89     AC D3J636.1
#=GS C7AYY0_HBV/2-185     AC C7AYY0.1
#=GS O42034_HBV/2-183     AC O42034.1
#=GS E9L2M5_HBV/2-185     AC E9L2M5.1
#=GS C4P1P3_HBV/31-76     AC C4P1P3.1
#=GS B4Z2A8_HBV/31-66     AC B4Z2A8.1
#=GS G0Z301_HBV/2-121     AC G0Z301.1
#=GS C4P1R8_HBV/31-76     AC C4P1R8.1
#=GS B4Z1K3_HBV/31-71     AC B4Z1K3.1
#=GS Q77QZ3_HBVB5/31-212  AC Q77QZ3.1
#=GS CAPSD_HBVA3/2-185    AC P03148.3
#=GS D9U5B1_HBV/2-84      AC D9U5B1.1
#=GS Q1MSU3_HBV/31-173    AC Q1MSU3.1
#=GS Q9QAW5_HBV/31-212    AC Q9QAW5.1
#=GS B4Z431_HBV/2-39      AC B4Z431.1
#=GS Q1MSP1_HBV/31-173    AC Q1MSP1.1
#=GS Q805R2_HBV/2-183     AC Q805R2.1
#=GS D3J614_HBV/31-91     AC D3J614.1
#=GS D3GIK0_HBV/2-183     AC D3GIK0.1
#=GS E0ZP74_HBV/2-110     AC E0ZP74.1
#=GS C4P1C6_HBV/31-76     AC C4P1C6.1
#=GS E0ZN77_HBV/31-182    AC E0ZN77.1
#=GS A1ILJ7_HBV/2-183     AC A1ILJ7.1
#=GS B4Z200_HBV/31-70     AC B4Z200.1
#=GS B0FCD8_HBV/31-212    AC B0FCD8.1
#=GS C1K1F7_HBV/2-181     AC C1K1F7.1
#=GS Q7TDR1_HBV/2-183     AC Q7TDR1.1
#=GS B5ATD5_HBV/31-115    AC B5ATD5.1
#=GS B4Z3E8_HBV/2-42      AC B4Z3E8.1
#=GS Q8QSC6_HBV/31-212    AC Q8QSC6.1
#=GS C1KT87_HBV/31-210    AC C1KT87.1
#=GS D8VCD5_HBV/2-36      AC D8VCD5.1
#=GS F5C040_HBV/31-53     AC F5C040.1
#=GS B4Z229_HBV/2-41      AC B4Z229.1
#=GS Q60H32_HBV/31-71     AC Q60H32.1
#=GS G1C8G8_HBV/2-183     AC G1C8G8.1
#=GS B3VAZ1_HBV/2-183     AC B3VAZ1.1
#=GS I0DG73_HBV/31-212    AC I0DG73.1
#=GS Q60H40_HBV/31-71     AC Q60H40.1
#=GS A0A865_HBV/31-212    AC A0A865.1
#=GS B4Z1J7_HBV/31-71     AC B4Z1J7.1
#=GS G1E8M4_HBV/2-183     AC G1E8M4.1
#=GS I0DG56_HBV/96-212    AC I0DG56.1
#=GS Q8QSC3_HBV/31-212    AC Q8QSC3.1
#=GS B4Z5X9_HBV/31-71     AC B4Z5X9.1
#=GS B4ZYV4_HBV/31-212    AC B4ZYV4.1
#=GS D5LCS7_HBV/31-212    AC D5LCS7.1
#=GS B3VAK8_HBV/2-183     AC B3VAK8.1
#=GS Q765B7_HBV/31-214    AC Q765B7.1
#=GS B5BPQ2_HBV/31-212    AC B5BPQ2.1
#=GS Q2EGG2_HBV/31-99     AC Q2EGG2.1
#=GS B3V8T8_HBV/2-183     AC B3V8T8.1
#=GS E0ZP18_HBV/31-139    AC E0ZP18.1
#=GS B4Z5U6_HBV/31-71     AC B4Z5U6.1
#=GS A4ZRF6_HBV/31-163    AC A4ZRF6.1
#=GS D8VBI6_HBV/2-99      AC D8VBI6.1
#=GS B4Z1F2_HBV/2-40      AC B4Z1F2.1
#=GS A4ZRF2_HBV/31-163    AC A4ZRF2.1
#=GS A9PLH5_HBV/1-39      AC A9PLH5.1
#=GS D5MRS5_HBV/2-100     AC D5MRS5.1
#=GS E0ZNG4_HBV/2-147     AC E0ZNG4.1
#=GS D2JMR3_HBV/31-212    AC D2JMR3.1
#=GS C6F574_HBV/31-214    AC C6F574.1
#=GS C4P1V5_HBV/31-76     AC C4P1V5.1
#=GS H6V5Q9_HBV/2-183     AC H6V5Q9.1
#=GS G0Z2Z9_HBV/2-121     AC G0Z2Z9.1
#=GS B7TUJ2_HBV/2-181     AC B7TUJ2.1
#=GS Q09KZ7_HBV/2-20      AC Q09KZ7.1
#=GS Q2L5I1_HBV/2-24      AC Q2L5I1.1
#=GS H6UGG6_HBV/2-183     AC H6UGG6.1
#=GS D8VBE4_HBV/2-51      AC D8VBE4.1
#=GS Q4FDL5_HBV/31-212    AC Q4FDL5.1
#=GS D2JMI2_HBV/2-183     AC D2JMI2.1
#=GS Q9WP56_HBV/83-135    AC Q9WP56.1
#=GS D6P5C1_HBV/2-185     AC D6P5C1.1
#=GS B9VKV8_HBV/31-212    AC B9VKV8.1
#=GS C1K204_HBV/2-101     AC C1K204.1
#=GS B7TUA7_HBV/31-212    AC B7TUA7.1
#=GS B7TUT6_HBV/2-183     AC B7TUT6.1
#=GS D2JMV6_HBV/2-183     AC D2JMV6.1
#=GS D8VC63_HBV/31-54     AC D8VC63.1
#=GS B1Q2W9_HBVDR/31-212  AC B1Q2W9.1
#=GS Q91SZ2_HBV/31-212    AC Q91SZ2.1
#=GS B4Z277_HBV/2-37      AC B4Z277.1
#=GS B4Z452_HBV/2-39      AC B4Z452.1
#=GS B1NYB4_HBV/2-183     AC B1NYB4.1
#=GS B4Z329_HBV/31-66     AC B4Z329.1
#=GS C4P181_HBV/31-76     AC C4P181.1
#=GS Q9QB07_HBV/2-183     AC Q9QB07.1
#=GS B4Z246_HBV/2-41      AC B4Z246.1
#=GS B4Z3A4_HBV/31-66     AC B4Z3A4.1
#=GS Q7TF67_HBV/31-212    AC Q7TF67.1
#=GS B4Z2H2_HBV/2-37      AC B4Z2H2.1
#=GS D3GIJ6_HBV/2-183     AC D3GIJ6.1
#=GS Q0PMK1_HBV/31-106    AC Q0PMK1.1
#=GS F5HRF3_HBV/31-212    AC F5HRF3.1
#=GS B3VAR3_HBV/2-183     AC B3VAR3.1
#=GS D2JMK4_HBV/2-183     AC D2JMK4.1
#=GS B6D6E9_HBV/31-142    AC B6D6E9.1
#=GS D3J6E4_HBV/31-70     AC D3J6E4.1
#=GS G1C8I2_HBV/2-183     AC G1C8I2.1
#=GS D3J689_HBV/31-71     AC D3J689.1
#=GS D9U5N2_HBV/2-183     AC D9U5N2.1
#=GS Q30BH3_HBV/31-113    AC Q30BH3.1
#=GS G8H3G6_HBV/2-131     AC G8H3G6.1
#=GS Q9QN53_HBV/2-183     AC Q9QN53.1
#=GS Q9E6T4_HBV/31-212    AC Q9E6T4.1
#=GS C1K1J6_HBV/31-212    AC C1K1J6.1
#=GS C7AYD5_HBV/31-214    AC C7AYD5.1
#=GS B1N1A8_HBV/2-183     AC B1N1A8.1
#=GS I0DG65_HBV/28-209    AC I0DG65.1
#=GS D3J5L8_HBV/31-57     AC D3J5L8.1
#=GS B5ATA2_HBV/2-183     AC B5ATA2.1
#=GS Q06AM7_HBV/31-212    AC Q06AM7.1
#=GS B4Z629_HBV/31-70     AC B4Z629.1
#=GS Q5DW10_HBV/31-212    AC Q5DW10.1
#=GS D3YGN9_HBV/2-183     AC D3YGN9.1
#=GS B4Z1X1_HBV/2-41      AC B4Z1X1.1
#=GS B5TXV2_HBV/31-212    AC B5TXV2.1
#=GS D3J6E9_HBV/31-70     AC D3J6E9.1
#=GS D0E693_HBV/31-212    AC D0E693.1
#=GS C4P1G5_HBV/31-76     AC C4P1G5.1
#=GS C1K1B7_HBV/31-90     AC C1K1B7.1
#=GS B0FD88_HBV/31-212    AC B0FD88.1
#=GS B4Z336_HBV/2-37      AC B4Z336.1
#=GS C4P1I3_HBV/31-76     AC C4P1I3.1
#=GS D8VBH3_HBV/31-53     AC D8VBH3.1
#=GS B0B366_HBV/2-183     AC B0B366.1
#=GS B4Z1Y8_HBV/31-70     AC B4Z1Y8.1
#=GS B2LW85_HBV/2-150     AC B2LW85.1
#=GS C4P1M6_HBV/31-76     AC C4P1M6.1
#=GS D8VBG1_HBV/31-53     AC D8VBG1.1
#=GS D4HMY6_HBV/1-60      AC D4HMY6.1
#=GS D8VB79_HBV/31-212    AC D8VB79.1
#=GS Q8B6N1_HBV/31-212    AC Q8B6N1.1
#=GS D8VBD9_HBV/2-51      AC D8VBD9.1
#=GS Q77NU0_HBV/31-212    AC Q77NU0.1
#=GS Q9E8K3_HBV/2-183     AC Q9E8K3.1
#=GS B4Z4S0_HBV/2-41      AC B4Z4S0.1
#=GS D5LCS8_HBV/2-183     AC D5LCS8.1
#=GS Q5G3J9_HBV/2-25      AC Q5G3J9.1
#=GS H6V5L9_HBV/2-183     AC H6V5L9.1
#=GS D8VBZ9_HBV/2-51      AC D8VBZ9.1
#=GS B4Z437_HBV/2-39      AC B4Z437.1
#=GS Q7T3Z0_HBV/84-157    AC Q7T3Z0.1
#=GS H2ERD0_HBV/2-183     AC H2ERD0.1
#=GS Q60H33_HBV/31-71     AC Q60H33.1
#=GS F4MJD4_HBV/31-81     AC F4MJD4.1
#=GS C4P184_HBV/31-76     AC C4P184.1
#=GS C9WDK6_HBV/2-183     AC C9WDK6.1
#=GS B3VAR8_HBV/2-183     AC B3VAR8.1
#=GS B6ULJ4_HBV/31-212    AC B6ULJ4.1
#=GS D0E609_HBV/31-212    AC D0E609.1
#=GS C6F505_HBV/31-214    AC C6F505.1
#=GS D8VBI8_HBV/31-144    AC D8VBI8.1
#=GS B5BPU9_HBV/2-183     AC B5BPU9.1
#=GS Q1MSU2_HBV/31-173    AC Q1MSU2.1
#=GS D3J6D9_HBV/31-70     AC D3J6D9.1
#=GS C3W4C9_HBV/2-183     AC C3W4C9.1
#=GS C3W4A5_HBV/2-183     AC C3W4A5.1
#=GS D0EYY3_HBV/2-183     AC D0EYY3.1
#=GS B4Z1H6_HBV/31-71     AC B4Z1H6.1
#=GS Q598R6_HBV/2-183     AC Q598R6.1
#=GS C7AYB0_HBV/2-185     AC C7AYB0.1
#=GS E7EFD4_HBV/2-183     AC E7EFD4.1
#=GS E5D5N6_HBV/1-174     AC E5D5N6.1
#=GS Q917J7_HBV/31-212    AC Q917J7.1
#=GS C4P0Y1_HBV/31-76     AC C4P0Y1.1
#=GS B4X6N2_HBV/31-86     AC B4X6N2.1
#=GS Q58VZ8_HBV/31-212    AC Q58VZ8.1
#=GS B4Z4Q3_HBV/31-70     AC B4Z4Q3.1
#=GS D8VCG1_HBV/2-51      AC D8VCG1.1
#=GS Q2L5C1_HBV/2-20      AC Q2L5C1.1
#=GS B1ABR3_HBV/2-181     AC B1ABR3.1
#=GS C3W481_HBV/2-182     AC C3W481.1
#=GS B4Z270_HBV/31-66     AC B4Z270.1
#=GS I0DG69_HBV/31-212    AC I0DG69.1
#=GS Q765B4_HBV/31-214    AC Q765B4.1
#=GS B4Z254_HBV/31-70     AC B4Z254.1
#=GS B4Z644_HBV/2-41      AC B4Z644.1
#=GS D3J5W2_HBV/31-73     AC D3J5W2.1
#=GS Q8VBH1_HBV/2-183     AC Q8VBH1.1
#=GS C4P1P8_HBV/31-76     AC C4P1P8.1
#=GS A4ZRF1_HBV/2-134     AC A4ZRF1.1
#=GS B6D6B3_HBV/2-182     AC B6D6B3.1
#=GS C9D7M9_HBV/18-196    AC C9D7M9.1
#=GS B9VKH1_HBV/2-183     AC B9VKH1.1
#=GS E1U7N8_HBV/2-183     AC E1U7N8.1
#=GS H9BMU6_HBV/25-191    AC H9BMU6.1
#=GS D7NKZ4_HBV/2-183     AC D7NKZ4.1
#=GS D0EDW7_HBV/2-185     AC D0EDW7.1
#=GS Q2EGF8_HBV/31-99     AC Q2EGF8.1
#=GS B3V8W1_HBV/2-183     AC B3V8W1.1
#=GS Q5Q0Y4_HBV/31-212    AC Q5Q0Y4.1
#=GS B4Z2X5_HBV/31-66     AC B4Z2X5.1
#=GS HBEAG_HBVA3/31-214   AC P0C625.1
#=GS Q8VBK2_HBV/2-183     AC Q8VBK2.1
#=GS E0ZR85_HBV/2-183     AC E0ZR85.1
#=GS H9BMR3_HBV/25-191    AC H9BMR3.1
#=GS Q4FDE8_HBV/31-212    AC Q4FDE8.1
#=GS A3F6J4_HBV/31-106    AC A3F6J4.1
#=GS D3J5R0_HBV/31-57     AC D3J5R0.1
#=GS E0ZNH5_HBV/2-153     AC E0ZNH5.1
#=GS A4ZRG3_HBV/2-134     AC A4ZRG3.1
#=GS I0DG76_HBV/31-212    AC I0DG76.1
#=GS E0ZP58_HBV/2-110     AC E0ZP58.1
#=GS E0ZN86_HBV/2-153     AC E0ZN86.1
#=GS H9BMQ3_HBV/31-150    AC H9BMQ3.1
#=GS Q2L5H7_HBV/2-24      AC Q2L5H7.1
#=GS Q8JSV6_HBV/1-130     AC Q8JSV6.1
#=GS D3J5R8_HBV/31-57     AC D3J5R8.1
#=GS Q1MSS7_HBV/31-173    AC Q1MSS7.1
#=GS Q1MSK7_HBV/31-173    AC Q1MSK7.1
#=GS B2CY41_HBV/31-212    AC B2CY41.1
#=GS Q9DTC6_HBV/2-183     AC Q9DTC6.1
#=GS B4Z466_HBV/31-68     AC B4Z466.1
#=GS C3W450_HBV/2-183     AC C3W450.1
#=GS Q1MSS1_HBV/31-173    AC Q1MSS1.1
#=GS D8VBM9_HBV/2-48      AC D8VBM9.1
#=GS C1K1D8_HBV/2-86      AC C1K1D8.1
#=GS B4Z479_HBV/2-39      AC B4Z479.1
#=GS C4P1I0_HBV/31-76     AC C4P1I0.1
#=GS B4Z4I0_HBV/2-41      AC B4Z4I0.1
#=GS G1E7H0_HBV/2-183     AC G1E7H0.1
#=GS C0LKQ3_HBV/2-183     AC C0LKQ3.1
#=GS Q910L8_HBV/31-212    AC Q910L8.1
#=GS Q09KZ4_HBV/2-20      AC Q09KZ4.1
#=GS G1E8N7_HBV/31-212    AC G1E8N7.1
#=GS B3V8V3_HBV/2-183     AC B3V8V3.1
#=GS Q68081_HBV/2-185     AC Q68081.1
#=GS B4Z2U2_HBV/31-70     AC B4Z2U2.1
#=GS A9PLI2_HBV/1-39      AC A9PLI2.1
#=GS B0FCF1_HBV/2-183     AC B0FCF1.1
#=GS I0DG25_HBV/31-212    AC I0DG25.1
#=GS B9VK93_HBV/2-183     AC B9VK93.1
#=GS G8Z916_HBV/31-168    AC G8Z916.1
#=GS Q1JUT1_HBV/112-178   AC Q1JUT1.1
#=GS F4MJI5_HBV/31-81     AC F4MJI5.1
#=GS C4T8V4_HBV/31-214    AC C4T8V4.1
#=GS D3TIJ2_HBV/2-183     AC D3TIJ2.1
#=GS D8VBP7_HBV/31-79     AC D8VBP7.1
#=GS D0UE30_HBV/2-183     AC D0UE30.1
#=GS C7AYV2_HBV/2-185     AC C7AYV2.1
#=GS E5CZ00_HBV/31-212    AC E5CZ00.1
#=GS Q80JA1_HBV/31-212    AC Q80JA1.1
#=GS B4Z1W3_HBV/31-70     AC B4Z1W3.1
#=GS B5A2I8_HBV/31-212    AC B5A2I8.1
#=GS G9MD83_HBV/2-183     AC G9MD83.1
#=GS D9U5I7_HBV/2-183     AC D9U5I7.1
#=GS C7DNJ3_HBV/31-212    AC C7DNJ3.1
#=GS D5LFI3_HBV/2-183     AC D5LFI3.1
#=GS Q7TF71_HBV/31-212    AC Q7TF71.1
#=GS C4P164_HBV/31-76     AC C4P164.1
#=GS F5C1P7_HBV/43-224    AC F5C1P7.1
#=GS B4Z1P8_HBV/2-42      AC B4Z1P8.1
#=GS D4HMX7_HBV/1-77      AC D4HMX7.1
#=GS C4P121_HBV/31-76     AC C4P121.1
#=GS D2JMN5_HBV/2-183     AC D2JMN5.1
#=GS Q2L566_HBV/2-20      AC Q2L566.1
#=GS G0YVN8_HBV/2-183     AC G0YVN8.1
#=GS D3YGA6_HBV/2-183     AC D3YGA6.1
#=GS C1K184_HBV/2-181     AC C1K184.1
#=GS B4Z1I6_HBV/2-42      AC B4Z1I6.1
#=GS D8VCF2_HBV/2-36      AC D8VCF2.1
#=GS B1ABP4_HBV/31-212    AC B1ABP4.1
#=GS B3VB70_HBV/2-183     AC B3VB70.1
#=GS G0Z2Z2_HBV/2-121     AC G0Z2Z2.1
#=GS Q2LCG9_HBV/2-183     AC Q2LCG9.1
#=GS A4F530_HBV/2-41      AC A4F530.1
#=GS B4Z3Q4_HBV/2-39      AC B4Z3Q4.1
#=GS D3J5Y8_HBV/31-79     AC D3J5Y8.1
#=GS C6F533_HBV/2-185     AC C6F533.1
#=GS C7DMF0_HBV/2-183     AC C7DMF0.1
#=GS D6QVK7_HBV/2-183     AC D6QVK7.1
#=GS Q67999_HBV/2-183     AC Q67999.1
#=GS B4X6I2_HBV/31-87     AC B4X6I2.1
#=GS Q917H4_HBV/31-212    AC Q917H4.1
#=GS D3J5Z4_HBV/31-69     AC D3J5Z4.1
#=GS B6D680_HBV/2-51      AC B6D680.1
#=GS B5BPP8_HBV/31-212    AC B5BPP8.1
#=GS Q8AYT8_HBV/31-214    AC Q8AYT8.1
#=GS D8VBT6_HBV/31-80     AC D8VBT6.1
#=GS Q1MSM7_HBV/31-173    AC Q1MSM7.1
#=GS B0B2M5_HBV/2-183     AC B0B2M5.1
#=GS D3J613_HBV/31-88     AC D3J613.1
#=GS D3J693_HBV/31-68     AC D3J693.1
#=GS Q8VBI5_HBV/2-183     AC Q8VBI5.1
#=GS B3VB53_HBV/31-212    AC B3VB53.1
#=GS B5LX89_HBV/2-183     AC B5LX89.1
#=GS B4Z1I5_HBV/31-71     AC B4Z1I5.1
#=GS O09512_HBV/2-181     AC O09512.1
#=GS G3E5J1_HBV/2-183     AC G3E5J1.1
#=GS C7DNM1_HBV/2-183     AC C7DNM1.1
#=GS C0LKB3_HBV/2-183     AC C0LKB3.1
#=GS B4Z2C9_HBV/31-66     AC B4Z2C9.1
#=GS D3J5W8_HBV/31-79     AC D3J5W8.1
#=GS D3J6B4_HBV/31-70     AC D3J6B4.1
#=GS Q6R7M7_HBV/14-151    AC Q6R7M7.1
#=GS C7AYA1_HBV/2-185     AC C7AYA1.1
#=GS C3V8M0_HBV/2-183     AC C3V8M0.1
#=GS B4Z449_HBV/2-39      AC B4Z449.1
#=GS B6D6H1_HBV/31-159    AC B6D6H1.1
#=GS B5BPI0_HBV/31-212    AC B5BPI0.1
#=GS B5AT30_HBV/31-212    AC B5AT30.1
#=GS Q60H00_HBV/31-71     AC Q60H00.1
#=GS H9BMV8_HBV/1-133     AC H9BMV8.1
#=GS B4Z2Z0_HBV/2-37      AC B4Z2Z0.1
#=GS D2JMY8_HBV/31-212    AC D2JMY8.1
#=GS CAPSD_HBVA6/2-185    AC P0C695.1
#=GS G8H3G2_HBV/2-131     AC G8H3G2.1
#=GS H6V5R7_HBV/2-183     AC H6V5R7.1
#=GS C4P1H9_HBV/31-76     AC C4P1H9.1
#=GS Q96845_HBV/31-212    AC Q96845.1
#=GS B7TUX0_HBV/2-183     AC B7TUX0.1
#=GS D3J5K8_HBV/31-57     AC D3J5K8.1
#=GS D2JMY9_HBV/2-183     AC D2JMY9.1
#=GS D3J6F4_HBV/31-69     AC D3J6F4.1
#=GS B5BPK4_HBV/31-212    AC B5BPK4.1
#=GS D6QVP6_HBV/2-183     AC D6QVP6.1
#=GS Q6X5G3_HBV/1-130     AC Q6X5G3.1
#=GS Q80H43_HBV/2-87      AC Q80H43.1
#=GS Q2PJN1_HBV/32-91     AC Q2PJN1.1
#=GS H6UN12_HBV/2-183     AC H6UN12.1
#=GS B4YT94_HBV/2-174     AC B4YT94.1
#=GS I0DG75_HBV/31-212    AC I0DG75.1
#=GS B0B2U0_HBV/2-183     AC B0B2U0.1
#=GS Q2L5F8_HBV/2-24      AC Q2L5F8.1
#=GS B4Z3J0_HBV/31-68     AC B4Z3J0.1
#=GS H6UGT3_HBV/2-183     AC H6UGT3.1
#=GS B4Z3R9_HBV/2-39      AC B4Z3R9.1
#=GS B4Z5Z7_HBV/31-71     AC B4Z5Z7.1
#=GS Q00K61_HBV/2-183     AC Q00K61.1
#=GS G9G9P2_HBV/2-183     AC G9G9P2.1
#=GS Q68066_HBV/2-183     AC Q68066.1
#=GS Q2L4J3_HBV/2-185     AC Q2L4J3.1
#=GS Q8B6N7_HBV/31-212    AC Q8B6N7.1
#=GS Q1MST9_HBV/2-144     AC Q1MST9.1
#=GS C1KTA6_HBV/31-210    AC C1KTA6.1
#=GS B6D688_HBV/31-54     AC B6D688.1
#=GS B5M5W0_HBV/31-212    AC B5M5W0.1
#=GS E0ZP35_HBV/2-110     AC E0ZP35.1
#=GS B4YKW8_HBV/2-183     AC B4YKW8.1
#=GS G1E7T2_HBV/2-183     AC G1E7T2.1
#=GS D3J5X0_HBV/31-79     AC D3J5X0.1
#=GS C4P1M4_HBV/31-76     AC C4P1M4.1
#=GS Q60H43_HBV/31-71     AC Q60H43.1
#=GS Q77N80_HBVF3/2-183   AC Q77N80.1
#=GS B4Z380_HBV/31-66     AC B4Z380.1
#=GS Q9WP73_HBV/105-184   AC Q9WP73.1
#=GS Q09L17_HBV/2-20      AC Q09L17.1
#=GS B4Z1T4_HBV/31-80     AC B4Z1T4.1
#=GS Q14UA8_HBV/31-78     AC Q14UA8.1
#=GS D3GE34_HBV/2-183     AC D3GE34.1
#=GS Q81156_HBV/2-82      AC Q81156.1
#=GS D8VBV3_HBV/31-66     AC D8VBV3.1
#=GS B6ULI4_HBV/92-162    AC B6ULI4.1
#=GS H6UN44_HBV/2-183     AC H6UN44.1
#=GS A9PLH3_HBV/1-39      AC A9PLH3.1
#=GS Q45F29_HBV/31-212    AC Q45F29.1
#=GS B5M5M4_HBV/31-212    AC B5M5M4.1
#=GS B5BPW6_HBV/2-183     AC B5BPW6.1
#=GS B4Z1M7_HBV/2-42      AC B4Z1M7.1
#=GS D2JMT6_HBV/2-183     AC D2JMT6.1
#=GS H6V8C1_HBV/31-56     AC H6V8C1.1
#=GS F5C049_HBV/31-53     AC F5C049.1
#=GS HBEAG_HBVD6/31-212   AC Q67876.1
#=GS D0EE00_HBV/2-185     AC D0EE00.1
#=GS B5ASR7_HBV/2-183     AC B5ASR7.1
#=GS Q917I8_HBV/2-183     AC Q917I8.1
#=GS C1KT95_HBV/31-210    AC C1KT95.1
#=GS C1K1V6_HBV/2-27      AC C1K1V6.1
#=GS Q9WMC9_HBV/31-212    AC Q9WMC9.1
#=GS Q4FDM3_HBV/31-212    AC Q4FDM3.1
#=GS B2Y6T9_HBV/31-214    AC B2Y6T9.1
#=GS Q2EGE7_HBV/31-84     AC Q2EGE7.1
#=GS E0ZNZ8_HBV/31-139    AC E0ZNZ8.1
#=GS B4Z220_HBV/2-41      AC B4Z220.1
#=GS B3GSW3_HBV/2-183     AC B3GSW3.1
#=GS Q60H05_HBV/2-42      AC Q60H05.1
#=GS D8VC11_HBV/2-23      AC D8VC11.1
#=GS H6V8B3_HBV/31-56     AC H6V8B3.1
#=GS G1EIK0_HBV/2-153     AC G1EIK0.1
#=GS E0ZNG7_HBV/2-144     AC E0ZNG7.1
#=GS Q7TEC2_HBV/31-163    AC Q7TEC2.1
#=GS D0EE98_HBV/31-214    AC D0EE98.1
#=GS Q91A60_HBV/31-66     AC Q91A60.1
#=GS A3F6I8_HBV/101-197   AC A3F6I8.1
#=GS D0UDX6_HBV/2-183     AC D0UDX6.1
#=GS Q77BG0_HBV/1-96      AC Q77BG0.1
#=GS Q91A51_HBV/31-66     AC Q91A51.1
#=GS E0ZNZ3_HBV/2-110     AC E0ZNZ3.1
#=GS C4P113_HBV/31-76     AC C4P113.1
#=GS C4P0Y3_HBV/31-76     AC C4P0Y3.1
#=GS D3J698_HBV/31-66     AC D3J698.1
#=GS D0EE72_HBV/31-214    AC D0EE72.1
#=GS A7L349_HBV/31-190    AC A7L349.1
#=GS C3W3X1_HBV/2-183     AC C3W3X1.1
#=GS G3XGT9_HBV/2-183     AC G3XGT9.1
#=GS B4Z1S3_HBV/2-50      AC B4Z1S3.1
#=GS C7DMB0_HBV/2-183     AC C7DMB0.1
#=GS Q7TEC5_HBV/31-163    AC Q7TEC5.1
#=GS Q9QB14_HBV/2-183     AC Q9QB14.1
#=GS B4Z4L6_HBV/2-41      AC B4Z4L6.1
#=GS B5TXY6_HBV/31-212    AC B5TXY6.1
#=GS Q7T3Z0_HBV/31-88     AC Q7T3Z0.1
#=GS B6D6D0_HBV/2-113     AC B6D6D0.1
#=GS A1KR33_HBV/2-25      AC A1KR33.1
#=GS Q67980_HBV/31-212    AC Q67980.1
#=GS C4P1N5_HBV/31-76     AC C4P1N5.1
#=GS Q14UA6_HBV/31-78     AC Q14UA6.1
#=GS Q7THQ6_HBV/102-180   AC Q7THQ6.1
#=GS C4P1V2_HBV/31-76     AC C4P1V2.1
#=GS Q6I6S4_HBV/31-71     AC Q6I6S4.1
#=GS D3YGS5_HBV/31-212    AC D3YGS5.1
#=GS Q00K53_HBV/2-183     AC Q00K53.1
#=GS B9VKT0_HBV/2-183     AC B9VKT0.1
#=GS Q9E0V5_HBV/31-152    AC Q9E0V5.1
#=GS Q8QSA8_HBV/31-212    AC Q8QSA8.1
#=GS D8VCA6_HBV/2-36      AC D8VCA6.1
#=GS E0ZNB0_HBV/31-176    AC E0ZNB0.1
#=GS Q67849_9HEPA/2-262   AC Q67849.1
#=GS D3J6B1_HBV/31-70     AC D3J6B1.1
#=GS B5L580_HBV/31-214    AC B5L580.1
#=GS CAPSD_WHV4/2-188     AC P69710.1
#=GS D8VBM8_HBV/31-77     AC D8VBM8.1
#=GS D8VC83_HBV/31-80     AC D8VC83.1
#=GS D2U604_HBV/2-183     AC D2U604.1
#=GS I0DG38_HBV/31-212    AC I0DG38.1
#=GS C4P167_HBV/31-76     AC C4P167.1
#=GS Q5R2M4_HBV/2-183     AC Q5R2M4.1
#=GS E0ZNC5_HBV/2-142     AC E0ZNC5.1
#=GS D8VCJ0_HBV/31-63     AC D8VCJ0.1
#=GS Q09KZ1_HBV/2-20      AC Q09KZ1.1
#=GS G9G930_HBV/2-183     AC G9G930.1
#=GS G8H3G7_HBV/2-131     AC G8H3G7.1
#=GS Q2EGC1_HBV/31-99     AC Q2EGC1.1
#=GS G1C918_HBV/2-183     AC G1C918.1
#=GS D8VBM6_HBV/2-51      AC D8VBM6.1
#=GS Q8VBF6_HBV/2-183     AC Q8VBF6.1
#=GS C7DN41_HBV/2-183     AC C7DN41.1
#=GS D8VC39_HBV/2-51      AC D8VC39.1
#=GS C4P0X5_HBV/31-76     AC C4P0X5.1
#=GS I0DG83_HBV/31-212    AC I0DG83.1
#=GS B4Z306_HBV/2-37      AC B4Z306.1
#=GS F4MJI2_HBV/31-81     AC F4MJI2.1
#=GS Q81153_HBV/2-82      AC Q81153.1
#=GS G9MD84_HBV/2-183     AC G9MD84.1
#=GS Q003Z8_HBV/31-212    AC Q003Z8.1
#=GS E0ZRE0_HBV/2-183     AC E0ZRE0.1
#=GS A9QPW0_HBV/16-197    AC A9QPW0.1
#=GS C4P0Z4_HBV/31-76     AC C4P0Z4.1
#=GS B4Z639_HBV/2-41      AC B4Z639.1
#=GS B4Z673_HBV/2-41      AC B4Z673.1
#=GS D8VC19_HBV/2-37      AC D8VC19.1
#=GS B4Z1Q4_HBV/2-42      AC B4Z1Q4.1
#=GS Q80J61_HBV/34-113    AC Q80J61.1
#=GS C4P0Z0_HBV/31-76     AC C4P0Z0.1
#=GS I0DG78_HBV/31-212    AC I0DG78.1
#=GS C4P1E4_HBV/31-76     AC C4P1E4.1
#=GS Q6RSG9_9HEPA/45-305  AC Q6RSG9.1
#=GS B7TUY3_HBV/2-183     AC B7TUY3.1
#=GS D3J6E7_HBV/31-70     AC D3J6E7.1
#=GS CAPSD_HBVCJ/2-183    AC Q76R61.1
#=GS E0ZNV7_HBV/2-25      AC E0ZNV7.1
#=GS Q2L5B2_HBV/2-20      AC Q2L5B2.1
#=GS Q910H6_HBV/31-214    AC Q910H6.1
#=GS B4YL22_HBV/31-212    AC B4YL22.1
#=GS B6D6C4_HBV/2-39      AC B6D6C4.1
#=GS B5B484_HBV/2-183     AC B5B484.1
#=GS Q91SX9_HBV/31-212    AC Q91SX9.1
#=GS Q9E0S3_HBV/2-123     AC Q9E0S3.1
#=GS D3J5Z1_HBV/31-80     AC D3J5Z1.1
#=GS B9VL04_HBV/2-183     AC B9VL04.1
#=GS Q7T7U7_HBV/2-183     AC Q7T7U7.1
#=GS HBEAG_DHBV1/45-305   AC P03154.1
#=GS D0EDU0_HBV/2-183     AC D0EDU0.1
#=GS C3W426_HBV/2-183     AC C3W426.1
#=GS B0FC57_HBV/31-212    AC B0FC57.1
#=GS Q784K3_HBV/31-212    AC Q784K3.1
#=GS D8VC75_HBV/2-36      AC D8VC75.1
#=GS B4Z445_HBV/31-68     AC B4Z445.1
#=GS C1K1L4_HBV/2-181     AC C1K1L4.1
#=GS Q8VBI1_HBV/2-183     AC Q8VBI1.1
#=GS Q6R7M6_HBV/14-151    AC Q6R7M6.1
#=GS C4P1U0_HBV/31-76     AC C4P1U0.1
#=GS B6ULK1_HBV/31-83     AC B6ULK1.1
#=GS C4P1L8_HBV/31-76     AC C4P1L8.1
#=GS E0ZP60_HBV/31-139    AC E0ZP60.1
#=GS Q6J314_HBV/31-214    AC Q6J314.1
#=GS D3YGK9_HBV/2-183     AC D3YGK9.1
#=GS B4Z341_HBV/31-66     AC B4Z341.1
#=GS B4Z3A1_HBV/31-66     AC B4Z3A1.1
#=GS B3VB96_HBV/2-183     AC B3VB96.1
#=GS D2JZX1_HBV/2-183     AC D2JZX1.1
#=GS E0D3A2_HBV/31-82     AC E0D3A2.1
#=GS B5M594_HBV/31-212    AC B5M594.1
#=GS B5M5S9_HBV/31-212    AC B5M5S9.1
#=GS B5BPY5_HBV/31-212    AC B5BPY5.1
#=GS Q19K63_HBV/31-62     AC Q19K63.1
#=GS B4Z4V8_HBV/31-70     AC B4Z4V8.1
#=GS H6UNB1_HBV/2-183     AC H6UNB1.1
#=GS B4Z298_HBV/2-37      AC B4Z298.1
#=GS D3YGB8_HBV/2-183     AC D3YGB8.1
#=GS A1KR32_HBV/2-25      AC A1KR32.1
#=GS Q9E0V9_HBV/31-152    AC Q9E0V9.1
#=GS Q4FDC4_HBV/31-212    AC Q4FDC4.1
#=GS B4Z4L7_HBV/31-70     AC B4Z4L7.1
#=GS C3W487_HBV/2-183     AC C3W487.1
#=GS D3J683_HBV/31-68     AC D3J683.1
#=GS Q2L4N1_HBV/2-183     AC Q2L4N1.1
#=GS B3VAS0_HBV/2-183     AC B3VAS0.1
#=GS B7TV26_HBV/31-212    AC B7TV26.1
#=GS Q5G3F5_HBV/2-25      AC Q5G3F5.1
#=GS D5LCM7_HBV/2-183     AC D5LCM7.1
#=GS G0Z2X0_HBV/2-121     AC G0Z2X0.1
#=GS F4MJE3_HBV/31-81     AC F4MJE3.1
#=GS B7TTD3_HBV/31-212    AC B7TTD3.1
#=GS Q2ABY7_HBV/1-165     AC Q2ABY7.1
#=GS E3Q0I7_HBV/31-212    AC E3Q0I7.1
#=GS Q81119_HBV/2-183     AC Q81119.1
#=GS B4Z3M4_HBV/2-39      AC B4Z3M4.1
#=GS D8VC49_HBV/31-80     AC D8VC49.1
#=GS B7TTE6_HBV/2-183     AC B7TTE6.1
#=GS Q5UFS4_HBV/31-212    AC Q5UFS4.1
#=GS H6V5H9_HBV/2-183     AC H6V5H9.1
#=GS D8VC33_HBV/2-51      AC D8VC33.1
#=GS Q1MSL7_HBV/31-168    AC Q1MSL7.1
#=GS A7L350_HBV/2-161     AC A7L350.1
#=GS Q5U7P3_HBV/31-212    AC Q5U7P3.1
#=GS A6YJY6_HBV/2-181     AC A6YJY6.1
#=GS D8VCG3_HBV/31-80     AC D8VCG3.1
#=GS D3J5Q7_HBV/31-57     AC D3J5Q7.1
#=GS I0DG42_HBV/31-212    AC I0DG42.1
#=GS Q2MLR7_HBV/2-183     AC Q2MLR7.1
#=GS C9W229_HBV/2-183     AC C9W229.1
#=GS E5RN31_HBV/1-162     AC E5RN31.1
#=GS B0FD89_HBV/2-183     AC B0FD89.1
#=GS D3J687_HBV/31-68     AC D3J687.1
#=GS Q7TDS2_HBV/2-183     AC Q7TDS2.1
#=GS E0ZN97_HBV/2-153     AC E0ZN97.1
#=GS C4P1I6_HBV/31-76     AC C4P1I6.1
#=GS Q19SX3_HBV/2-183     AC Q19SX3.1
#=GS B4Z285_HBV/31-66     AC B4Z285.1
#=GS B4Z3T7_HBV/2-39      AC B4Z3T7.1
#=GS H9BMS0_HBV/1-146     AC H9BMS0.1
#=GS B5M5A0_HBV/31-212    AC B5M5A0.1
#=GS Q2L5D5_HBV/2-20      AC Q2L5D5.1
#=GS Q6I6R2_HBV/31-71     AC Q6I6R2.1
#=GS B4Z3F1_HBV/2-42      AC B4Z3F1.1
#=GS Q8UYB4_HHBV/45-305   AC Q8UYB4.1
#=GS D2JMD5_HBV/2-183     AC D2JMD5.1
#=GS B4Z2B5_HBV/31-66     AC B4Z2B5.1
#=GS B5M605_HBV/31-212    AC B5M605.1
#=GS D6QVK0_HBV/2-183     AC D6QVK0.1
#=GS Q7T7Y1_HBV/2-183     AC Q7T7Y1.1
#=GS B9W410_HBV/2-185     AC B9W410.1
#=GS C4P126_HBV/31-76     AC C4P126.1
#=GS B4Z604_HBV/2-41      AC B4Z604.1
#=GS Q1MSL6_HBV/31-151    AC Q1MSL6.1
#=GS B5BPJ2_HBV/31-212    AC B5BPJ2.1
#=GS Q45F49_HBV/2-183     AC Q45F49.1
#=GS C4P1S6_HBV/31-76     AC C4P1S6.1
#=GS B4Z3I8_HBV/2-39      AC B4Z3I8.1
#=GS B5B4Q6_HBV/31-212    AC B5B4Q6.1
#=GS D3J6C2_HBV/31-70     AC D3J6C2.1
#=GS B4Z2M9_HBV/2-41      AC B4Z2M9.1
#=GS G0XT52_HBV/31-193    AC G0XT52.1
#=GS B4X6M2_HBV/31-86     AC B4X6M2.1
#=GS C9WDD6_HBV/2-183     AC C9WDD6.1
#=GS Q2L5F1_HBV/2-24      AC Q2L5F1.1
#=GS G1EIF7_HBV/2-183     AC G1EIF7.1
#=GS C7DM23_HBV/2-183     AC C7DM23.1
#=GS D6QW36_HBV/31-212    AC D6QW36.1
#=GS H9BMT6_HBV/24-182    AC H9BMT6.1
#=GS G0Z2X1_HBV/2-121     AC G0Z2X1.1
#=GS C7AY64_HBV/31-214    AC C7AY64.1
#=GS B4Z4S8_HBV/31-70     AC B4Z4S8.1
#=GS C4RU83_HBV/2-183     AC C4RU83.1
#=GS B5BPY9_HBV/31-212    AC B5BPY9.1
#=GS D8VC07_HBV/31-80     AC D8VC07.1
#=GS HBEAG_HBVD7/31-212   AC O92920.1
#=GS D2JME4_HBV/2-183     AC D2JME4.1
#=GS H6UMZ6_HBV/2-183     AC H6UMZ6.1
#=GS E0ZRU0_HBV/2-183     AC E0ZRU0.1
#=GS B4Z646_HBV/2-41      AC B4Z646.1
#=GS B4Z219_HBV/31-70     AC B4Z219.1
#=GS Q8QP19_HBV/1-130     AC Q8QP19.1
#=GS Q4FDJ5_HBV/31-212    AC Q4FDJ5.1
#=GS C4P1S4_HBV/31-71     AC C4P1S4.1
#=GS B4Z4T5_HBV/2-41      AC B4Z4T5.1
#=GS Q6XJY0_HBV/2-62      AC Q6XJY0.1
#=GS B4Z255_HBV/2-41      AC B4Z255.1
#=GS B4Z3F3_HBV/31-71     AC B4Z3F3.1
#=GS D3J673_HBV/31-68     AC D3J673.1
#=GS B4Z5X7_HBV/2-42      AC B4Z5X7.1
#=GS B4YKM1_HBV/31-214    AC B4YKM1.1
#=GS B4Z4K8_HBV/31-69     AC B4Z4K8.1
#=GS Q918J3_HBV/2-183     AC Q918J3.1
#=GS D3J5Q8_HBV/31-57     AC D3J5Q8.1
#=GS B8PTF0_HBV/31-212    AC B8PTF0.1
#=GS Q80JA8_HBV/31-212    AC Q80JA8.1
#=GS E5RD72_HBV/31-212    AC E5RD72.1
#=GS B4Z1S6_HBV/2-51      AC B4Z1S6.1
#=GS Q9WJC3_HBV/2-183     AC Q9WJC3.1
#=GS B4Z600_HBV/31-71     AC B4Z600.1
#=GS C9WD87_HBV/2-183     AC C9WD87.1
#=GS G1E806_HBV/2-172     AC G1E806.1
#=GS E5CYX5_HBV/31-212    AC E5CYX5.1
#=GS C1K203_HBV/31-130    AC C1K203.1
#=GS D0EYV6_HBV/2-158     AC D0EYV6.1
#=GS Q67997_HBV/2-183     AC Q67997.1
#=GS Q09KT7_HBV/2-20      AC Q09KT7.1
#=GS E0ZNS6_HBV/2-110     AC E0ZNS6.1
#=GS Q805K2_HBV/2-181     AC Q805K2.1
#=GS Q6TYF7_HBV/31-182    AC Q6TYF7.1
#=GS B4Z321_HBV/2-37      AC B4Z321.1
#=GS B9VKR8_HBV/31-212    AC B9VKR8.1
#=GS D0EE92_HBV/2-185     AC D0EE92.1
#=GS A1KR38_HBV/2-25      AC A1KR38.1
#=GS D3J5W6_HBV/31-77     AC D3J5W6.1
#=GS Q9E0P1_HBV/2-123     AC Q9E0P1.1
#=GS H6UMZ2_HBV/2-183     AC H6UMZ2.1
#=GS G9G936_HBV/2-183     AC G9G936.1
#=GS H2ERI6_HBV/2-183     AC H2ERI6.1
#=GS Q81154_HBV/31-111    AC Q81154.1
#=GS Q8JSX5_HBV/1-130     AC Q8JSX5.1
#=GS B4Z395_HBV/31-66     AC B4Z395.1
#=GS B5B4L8_HBV/31-212    AC B5B4L8.1
#=GS B5A2H7_HBV/2-183     AC B5A2H7.1
#=GS G0Z2Z7_HBV/2-121     AC G0Z2Z7.1
#=GS Q917I9_HBV/2-183     AC Q917I9.1
#=GS D7R742_HBV/2-183     AC D7R742.1
#=GS B4Z1Q9_HBV/31-71     AC B4Z1Q9.1
#=GS A4UIM1_HBV/31-211    AC A4UIM1.1
#=GS B0B2L0_HBV/2-183     AC B0B2L0.1
#=GS Q805K1_HBV/2-181     AC Q805K1.1
#=GS E0D3B6_HBV/31-212    AC E0D3B6.1
#=GS B4Z4P8_HBV/31-70     AC B4Z4P8.1
#=GS B4Z2X6_HBV/2-37      AC B4Z2X6.1
#=GS D0E665_HBV/31-212    AC D0E665.1
#=GS G9G9K7_HBV/2-183     AC G9G9K7.1
#=GS H9BMV6_HBV/1-146     AC H9BMV6.1
#=GS B4Y4L3_HBV/2-183     AC B4Y4L3.1
#=GS D5LDF5_HBV/2-183     AC D5LDF5.1
#=GS B9W3Y4_HBV/2-185     AC B9W3Y4.1
#=GS Q6UE65_HBV/2-183     AC Q6UE65.1
#=GS Q81144_HBV/2-82      AC Q81144.1
#=GS G1E7H6_HBV/31-212    AC G1E7H6.1
#=GS B5U728_HBV/2-183     AC B5U728.1
#=GS C7AYR0_HBV/31-214    AC C7AYR0.1
#=GS B5M5R1_HBV/31-212    AC B5M5R1.1
#=GS B4Z3V7_HBV/2-39      AC B4Z3V7.1
#=GS Q60GW1_HBV/31-71     AC Q60GW1.1
#=GS E0ZN93_HBV/31-182    AC E0ZN93.1
#=GS D4I4Q6_HBV/2-183     AC D4I4Q6.1
#=GS C7DSJ1_HBV/2-183     AC C7DSJ1.1
#=GS Q991J9_HBV/84-157    AC Q991J9.1
#=GS Q1MSN0_HBV/31-173    AC Q1MSN0.1
#=GS Q60H28_HBV/31-71     AC Q60H28.1
#=GS B5M5R3_HBV/31-212    AC B5M5R3.1
#=GS Q00KA5_HBV/2-183     AC Q00KA5.1
#=GS Q6TYI3_HBV/31-182    AC Q6TYI3.1
#=GS H9BMT9_HBV/2-155     AC H9BMT9.1
#=GS Q81155_HBV/2-82      AC Q81155.1
#=GS B4Z475_HBV/31-68     AC B4Z475.1
#=GS D3J6F0_HBV/31-70     AC D3J6F0.1
#=GS A5LG93_HBV/2-183     AC A5LG93.1
#=GS C4P137_HBV/31-76     AC C4P137.1
#=GS B5BPX7_HBV/2-183     AC B5BPX7.1
#=GS E8Z622_HBV/2-183     AC E8Z622.1
#=GS B1ABL3_HBV/31-210    AC B1ABL3.1
#=GS D3TK42_HBV/31-113    AC D3TK42.1
#=GS B0B346_HBV/2-183     AC B0B346.1
#=GS B4Z2B2_HBV/31-66     AC B4Z2B2.1
#=GS Q4FD84_HBV/31-212    AC Q4FD84.1
#=GS Q3LTY0_HBV/2-183     AC Q3LTY0.1
#=GS B4Z3R2_HBV/31-68     AC B4Z3R2.1
#=GS E5CZ19_HBV/31-212    AC E5CZ19.1
#=GS D2JME3_HBV/31-212    AC D2JME3.1
#=GS C4P1C3_HBV/31-76     AC C4P1C3.1
#=GS E5L512_9HEPA/45-305  AC E5L512.1
#=GS D8VCB5_HBV/31-80     AC D8VCB5.1
#=GS B3VAH6_HBV/31-212    AC B3VAH6.1
#=GS Q774G3_HBVF2/31-212  AC Q774G3.1
#=GS Q2L5D4_HBV/2-20      AC Q2L5D4.1
#=GS C1K1E4_HBV/31-212    AC C1K1E4.1
#=GS D8VBM2_HBV/31-212    AC D8VBM2.1
#=GS H2ER69_HBV/2-183     AC H2ER69.1
#=GS D8VCE3_HBV/31-64     AC D8VCE3.1
#=GS Q65Z74_HBV/2-183     AC Q65Z74.1
#=GS Q1MSJ8_HBV/31-173    AC Q1MSJ8.1
#=GS A9PLE9_HBV/1-39      AC A9PLE9.1
#=GS B4Z5X6_HBV/31-71     AC B4Z5X6.1
#=GS I0DG46_HBV/31-212    AC I0DG46.1
#=GS G8H3G5_HBV/2-131     AC G8H3G5.1
#=GS E9NIN3_HBV/31-212    AC E9NIN3.1
#=GS Q2F4X9_HBV/31-212    AC Q2F4X9.1
#=GS D8VBT7_HBV/2-51      AC D8VBT7.1
#=GS C4P127_HBV/31-76     AC C4P127.1
#=GS H6UGG0_HBV/2-183     AC H6UGG0.1
#=GS B6ULM0_HBV/2-183     AC B6ULM0.1
#=GS B4Z6C0_HBV/31-70     AC B4Z6C0.1
#=GS G1C8Z1_HBV/2-183     AC G1C8Z1.1
#=GS Q6RSF4_9HEPA/45-305  AC Q6RSF4.1
#=GS G1E7D9_HBV/31-212    AC G1E7D9.1
#=GS E0ZRE6_HBV/31-212    AC E0ZRE6.1
#=GS Q45F41_HBV/2-183     AC Q45F41.1
#=GS C4P1J1_HBV/31-76     AC C4P1J1.1
#=GS D3TJA3_HBV/113-183   AC D3TJA3.1
#=GS C0LKP7_HBV/2-183     AC C0LKP7.1
#=GS B0FD96_HBV/2-181     AC B0FD96.1
#=GS D2JML7_HBV/2-183     AC D2JML7.1
#=GS D8VC77_HBV/2-50      AC D8VC77.1
#=GS G1E7D4_HBV/2-183     AC G1E7D4.1
#=GS B3VAZ5_HBV/2-183     AC B3VAZ5.1
#=GS B4Z1R2_HBV/31-71     AC B4Z1R2.1
#=GS A4ZRF5_HBV/2-134     AC A4ZRF5.1
#=GS Q2V2L3_HBV/2-183     AC Q2V2L3.1
#=GS B5TY01_HBV/2-183     AC B5TY01.1
#=GS E0ZP76_HBV/2-110     AC E0ZP76.1
#=GS Q507G3_HBV/31-163    AC Q507G3.1
#=GS C9WDC4_HBV/2-183     AC C9WDC4.1
#=GS E5CZ10_HBV/31-212    AC E5CZ10.1
#=GS CAPSD_HBVC3/2-183    AC P69706.1
#=GS HBEAG_HBVGO/31-212   AC Q9WJE9.1
#=GS C7AYR1_HBV/2-185     AC C7AYR1.1
#=GS B2LRY7_HBV/2-183     AC B2LRY7.1
#=GS E3Q0I8_HBV/2-183     AC E3Q0I8.1
#=GS B5U723_HBV/2-183     AC B5U723.1
#=GS E0ZP78_HBV/31-139    AC E0ZP78.1
#=GS Q60GW6_HBV/31-71     AC Q60GW6.1
#=GS D8VBX1_HBV/31-80     AC D8VBX1.1
#=GS Q8QP14_HBV/1-130     AC Q8QP14.1
#=GS B9VK26_HBV/2-183     AC B9VK26.1
#=GS B2Y6J6_HBV/2-183     AC B2Y6J6.1
#=GS B4X6I5_HBV/31-87     AC B4X6I5.1
#=GS D3J668_HBV/31-68     AC D3J668.1
#=GS B4ZYZ8_HBV/2-183     AC B4ZYZ8.1
#=GS G1E7W2_HBV/2-183     AC G1E7W2.1
#=GS B4Z314_HBV/31-66     AC B4Z314.1
#=GS Q7TF61_HBV/31-212    AC Q7TF61.1
#=GS D8VBZ2_HBV/31-80     AC D8VBZ2.1
#=GS F5C1Q5_HBV/2-183     AC F5C1Q5.1
#=GS I0DG80_HBV/31-212    AC I0DG80.1
#=GS G1EIG4_HBV/2-183     AC G1EIG4.1
#=GS Q2EGC6_HBV/31-99     AC Q2EGC6.1
#=GS H2ER63_HBV/2-183     AC H2ER63.1
#=GS Q8VBH9_HBV/2-183     AC Q8VBH9.1
#=GS C4P1A6_HBV/31-76     AC C4P1A6.1
#=GS Q7TDP6_HBV/2-183     AC Q7TDP6.1
#=GS Q9E0S7_HBV/2-123     AC Q9E0S7.1
#=GS B4Z5S3_HBV/31-71     AC B4Z5S3.1
#=GS G1EIK3_HBV/2-153     AC G1EIK3.1
#=GS C0LKP5_HBV/2-183     AC C0LKP5.1
#=GS Q80H22_HBV/2-183     AC Q80H22.1
#=GS H9BMT0_HBV/24-182    AC H9BMT0.1
#=GS B9VK46_HBV/2-183     AC B9VK46.1
#=GS D2U612_HBV/2-183     AC D2U612.1
#=GS D5LBW3_HBV/2-183     AC D5LBW3.1
#=GS D8VBP5_HBV/2-24      AC D8VBP5.1
#=GS HBEAG_HBVC1/31-212   AC P0C6H3.1
#=GS Q9WMB9_HBV/31-212    AC Q9WMB9.1
#=GS Q6XGU8_HBV/2-185     AC Q6XGU8.1
#=GS Q917H8_HBV/31-214    AC Q917H8.1
#=GS B7TTY7_HBV/2-183     AC B7TTY7.1
#=GS H6V891_HBV/31-56     AC H6V891.1
#=GS C1KT98_HBV/31-210    AC C1KT98.1
#=GS D3J6E2_HBV/31-70     AC D3J6E2.1
#=GS E0ZNU6_HBV/31-139    AC E0ZNU6.1
#=GS Q77ZZ3_HBVE2/31-212  AC Q77ZZ3.1
#=GS F5C042_HBV/31-53     AC F5C042.1
#=GS Q60GV7_HBV/31-71     AC Q60GV7.1
#=GS B4Z295_HBV/2-37      AC B4Z295.1
#=GS B4Z430_HBV/31-68     AC B4Z430.1
#=GS D6QW11_HBV/2-183     AC D6QW11.1
#=GS C7DM30_HBV/2-183     AC C7DM30.1
#=GS B7TU17_HBV/2-183     AC B7TU17.1
#=GS B4Z3L2_HBV/2-39      AC B4Z3L2.1
#=GS Q67906_HBV/2-164     AC Q67906.1
#=GS O91568_HBV/31-212    AC O91568.1
#=GS D3J5P9_HBV/31-57     AC D3J5P9.1
#=GS B0B371_HBV/2-183     AC B0B371.1
#=GS H3K3K5_HBV/31-214    AC H3K3K5.1
#=GS D0EEN7_HBV/2-185     AC D0EEN7.1
#=GS Q8UYA5_HBV/2-183     AC Q8UYA5.1
#=GS Q91A82_HBV/31-66     AC Q91A82.1
#=GS D2JMB5_HBV/2-183     AC D2JMB5.1
#=GS A7J8K5_HBV/2-89      AC A7J8K5.1
#=GS Q60H27_HBV/31-71     AC Q60H27.1
#=GS E0ZNA5_HBV/2-128     AC E0ZNA5.1
#=GS D4HMY3_HBV/1-78      AC D4HMY3.1
#=GS Q91SY6_HBV/31-212    AC Q91SY6.1
#=GS H9BMQ9_HBV/25-191    AC H9BMQ9.1
#=GS B7TTR7_HBV/31-212    AC B7TTR7.1
#=GS B4Z4R7_HBV/2-41      AC B4Z4R7.1
#=GS G1E7F7_HBV/2-183     AC G1E7F7.1
#=GS G8Z913_HBV/2-139     AC G8Z913.1
#=GS C4P1G1_HBV/31-76     AC C4P1G1.1
#=GS B7TV75_HBV/31-212    AC B7TV75.1
#=GS C7DML8_HBV/2-183     AC C7DML8.1
#=GS D3TIS5_HBV/2-183     AC D3TIS5.1
#=GS B4Z217_HBV/2-41      AC B4Z217.1
#=GS B4Z2Z9_HBV/2-37      AC B4Z2Z9.1
#=GS B4Z6A5_HBV/31-70     AC B4Z6A5.1
#=GS B4X6J5_HBV/31-87     AC B4X6J5.1
#=GS D5LDL3_HBV/31-212    AC D5LDL3.1
#=GS D4HMX4_HBV/1-77      AC D4HMX4.1
#=GS D3J5Y7_HBV/31-78     AC D3J5Y7.1
#=GS B4Z3H2_HBV/31-71     AC B4Z3H2.1
#=GS CAPSD_HBVD7/2-183    AC P0C6I3.1
#=GS B1ABM9_HBV/31-212    AC B1ABM9.1
#=GS Q6TYG0_HBV/31-182    AC Q6TYG0.1
#=GS B5M5G8_HBV/31-212    AC B5M5G8.1
#=GS C7DY98_HBV/2-183     AC C7DY98.1
#=GS C7DSJ0_HBV/31-212    AC C7DSJ0.1
#=GS Q91SY1_HBV/31-212    AC Q91SY1.1
#=GS Q6TYH5_HBV/31-182    AC Q6TYH5.1
#=GS D3J5Y2_HBV/31-88     AC D3J5Y2.1
#=GS Q8QP22_HBV/1-130     AC Q8QP22.1
#=GS G9MD71_HBV/2-183     AC G9MD71.1
#=GS H9N878_HBV/2-183     AC H9N878.1
#=GS C7DN81_HBV/2-183     AC C7DN81.1
#=GS A6MFZ2_HBV/2-183     AC A6MFZ2.1
#=GS B4Z4M3_HBV/31-70     AC B4Z4M3.1
#=GS D8VC92_HBV/2-51      AC D8VC92.1
#=GS Q9QBF7_HBV/2-183     AC Q9QBF7.1
#=GS I0DG81_HBV/31-212    AC I0DG81.1
#=GS D3J676_HBV/31-60     AC D3J676.1
#=GS D3J604_HBV/31-80     AC D3J604.1
#=GS Q5Q0T6_HBV/2-183     AC Q5Q0T6.1
#=GS D3J669_HBV/31-68     AC D3J669.1
#=GS C1KTA7_HBV/31-210    AC C1KTA7.1
#=GS G1E8L7_HBV/2-183     AC G1E8L7.1
#=GS B4X6N0_HBV/31-86     AC B4X6N0.1
#=GS D8VCA9_HBV/2-51      AC D8VCA9.1
#=GS D3J5R5_HBV/31-57     AC D3J5R5.1
#=GS F1CFC8_HBV/2-183     AC F1CFC8.1
#=GS G1E847_HBV/31-212    AC G1E847.1
#=GS CAPSD_HBVG1/14-195   AC P29178.1
#=GS D9U579_HBV/111-182   AC D9U579.1
#=GS HBEAG_HPBDW/45-305   AC P17191.2
#=GS H6UGQ5_HBV/2-183     AC H6UGQ5.1
#=GS B4Z2Y9_HBV/31-66     AC B4Z2Y9.1
#=GS D3J659_HBV/31-89     AC D3J659.1
#=GS E0ZP63_HBV/2-110     AC E0ZP63.1
#=GS G1E7F1_HBV/2-183     AC G1E7F1.1
#=GS D3J6C9_HBV/31-70     AC D3J6C9.1
#=GS Q68014_HBV/31-212    AC Q68014.1
#=GS G1C8X7_HBV/2-183     AC G1C8X7.1
#=GS E5RPK6_HBV/31-212    AC E5RPK6.1
#=GS B0FCV5_HBV/2-183     AC B0FCV5.1
#=GS Q6UE59_HBV/2-183     AC Q6UE59.1
#=GS Q769H8_HBV/31-212    AC Q769H8.1
#=GS D2U656_HBV/2-183     AC D2U656.1
#=GS A7YEX1_HBV/31-212    AC A7YEX1.1
#=GS Q8V1F1_HBV/31-111    AC Q8V1F1.1
#=GS B4Z439_HBV/31-68     AC B4Z439.1
#=GS Q2L575_HBV/2-20      AC Q2L575.1
#=GS G1E820_HBV/2-52      AC G1E820.1
#=GS B4X6L7_HBV/31-86     AC B4X6L7.1
#=GS B3VAK4_HBV/2-183     AC B3VAK4.1
#=GS Q8B6D1_HBV/2-183     AC Q8B6D1.1
#=GS B9VKE7_HBV/31-212    AC B9VKE7.1
#=GS B2LRU8_HBV/31-212    AC B2LRU8.1
#=GS D4HMX9_HBV/1-77      AC D4HMX9.1
#=GS Q2EGI0_HBV/31-86     AC Q2EGI0.1
#=GS Q6XGH3_HBV/31-212    AC Q6XGH3.1
#=GS Q1MSQ7_HBV/31-173    AC Q1MSQ7.1
#=GS D7NKL2_HBV/2-183     AC D7NKL2.1
#=GS B4Z3R6_HBV/2-39      AC B4Z3R6.1
#=GS Q91T01_HBV/31-212    AC Q91T01.1
#=GS B5BPK8_HBV/31-212    AC B5BPK8.1
#=GS C3W4H4_HBV/2-183     AC C3W4H4.1
#=GS C7AYY6_HBV/2-185     AC C7AYY6.1
#=GS E0ZNH1_HBV/31-158    AC E0ZNH1.1
#=GS Q9E0U9_HBV/2-123     AC Q9E0U9.1
#=GS B4X6M4_HBV/31-86     AC B4X6M4.1
#=GS B4Z4W4_HBV/31-70     AC B4Z4W4.1
#=GS D3J6F3_HBV/31-70     AC D3J6F3.1
#=GS G0Z2Y7_HBV/2-121     AC G0Z2Y7.1
#=GS B0FCD9_HBV/2-183     AC B0FCD9.1
#=GS Q6J317_HBV/31-214    AC Q6J317.1
#=GS C0LKH1_HBV/2-183     AC C0LKH1.1
#=GS Q67930_HBV/2-183     AC Q67930.1
#=GS A5LG41_HBV/2-183     AC A5LG41.1
#=GS B4Z2P0_HBV/31-70     AC B4Z2P0.1
#=GS B4Z3T3_HBV/31-68     AC B4Z3T3.1
#=GS D8VBC4_HBV/2-183     AC D8VBC4.1
#=GS A9PLH7_HBV/1-39      AC A9PLH7.1
#=GS C1KT85_HBV/31-212    AC C1KT85.1
#=GS B4YT93_HBV/31-202    AC B4YT93.1
#=GS G1E827_HBV/2-183     AC G1E827.1
#=GS D0UE57_HBV/2-183     AC D0UE57.1
#=GS B4Z3C9_HBV/31-66     AC B4Z3C9.1
#=GS B4X6K3_HBV/31-87     AC B4X6K3.1
#=GS B3VBD5_HBV/2-183     AC B3VBD5.1
#=GS G1E8Q7_HBV/31-212    AC G1E8Q7.1
#=GS Q6TYF8_HBV/31-182    AC Q6TYF8.1
#=GS G1E8G4_HBV/2-183     AC G1E8G4.1
#=GS HBEAG_HBVA4/31-214   AC P17099.1
#=GS A7L342_HBV/31-190    AC A7L342.1
#=GS Q8VBI6_HBV/2-183     AC Q8VBI6.1
#=GS B3VAH9_HBV/31-212    AC B3VAH9.1
#=GS B4Z6A0_HBV/2-41      AC B4Z6A0.1
#=GS Q6TYI1_HBV/31-182    AC Q6TYI1.1
#=GS G1E7X4_HBV/2-183     AC G1E7X4.1
#=GS Q9WP95_HBV/31-104    AC Q9WP95.1
#=GS C4P135_HBV/31-76     AC C4P135.1
#=GS D8VCI3_HBV/2-36      AC D8VCI3.1
#=GS Q91A80_HBV/31-66     AC Q91A80.1
#=GS Q91SX3_HBV/31-212    AC Q91SX3.1
#=GS B4Z2V8_HBV/2-41      AC B4Z2V8.1
#=GS G8Z917_HBV/2-139     AC G8Z917.1
#=GS C9WDF3_HBV/2-183     AC C9WDF3.1
#=GS Q68057_HBV/31-212    AC Q68057.1
#=GS Q7TEC3_HBV/31-163    AC Q7TEC3.1
#=GS Q67989_HBV/2-183     AC Q67989.1
#=GS D9U5L2_HBV/31-212    AC D9U5L2.1
#=GS H9BMR7_HBV/25-191    AC H9BMR7.1
#=GS B4Z3W3_HBV/2-39      AC B4Z3W3.1
#=GS E0ZNW7_HBV/2-110     AC E0ZNW7.1
#=GS CAPSD_HBVF6/2-183    AC Q69608.1
#=GS D0EDY7_HBV/2-185     AC D0EDY7.1
#=GS C7AY34_HBV/2-185     AC C7AY34.1
#=GS C7DMU5_HBV/2-183     AC C7DMU5.1
#=GS C4P1Q7_HBV/31-76     AC C4P1Q7.1
#=GS A6MG31_HBV/2-183     AC A6MG31.1
#=GS Q5UFR9_HBV/2-183     AC Q5UFR9.1
#=GS B7TUA8_HBV/2-183     AC B7TUA8.1
#=GS Q9E0P9_HBV/2-123     AC Q9E0P9.1
#=GS D3YGJ6_HBV/31-212    AC D3YGJ6.1
#=GS Q8QSC7_HBV/31-212    AC Q8QSC7.1
#=GS C7AY28_HBV/2-185     AC C7AY28.1
#=GS B4Z442_HBV/31-68     AC B4Z442.1
#=GS C4P166_HBV/31-76     AC C4P166.1
#=GS G1C8Q0_HBV/2-183     AC G1C8Q0.1
#=GS B3VB83_HBV/2-183     AC B3VB83.1
#=GS C9WDB2_HBV/31-212    AC C9WDB2.1
#=GS B9VL36_HBV/2-183     AC B9VL36.1
#=GS B4Z669_HBV/31-70     AC B4Z669.1
#=GS Q7TEE3_HBV/31-163    AC Q7TEE3.1
#=GS D0UDX2_HBV/2-79      AC D0UDX2.1
#=GS G1E8N1_HBV/2-183     AC G1E8N1.1
#=GS F4MJJ4_HBV/31-81     AC F4MJJ4.1
#=GS D5LB95_HBV/2-183     AC D5LB95.1
#=GS H6V895_HBV/31-56     AC H6V895.1
#=GS Q9E6R9_HBV/2-183     AC Q9E6R9.1
#=GS Q5G3F6_HBV/2-25      AC Q5G3F6.1
#=GS D2JMQ9_HBV/2-183     AC D2JMQ9.1
#=GS A0FDN1_HBV/2-183     AC A0FDN1.1
#=GS B4X6K9_HBV/31-87     AC B4X6K9.1
#=GS Q2L4P0_HBV/2-183     AC Q2L4P0.1
#=GS Q7T7U8_HBV/31-212    AC Q7T7U8.1
#=GS Q2L5A7_HBV/2-20      AC Q2L5A7.1
#=GS B4Z3V0_HBV/31-68     AC B4Z3V0.1
#=GS D3J5S8_HBV/31-57     AC D3J5S8.1
#=GS E5D5N2_HBV/1-174     AC E5D5N2.1
#=GS D5LEG6_HBV/31-212    AC D5LEG6.1
#=GS Q5G3H7_HBV/31-54     AC Q5G3H7.1
#=GS B4Z5Z2_HBV/2-42      AC B4Z5Z2.1
#=GS Q9QAW9_HBVE3/31-212  AC Q9QAW9.1
#=GS Q4U253_HBV/2-183     AC Q4U253.1
#=GS Q9WFB8_9HEPA/45-305  AC Q9WFB8.1
#=GS D3J690_HBV/31-68     AC D3J690.1
#=GS D3J5M1_HBV/31-70     AC D3J5M1.1
#=GS C4P1N6_HBV/31-76     AC C4P1N6.1
#=GS B3VB74_HBV/2-183     AC B3VB74.1
#=GS D3YGQ7_HBV/2-183     AC D3YGQ7.1
#=GS Q991J9_HBV/31-88     AC Q991J9.1
#=GS B9VKA9_HBV/2-183     AC B9VKA9.1
#=GS D0EEL7_HBV/2-185     AC D0EEL7.1
#=GS C7AY88_HBV/31-214    AC C7AY88.1
#=GS E0ZNS8_HBV/31-139    AC E0ZNS8.1
#=GS C0IRW7_HBV/31-212    AC C0IRW7.1
#=GS HBEAG_HBVF6/31-212   AC P0C6I5.1
#=GS Q917H3_HBV/31-212    AC Q917H3.1
#=GS B4Z1K7_HBV/2-42      AC B4Z1K7.1
#=GS B4Z461_HBV/2-39      AC B4Z461.1
#=GS Q67991_HBV/2-183     AC Q67991.1
#=GS Q60H34_HBV/31-71     AC Q60H34.1
#=GS B0YGL5_HBV/2-183     AC B0YGL5.1
#=GS B5M630_HBV/31-212    AC B5M630.1
#=GS Q1MSW6_HBV/2-144     AC Q1MSW6.1
#=GS Q60GL3_HBVDR/2-183   AC Q60GL3.1
#=GS E0ZNU9_HBV/2-110     AC E0ZNU9.1
#=GS H9BMV1_HBV/2-168     AC H9BMV1.1
#=GS G1EIJ3_HBV/2-153     AC G1EIJ3.1
#=GS D3J641_HBV/31-88     AC D3J641.1
#=GS B7TUG0_HBV/31-212    AC B7TUG0.1
#=GS B4Z261_HBV/2-41      AC B4Z261.1
#=GS B4Z407_HBV/2-39      AC B4Z407.1
#=GS C4P178_HBV/31-76     AC C4P178.1
#=GS Q0PMK8_HBV/105-184   AC Q0PMK8.1
#=GS C7DNK6_HBV/31-212    AC C7DNK6.1
#=GS B9VKF1_HBV/31-212    AC B9VKF1.1
#=GS F2WS79_HBV/31-212    AC F2WS79.1
#=GS F4MJG4_HBV/31-81     AC F4MJG4.1
#=GS G9G8X5_HBV/31-79     AC G9G8X5.1
#=GS B0FCB0_HBV/105-183   AC B0FCB0.1
#=GS C1K1H5_HBV/31-212    AC C1K1H5.1
#=GS D0E5J3_HBV/31-212    AC D0E5J3.1
#=GS H9BMU8_HBV/25-191    AC H9BMU8.1
#=GS D3J6C4_HBV/31-70     AC D3J6C4.1
#=GS Q6XGI6_HBV/2-183     AC Q6XGI6.1
#=GS B4Z632_HBV/31-70     AC B4Z632.1
#=GS A6MG03_HBV/2-183     AC A6MG03.1
#=GS Q2L5E8_HBV/2-24      AC Q2L5E8.1
#=GS H6UN47_HBV/2-183     AC H6UN47.1
#=GS B4Z1Z4_HBV/31-70     AC B4Z1Z4.1
#=GS B4Z2U3_HBV/2-41      AC B4Z2U3.1
#=GS C4P1J3_HBV/31-76     AC C4P1J3.1
#=GS D2JMG8_HBV/2-183     AC D2JMG8.1
#=GS B4Z387_HBV/2-37      AC B4Z387.1
#=GS B9VKS6_HBV/2-183     AC B9VKS6.1
#=GS Q4FD58_HBV/31-212    AC Q4FD58.1
#=GS D8VC16_HBV/2-51      AC D8VC16.1
#=GS B4Z4V6_HBV/2-41      AC B4Z4V6.1
#=GS B7TU74_HBV/31-212    AC B7TU74.1
#=GS Q404E7_HBV/2-183     AC Q404E7.1
#=GS B0B2T9_HBV/31-212    AC B0B2T9.1
#=GS F5C039_HBV/31-53     AC F5C039.1
#=GS Q91T09_HBV/31-214    AC Q91T09.1
#=GS Q6TYG7_HBV/31-182    AC Q6TYG7.1
#=GS B4Z5T5_HBV/31-71     AC B4Z5T5.1
#=GS C4P117_HBV/31-76     AC C4P117.1
#=GS G1C965_HBV/2-183     AC G1C965.1
#=GS H6UN51_HBV/2-183     AC H6UN51.1
#=GS Q68RP5_HBV/31-212    AC Q68RP5.1
#=GS Q6I6W0_HBV/31-74     AC Q6I6W0.1
#=GS D8VC29_HBV/31-80     AC D8VC29.1
#=GS Q8JJD2_HBVH2/31-212  AC Q8JJD2.1
#=GS B4Z1X7_HBV/2-41      AC B4Z1X7.1
#=GS B5ATA1_HBV/31-212    AC B5ATA1.1
#=GS B9VK89_HBV/2-183     AC B9VK89.1
#=GS G1C8K8_HBV/31-212    AC G1C8K8.1
#=GS O90743_9HEPA/2-262   AC O90743.1
#=GS B5ATB2_HBV/31-212    AC B5ATB2.1
#=GS B5B4E9_HBV/84-151    AC B5B4E9.1
#=GS G9G9W3_HBV/2-51      AC G9G9W3.1
#=GS Q1MSN6_HBV/31-173    AC Q1MSN6.1
#=GS Q507F8_HBV/31-163    AC Q507F8.1
#=GS F4MJD9_HBV/31-81     AC F4MJD9.1
#=GS CAPSD_HBVC5/2-183    AC P69708.1
#=GS Q06483_HBV/2-183     AC Q06483.1
#=GS C7DSQ1_HBV/31-212    AC C7DSQ1.1
#=GS B9VL67_HBV/2-183     AC B9VL67.1
#=GS Q5G3G0_HBV/2-25      AC Q5G3G0.1
#=GS B6D6I4_HBV/2-69      AC B6D6I4.1
#=GS C3W4E9_HBV/2-183     AC C3W4E9.1
#=GS B4Z3U8_HBV/2-39      AC B4Z3U8.1
#=GS C1K1U2_HBV/2-91      AC C1K1U2.1
#=GS E0ZNT5_HBV/2-110     AC E0ZNT5.1
#=GS D8VCB8_HBV/31-80     AC D8VCB8.1
#=GS B7TU75_HBV/2-183     AC B7TU75.1
#=GS B2CSA5_HBV/2-183     AC B2CSA5.1
#=GS D3J5S4_HBV/31-57     AC D3J5S4.1
#=GS B2Y6I8_HBV/2-185     AC B2Y6I8.1
#=GS Q09KY2_HBV/2-20      AC Q09KY2.1
#=GS C4P0Z5_HBV/31-76     AC C4P0Z5.1
#=GS A1KR41_HBV/2-25      AC A1KR41.1
#=GS E0ZRK1_HBV/2-183     AC E0ZRK1.1
#=GS G3E557_HBV/31-212    AC G3E557.1
#=GS Q67936_HBV/31-212    AC Q67936.1
#=GS D2JMR4_HBV/2-183     AC D2JMR4.1
#=GS Q58VZ1_HBV/31-212    AC Q58VZ1.1
#=GS G1C8W9_HBV/31-212    AC G1C8W9.1
#=GS B4Z345_HBV/2-37      AC B4Z345.1
#=GS B4Z4R6_HBV/31-70     AC B4Z4R6.1
#=GS H6V5K7_HBV/2-183     AC H6V5K7.1
#=GS B0FCE5_HBV/2-183     AC B0FCE5.1
#=GS Q765E4_HBV/31-214    AC Q765E4.1
#=GS B3VAP7_HBV/2-183     AC B3VAP7.1
#=GS B1A0A9_HBV/31-212    AC B1A0A9.1
#=GS B4Z642_HBV/2-41      AC B4Z642.1
#=GS C4P163_HBV/31-76     AC C4P163.1
#=GS G0Z2V0_HBV/2-121     AC G0Z2V0.1
#=GS B5M5P8_HBV/31-212    AC B5M5P8.1
#=GS D3J646_HBV/31-89     AC D3J646.1
#=GS B4Z292_HBV/2-37      AC B4Z292.1
#=GS B4Z3Y0_HBV/31-68     AC B4Z3Y0.1
#=GS Q918J7_HBV/2-183     AC Q918J7.1
#=GS Q8B4C3_HBV/2-183     AC Q8B4C3.1
#=GS B2CFG6_HBV/31-210    AC B2CFG6.1
#=GS D3YG82_HBV/2-183     AC D3YG82.1
#=GS B4ZYX0_HBV/31-212    AC B4ZYX0.1
#=GS H6UN32_HBV/2-183     AC H6UN32.1
#=GS B4Z288_HBV/31-66     AC B4Z288.1
#=GS Q8VBH5_HBV/2-183     AC Q8VBH5.1
#=GS D3J5U8_HBV/31-89     AC D3J5U8.1
#=GS B4Z3T6_HBV/31-68     AC B4Z3T6.1
#=GS B2WSQ8_HBV/2-183     AC B2WSQ8.1
#=GS B0B2I9_HBV/31-212    AC B0B2I9.1
#=GS B6ULL3_HBV/31-212    AC B6ULL3.1
#=GS Q2EGD5_HBV/31-99     AC Q2EGD5.1
#=GS E0ZNE2_HBV/2-139     AC E0ZNE2.1
#=GS Q60GW3_HBV/31-71     AC Q60GW3.1
#=GS D3J632_HBV/31-87     AC D3J632.1
#=GS A8WE38_HBV/1-71      AC A8WE38.1
#=GS A4ZRE6_HBV/2-134     AC A4ZRE6.1
#=GS B6CIY5_HBV/31-212    AC B6CIY5.1
#=GS B4Z1I8_HBV/31-71     AC B4Z1I8.1
#=GS D8VCF0_HBV/2-37      AC D8VCF0.1
#=GS Q0PML9_HBV/31-86     AC Q0PML9.1
#=GS Q9WJE3_HBV/31-212    AC Q9WJE3.1
#=GS Q91SX8_HBV/31-212    AC Q91SX8.1
#=GS Q2PJN0_HBV/31-92     AC Q2PJN0.1
#=GS Q1HHB6_HBV/2-183     AC Q1HHB6.1
#=GS C4P1V6_HBV/31-76     AC C4P1V6.1
#=GS B4Z691_HBV/2-41      AC B4Z691.1
#=GS B4Z654_HBV/31-70     AC B4Z654.1
#=GS D6P5B5_HBV/105-183   AC D6P5B5.1
#=GS B4Z2R9_HBV/2-41      AC B4Z2R9.1
#=GS H6UGB6_HBV/2-183     AC H6UGB6.1
#=GS Q45F45_HBV/2-183     AC Q45F45.1
#=GS C1K162_HBV/2-183     AC C1K162.1
#=GS D3J6G6_HBV/31-70     AC D3J6G6.1
#=GS D8VBL6_HBV/31-80     AC D8VBL6.1
#=GS B5A2I9_HBV/2-183     AC B5A2I9.1
#=GS HBEAG_HBVF1/31-212   AC Q05495.1
#=GS E0ZND0_HBV/2-153     AC E0ZND0.1
#=GS Q09L09_HBV/2-20      AC Q09L09.1
#=GS B9VKP5_HBV/2-183     AC B9VKP5.1
#=GS D9U5B8_HBV/2-89      AC D9U5B8.1
#=GS Q09GN9_HBV/31-212    AC Q09GN9.1
#=GS Q1MSQ1_HBV/31-173    AC Q1MSQ1.1
#=GS C1KTA0_HBV/31-210    AC C1KTA0.1
#=GS D6QVZ0_HBV/2-183     AC D6QVZ0.1
#=GS I0DG40_HBV/31-212    AC I0DG40.1
#=GS B2Y6Y6_HBV/31-212    AC B2Y6Y6.1
#=GS Q1T7D6_HBV/2-183     AC Q1T7D6.1
#=GS Q6R7N0_HBV/14-151    AC Q6R7N0.1
#=GS Q45F54_HBV/2-183     AC Q45F54.1
#=GS G3E5B4_HBV/2-183     AC G3E5B4.1
#=GS C3W4F5_HBV/2-183     AC C3W4F5.1
#=GS C7AYS3_HBV/2-185     AC C7AYS3.1
#=GS Q6I6U0_HBV/31-71     AC Q6I6U0.1
#=GS B5ATD5_HBV/112-177   AC B5ATD5.1
#=GS D9U580_HBV/82-153    AC D9U580.1
#=GS A9CM44_HBV/2-183     AC A9CM44.1
#=GS Q19T07_HBV/2-183     AC Q19T07.1
#=GS Q8VBG5_HBV/2-185     AC Q8VBG5.1
#=GS E5D5N4_HBV/1-176     AC E5D5N4.1
#=GS B4Z1T1_HBV/31-79     AC B4Z1T1.1
#=GS B6D6G2_HBV/2-52      AC B6D6G2.1
#=GS HBEAG_HBVA7/31-214   AC O91532.1
#=GS C1KTB2_HBV/31-210    AC C1KTB2.1
#=GS D6QVU1_HBV/31-212    AC D6QVU1.1
#=GS Q80BT6_HBV/2-183     AC Q80BT6.1
#=GS B4Z3P7_HBV/31-68     AC B4Z3P7.1
#=GS G9I1Z8_HBV/31-212    AC G9I1Z8.1
#=GS H1ACZ1_HBV/2-183     AC H1ACZ1.1
#=GS B4Z1W8_HBV/2-41      AC B4Z1W8.1
#=GS F1AEQ7_HBV/2-185     AC F1AEQ7.1
#=GS B4Z4K1_HBV/2-41      AC B4Z4K1.1
#=GS C4P1U6_HBV/31-76     AC C4P1U6.1
#=GS Q8QP13_HBV/1-130     AC Q8QP13.1
#=GS G0Z2W6_HBV/2-121     AC G0Z2W6.1
#=GS B4Z2S3_HBV/2-41      AC B4Z2S3.1
#=GS Q5G3I3_HBV/2-25      AC Q5G3I3.1
#=GS C5WJU9_HBV/31-212    AC C5WJU9.1
#=GS B7TV99_HBV/2-183     AC B7TV99.1
#=GS D3J5X2_HBV/31-76     AC D3J5X2.1
#=GS E5D5N9_HBV/1-174     AC E5D5N9.1
#=GS D3J5V5_HBV/31-88     AC D3J5V5.1
#=GS Q7THR2_HBV/2-74      AC Q7THR2.1
#=GS Q80JB0_HBV/76-154    AC Q80JB0.1
#=GS B7TUD0_HBV/2-183     AC B7TUD0.1
#=GS Q67899_HBV/2-166     AC Q67899.1
#=GS Q2L5H4_HBV/2-24      AC Q2L5H4.1
#=GS D3J662_HBV/31-76     AC D3J662.1
#=GS Q67964_HBV/2-183     AC Q67964.1
#=GS D8VBS7_HBV/31-80     AC D8VBS7.1
#=GS C4P1S5_HBV/31-76     AC C4P1S5.1
#=GS B4Z2Z8_HBV/31-66     AC B4Z2Z8.1
#=GS Q404F9_HBV/2-183     AC Q404F9.1
#=GS D2JMC9_HBV/31-212    AC D2JMC9.1
#=GS Q8JXH5_HBV/14-195    AC Q8JXH5.1
#=GS Q7TDY5_HBV/2-183     AC Q7TDY5.1
#=GS C4P1I8_HBV/31-76     AC C4P1I8.1
#=GS B6ULK2_HBV/31-83     AC B6ULK2.1
#=GS B4Z3F0_HBV/31-71     AC B4Z3F0.1
#=GS Q6XEA8_HBV/2-183     AC Q6XEA8.1
#=GS A7YEX7_HBV/31-212    AC A7YEX7.1
#=GS D8VCH6_HBV/2-36      AC D8VCH6.1
#=GS B4Z1U3_HBV/31-80     AC B4Z1U3.1
#=GS Q7TF62_HBV/71-127    AC Q7TF62.1
#=GS Q91SZ0_HBV/31-212    AC Q91SZ0.1
#=GS B4X6I3_HBV/31-87     AC B4X6I3.1
#=GS B3VBB6_HBV/2-183     AC B3VBB6.1
#=GS Q9WMC7_HBV/31-212    AC Q9WMC7.1
#=GS Q45F14_HBV/31-212    AC Q45F14.1
#=GS G0Z2V3_HBV/2-121     AC G0Z2V3.1
#=GS G1EIK2_HBV/2-153     AC G1EIK2.1
#=GS E0ZNI3_HBV/31-182    AC E0ZNI3.1
#=GS B4Z1K1_HBV/2-42      AC B4Z1K1.1
#=GS Q1HHA4_HBV/2-183     AC Q1HHA4.1
#=GS C7AYP3_HBV/2-185     AC C7AYP3.1
#=GS C7G300_HBV/2-183     AC C7G300.1
#=GS C4P1T5_HBV/31-76     AC C4P1T5.1
#=GS B6D6I9_HBV/2-25      AC B6D6I9.1
#=GS Q769H4_HBV/31-212    AC Q769H4.1
#=GS Q6I6S2_HBV/31-74     AC Q6I6S2.1
#=GS Q8BCB5_HBV/2-185     AC Q8BCB5.1
#=GS B4Z1S8_HBV/31-80     AC B4Z1S8.1
#=GS C7DM77_HBV/2-183     AC C7DM77.1
#=GS D0EEK2_HBV/31-214    AC D0EEK2.1
#=GS G1C972_HBV/2-183     AC G1C972.1
#=GS Q4FDA4_HBV/31-212    AC Q4FDA4.1
#=GS E0ZP24_HBV/2-110     AC E0ZP24.1
#=GS Q6I6T6_HBV/31-71     AC Q6I6T6.1
#=GS B5ATE0_HBV/31-212    AC B5ATE0.1
#=GS D3J5X3_HBV/31-71     AC D3J5X3.1
#=GS HBEAG_HBVCJ/31-212   AC P0C767.1
#=GS Q1PCZ3_HBV/31-212    AC Q1PCZ3.1
#=GS F2WS91_HBV/31-212    AC F2WS91.1
#=GS Q89622_HBV/2-183     AC Q89622.1
#=GS B2WSS1_HBV/31-212    AC B2WSS1.1
#=GS Q7TF69_HBV/31-212    AC Q7TF69.1
#=GS D8VC24_HBV/2-51      AC D8VC24.1
#=GS D3J5Z6_HBV/31-80     AC D3J5Z6.1
#=GS C4P1R1_HBV/31-76     AC C4P1R1.1
#=GS Q8JNW3_HBV/31-214    AC Q8JNW3.1
#=GS Q60GV0_HBV/31-71     AC Q60GV0.1
#=GS G9MD77_HBV/2-183     AC G9MD77.1
#=GS D3J6C8_HBV/31-70     AC D3J6C8.1
#=GS B4X6K8_HBV/31-87     AC B4X6K8.1
#=GS B6ULF9_HBV/31-212    AC B6ULF9.1
#=GS B4Z2H8_HBV/2-37      AC B4Z2H8.1
#=GS C7AYV1_HBV/31-214    AC C7AYV1.1
#=GS Q9QB01_HBV/2-183     AC Q9QB01.1
#=GS C4P1B8_HBV/31-76     AC C4P1B8.1
#=GS Q769J2_HBV/31-212    AC Q769J2.1
#=GS D0UDY1_HBV/2-183     AC D0UDY1.1
#=GS D0E678_HBV/31-212    AC D0E678.1
#=GS B6CIY2_HBV/31-214    AC B6CIY2.1
#=GS G1E8K5_HBV/2-183     AC G1E8K5.1
#=GS B4Z2D8_HBV/31-66     AC B4Z2D8.1
#=GS Q2HWF3_HBV/31-212    AC Q2HWF3.1
#=GS A9PLF6_HBV/1-39      AC A9PLF6.1
#=GS B4Z332_HBV/31-66     AC B4Z332.1
#=GS B4Z3Y9_HBV/31-68     AC B4Z3Y9.1
#=GS G3E579_HBV/2-183     AC G3E579.1
#=GS E0ZRT4_HBV/2-183     AC E0ZRT4.1
#=GS H9BMV5_HBV/1-146     AC H9BMV5.1
#=GS Q99HT8_HBV/2-183     AC Q99HT8.1
#=GS Q9E946_HBV/31-212    AC Q9E946.1
#=GS Q7TEC8_HBV/31-163    AC Q7TEC8.1
#=GS HBEAG_HBVGB/31-212   AC P89951.1
#=GS Q9QAE1_HBV/2-183     AC Q9QAE1.1
#=GS I0DG32_HBV/31-212    AC I0DG32.1
#=GS C3W4I0_HBV/2-183     AC C3W4I0.1
#=GS B7TUU7_HBV/2-183     AC B7TUU7.1
#=GS D9U5B7_HBV/31-118    AC D9U5B7.1
#=GS Q9IHD0_HBV/2-183     AC Q9IHD0.1
#=GS Q76EC1_HBV/2-183     AC Q76EC1.1
#=GS D9U569_HBV/2-183     AC D9U569.1
#=GS B3IVL7_HBV/31-212    AC B3IVL7.1
#=GS G1E7G4_HBV/2-183     AC G1E7G4.1
#=GS B5ASR1_HBV/2-183     AC B5ASR1.1
#=GS D8VBV4_HBV/2-37      AC D8VBV4.1
#=GS Q68008_HBV/2-183     AC Q68008.1
#=GS D3J694_HBV/31-74     AC D3J694.1
#=GS HBEAG_HBVH3/31-212   AC Q8JMZ4.1
#=GS B6ULL6_HBV/31-212    AC B6ULL6.1
#=GS C4P1T7_HBV/31-76     AC C4P1T7.1
#=GS D3J5N5_HBV/31-57     AC D3J5N5.1
#=GS E0ZND5_HBV/31-182    AC E0ZND5.1
#=GS B4Z5Y0_HBV/2-42      AC B4Z5Y0.1
#=GS B4Z3A7_HBV/31-66     AC B4Z3A7.1
#=GS B4X6M7_HBV/31-86     AC B4X6M7.1
#=GS C4P173_HBV/31-76     AC C4P173.1
#=GS Q4FDC8_HBV/31-212    AC Q4FDC8.1
#=GS Q6XGK8_HBV/31-214    AC Q6XGK8.1
#=GS A8WE39_HBV/16-177    AC A8WE39.1
#=GS Q45F30_HBV/2-183     AC Q45F30.1
#=GS B7TV02_HBV/2-183     AC B7TV02.1
#=GS B5B491_HBV/2-183     AC B5B491.1
#=GS B4Z667_HBV/2-41      AC B4Z667.1
#=GS B9VKN5_HBV/31-212    AC B9VKN5.1
#=GS D3J5W5_HBV/31-80     AC D3J5W5.1
#=GS Q5R2Q4_HBV/2-183     AC Q5R2Q4.1
#=GS Q9WP73_HBV/31-107    AC Q9WP73.1
#=GS Q8QSC1_HBV/31-212    AC Q8QSC1.1
#=GS D0EDY0_HBV/2-185     AC D0EDY0.1
#=GS B7TTD9_HBV/2-183     AC B7TTD9.1
#=GS Q1MSQ9_HBV/31-173    AC Q1MSQ9.1
#=GS D9U5F9_HBV/2-183     AC D9U5F9.1
#=GS A7L343_HBV/2-161     AC A7L343.1
#=GS Q9E0T1_HBV/2-123     AC Q9E0T1.1
#=GS E0ZNV5_HBV/2-24      AC E0ZNV5.1
#=GS Q4FD74_HBV/31-212    AC Q4FD74.1
#=GS D5MSG2_HBV/2-183     AC D5MSG2.1
#=GS Q5G3K0_HBV/31-54     AC Q5G3K0.1
#=GS B4Z4K5_HBV/31-70     AC B4Z4K5.1
#=GS C4P128_HBV/31-76     AC C4P128.1
#=GS B7TUK5_HBV/2-183     AC B7TUK5.1
#=GS A3F6I8_HBV/31-106    AC A3F6I8.1
#=GS H2ER94_HBV/31-212    AC H2ER94.1
#=GS B5M5V4_HBV/31-212    AC B5M5V4.1
#=GS D6QVG8_HBV/2-183     AC D6QVG8.1
#=GS Q6X5H4_HBV/2-183     AC Q6X5H4.1
#=GS Q6J326_HBV/31-214    AC Q6J326.1
#=GS Q8QP18_HBV/1-130     AC Q8QP18.1
#=GS B4Z258_HBV/2-41      AC B4Z258.1
#=GS D3J6H3_HBV/31-70     AC D3J6H3.1
#=GS B6D6C1_HBV/2-66      AC B6D6C1.1
#=GS I0DG87_HBV/31-212    AC I0DG87.1
#=GS A9PLD2_HBV/1-39      AC A9PLD2.1
#=GS Q6UFV9_HBV/1-147     AC Q6UFV9.1
#=GS B7TTC6_HBV/31-212    AC B7TTC6.1
#=GS D8VBF4_HBV/31-159    AC D8VBF4.1
#=GS Q2EGE3_HBV/31-99     AC Q2EGE3.1
#=GS B4Z3Q9_HBV/31-68     AC B4Z3Q9.1
#=GS A1KR45_HBV/2-25      AC A1KR45.1
#=GS G0Z2Y2_HBV/2-121     AC G0Z2Y2.1
#=GS B2CY34_HBV/31-212    AC B2CY34.1
#=GS B4Z4R9_HBV/31-70     AC B4Z4R9.1
#=GS Q0PML4_HBV/104-184   AC Q0PML4.1
#=GS B2LRU9_HBV/2-183     AC B2LRU9.1
#=GS C7DSL5_HBV/31-212    AC C7DSL5.1
#=GS B4Z4N0_HBV/31-70     AC B4Z4N0.1
#=GS D6P5A8_HBV/31-212    AC D6P5A8.1
#=GS E0ZNC2_HBV/2-153     AC E0ZNC2.1
#=GS B6D685_HBV/31-106    AC B6D685.1
#=GS Q6I6V6_HBV/31-74     AC Q6I6V6.1
#=GS Q1MSN2_HBV/31-110    AC Q1MSN2.1
#=GS B9VL16_HBV/31-212    AC B9VL16.1
#=GS D0UDW2_HBV/31-212    AC D0UDW2.1
#=GS C4P1F9_HBV/31-76     AC C4P1F9.1
#=GS D3J5M2_HBV/31-70     AC D3J5M2.1
#=GS G1ETT8_HBV/2-183     AC G1ETT8.1
#=GS D8VC21_HBV/31-54     AC D8VC21.1
#=GS D3J5M3_HBV/31-70     AC D3J5M3.1
#=GS Q91SZ5_HBV/31-212    AC Q91SZ5.1
#=GS C7AYP2_HBV/31-214    AC C7AYP2.1
#=GS F5C066_HBV/31-212    AC F5C066.1
#=GS Q1T7C4_HBV/2-183     AC Q1T7C4.1
#=GS G9BNJ1_HBV/31-214    AC G9BNJ1.1
#=GS B0B2Q0_HBV/2-183     AC B0B2Q0.1
#=GS Q4AE53_HBV/31-212    AC Q4AE53.1
#=GS D0VXG8_HBV/2-183     AC D0VXG8.1
#=GS Q9E0T5_HBV/2-123     AC Q9E0T5.1
#=GS D6QVP0_HBV/2-183     AC D6QVP0.1
#=GS B3VAV4_HBV/2-183     AC B3VAV4.1
#=GS B4Z3P4_HBV/31-68     AC B4Z3P4.1
#=GS B2LSM1_HBV/2-183     AC B2LSM1.1
#=GS B4Z657_HBV/31-70     AC B4Z657.1
#=GS Q80GW6_HBV/31-115    AC Q80GW6.1
#=GS H9BMU9_HBV/2-168     AC H9BMU9.1
#=GS B3VB33_HBV/2-183     AC B3VB33.1
#=GS D3J5S9_HBV/31-57     AC D3J5S9.1
#=GS Q917H6_HBV/2-183     AC Q917H6.1
#=GS Q6XE96_HBV/2-185     AC Q6XE96.1
#=GS B3VAK0_HBV/2-183     AC B3VAK0.1
#=GS C4P182_HBV/31-76     AC C4P182.1
#=GS Q1MSV3_HBV/31-173    AC Q1MSV3.1
#=GS Q00K45_HBV/2-183     AC Q00K45.1
#=GS G3E585_HBV/31-212    AC G3E585.1
#=GS Q8QTM0_HBV/14-195    AC Q8QTM0.1
#=GS D8VBP0_HBV/2-51      AC D8VBP0.1
#=GS B4Z1M4_HBV/2-42      AC B4Z1M4.1
#=GS C7AY55_HBV/31-214    AC C7AY55.1
#=GS Q91SZ4_HBV/31-212    AC Q91SZ4.1
#=GS D4I4S1_HBV/2-185     AC D4I4S1.1
#=GS A4F535_HBV/2-41      AC A4F535.1
#=GS Q917I4_HBV/2-183     AC Q917I4.1
#=GS B4Z681_HBV/31-70     AC B4Z681.1
#=GS B4X6M1_HBV/31-86     AC B4X6M1.1
#=GS B4Z3H9_HBV/2-42      AC B4Z3H9.1
#=GS B5BPT4_HBV/2-183     AC B5BPT4.1
#=GS Q8VBI2_HBV/2-183     AC Q8VBI2.1
#=GS Q4FDE0_HBV/31-212    AC Q4FDE0.1
#=GS H2ERG0_HBV/31-108    AC H2ERG0.1
#=GS Q09L12_HBV/2-20      AC Q09L12.1
#=GS A5HKP9_HBV/31-212    AC A5HKP9.1
#=GS G8H3G0_HBV/2-131     AC G8H3G0.1
#=GS H9BMR5_HBV/25-191    AC H9BMR5.1
#=GS I0DG28_HBV/31-212    AC I0DG28.1
#=GS G1C8T5_HBV/2-183     AC G1C8T5.1
#=GS B7TV82_HBV/31-212    AC B7TV82.1
#=GS C4P140_HBV/31-76     AC C4P140.1
#=GS G9G9A3_HBV/2-183     AC G9G9A3.1
#=GS B4Z1V5_HBV/31-69     AC B4Z1V5.1
#=GS E0ZNB3_HBV/31-171    AC E0ZNB3.1
#=GS D5LBC2_HBV/31-212    AC D5LBC2.1
#=GS Q765C6_HBV/31-214    AC Q765C6.1
#=GS D3J603_HBV/31-80     AC D3J603.1
#=GS B1PI57_9HEPA/35-295  AC B1PI57.1
#=GS Q60H26_HBV/31-71     AC Q60H26.1
#=GS D8VCC6_HBV/2-51      AC D8VCC6.1
#=GS E5RN30_HBV/1-162     AC E5RN30.1
#=GS D0EEI9_HBV/2-185     AC D0EEI9.1
#=GS Q9QRQ9_HBV/2-133     AC Q9QRQ9.1
#=GS Q3ZKJ1_HBV/31-212    AC Q3ZKJ1.1
#=GS Q9QAD5_HBV/2-183     AC Q9QAD5.1
#=GS B4Z2W7_HBV/2-41      AC B4Z2W7.1
#=GS F4MJH2_HBV/31-81     AC F4MJH2.1
#=GS D9U579_HBV/31-118    AC D9U579.1
#=GS B3VBD0_HBV/2-183     AC B3VBD0.1
#=GS Q910U3_HBV/31-212    AC Q910U3.1
#=GS D3J6F2_HBV/31-70     AC D3J6F2.1
#=GS B4Z3V4_HBV/2-39      AC B4Z3V4.1
#=GS Q8QP24_HBV/1-130     AC Q8QP24.1
#=GS D8VBX9_HBV/2-51      AC D8VBX9.1
#=GS D4I4U3_HBV/2-185     AC D4I4U3.1
#=GS B4Z3J1_HBV/2-39      AC B4Z3J1.1
#=GS D2U668_HBV/2-183     AC D2U668.1
#=GS G9G9U8_HBV/31-212    AC G9G9U8.1
#=GS B2Y6J1_HBV/2-185     AC B2Y6J1.1
#=GS G9G9S4_HBV/2-183     AC G9G9S4.1
#=GS Q91T04_HBV/31-212    AC Q91T04.1
#=GS Q19SW1_HBV/2-183     AC Q19SW1.1
#=GS C7AY95_HBV/2-185     AC C7AY95.1
#=GS Q29VF6_HBV/31-212    AC Q29VF6.1
#=GS Q69377_HBV/1-65      AC Q69377.1
#=GS D4HMY0_HBV/1-77      AC D4HMY0.1
#=GS Q09KS5_HBV/2-20      AC Q09KS5.1
#=GS B8PTE4_HBV/2-183     AC B8PTE4.1
#=GS C7DMT0_HBV/31-212    AC C7DMT0.1
#=GS CAPSD_HBVD1/2-183    AC P03147.1
#=GS CAPSD_HBVD1/2-183    DR PDB; 2QIJ C; 3-142;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS F; 2-142;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G34 B; 2-147;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS E; 2-143;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2QIJ D; 3-143;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G34 D; 2-144;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS B; 2-142;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G33 C; 2-147;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G34 C; 2-147;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS C; 2-142;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G33 A; 2-148;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G33 D; 2-146;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G33 B; 2-147;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2QIJ A; 3-142;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS A; 2-140;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2G34 A; 2-144;
#=GS CAPSD_HBVD1/2-183    DR PDB; 2QIJ B; 3-143;
#=GS CAPSD_HBVD1/2-183    DR PDB; 3KXS D; 2-141;
#=GS C4P1H6_HBV/31-76     AC C4P1H6.1
#=GS G1C8S8_HBV/2-183     AC G1C8S8.1
#=GS C3W4G1_HBV/2-183     AC C3W4G1.1
#=GS G8H3F3_HBV/2-131     AC G8H3F3.1
#=GS Q45F20_HBV/2-183     AC Q45F20.1
#=GS F5C080_HBV/2-183     AC F5C080.1
#=GS B4Z485_HBV/2-39      AC B4Z485.1
#=GS D3J5N0_HBV/31-70     AC D3J5N0.1
#=GS B5M593_HBV/31-212    AC B5M593.1
#=GS H2ERG7_HBV/2-183     AC H2ERG7.1
#=GS G9IAM2_HBV/2-187     AC G9IAM2.1
#=GS Q9WMD1_HBV/31-212    AC Q9WMD1.1
#=GS Q1MSS3_HBV/31-173    AC Q1MSS3.1
#=GS B9VL63_HBV/31-212    AC B9VL63.1
#=GS B6DQE5_HBV/2-184     AC B6DQE5.1
#=GS G0Z2X6_HBV/2-121     AC G0Z2X6.1
#=GS C4P115_HBV/31-76     AC C4P115.1
#=GS Q2PXI4_HBV/31-150    AC Q2PXI4.1
#=GS B4Z2Z5_HBV/31-66     AC B4Z2Z5.1
#=GS Q5G3G1_HBV/31-54     AC Q5G3G1.1
#=GS D0EYW4_HBV/2-157     AC D0EYW4.1
#=GS C4P1L4_HBV/31-76     AC C4P1L4.1
#=GS D3TK68_HBV/2-57      AC D3TK68.1
#=GS E5CZ01_HBV/2-183     AC E5CZ01.1
#=GS B3VB88_HBV/2-183     AC B3VB88.1
#=GS B4Z3Y4_HBV/2-39      AC B4Z3Y4.1
#=GS E5RD32_HBV/31-212    AC E5RD32.1
#=GS B3VB29_HBV/2-183     AC B3VB29.1
#=GS B4Z378_HBV/2-37      AC B4Z378.1
#=GS D0E6F1_HBV/31-212    AC D0E6F1.1
#=GS H2ERD6_HBV/31-212    AC H2ERD6.1
#=GS B5BPG8_HBV/31-212    AC B5BPG8.1
#=GS H9BMW1_HBV/24-182    AC H9BMW1.1
#=GS Q9E0Q5_HBV/2-123     AC Q9E0Q5.1
#=GS Q9E9B5_HBV/2-183     AC Q9E9B5.1
#=GS D8VB77_HBV/2-41      AC D8VB77.1
#=GS B3VB07_HBV/2-183     AC B3VB07.1
#=GS B6ULK7_HBV/31-212    AC B6ULK7.1
#=GS Q6TYI2_HBV/31-182    AC Q6TYI2.1
#=GS B4Z3R3_HBV/2-39      AC B4Z3R3.1
#=GS H2ERD7_HBV/2-183     AC H2ERD7.1
#=GS B3VAL3_HBV/2-183     AC B3VAL3.1
#=GS Q1MSR4_HBV/31-173    AC Q1MSR4.1
#=GS C1K1R9_HBV/31-212    AC C1K1R9.1
#=GS Q68037_HBV/2-183     AC Q68037.1
#=GS Q6UE46_HBV/2-183     AC Q6UE46.1
#=GS G1EII1_HBV/2-153     AC G1EII1.1
#=GS D4HMY1_HBV/1-79      AC D4HMY1.1
#=GS Q6UE50_HBV/2-183     AC Q6UE50.1
#=GS Q9WMB8_HBV/31-212    AC Q9WMB8.1
#=GS D5LB81_HBV/2-183     AC D5LB81.1
#=GS D0UDV8_HBV/2-183     AC D0UDV8.1
#=GS D8VC30_HBV/2-51      AC D8VC30.1
#=GS D3J672_HBV/31-68     AC D3J672.1
#=GS B5M5Y7_HBV/31-212    AC B5M5Y7.1
#=GS C7AYA9_HBV/31-214    AC C7AYA9.1
#=GS CAPSD_HPBDW/2-262    AC P0C6K2.1
#=GS A0FDM4_HBV/2-183     AC A0FDM4.1
#=GS F5C1Q4_HBV/43-224    AC F5C1Q4.1
#=GS Q8VBG4_HBV/2-185     AC Q8VBG4.1
#=GS Q60H22_HBV/31-71     AC Q60H22.1
#=GS D3J5U7_HBV/31-88     AC D3J5U7.1
#=GS G1E7M1_HBV/2-183     AC G1E7M1.1
#=GS B5LIJ9_HBV/31-191    AC B5LIJ9.1
#=GS H6UGS1_HBV/2-183     AC H6UGS1.1
#=GS D8VC59_HBV/2-51      AC D8VC59.1
#=GS G9I484_9HEPA/2-250   AC G9I484.1
#=GS A8WE41_HBV/16-179    AC A8WE41.1
#=GS D6QVY2_HBV/31-212    AC D6QVY2.1
#=GS B4Z1P7_HBV/31-71     AC B4Z1P7.1
#=GS O39670_HBV/1-165     AC O39670.1
#=GS B4Z4U1_HBV/2-41      AC B4Z4U1.1
#=GS H6UGD6_HBV/2-183     AC H6UGD6.1
#=GS G0Z2Y0_HBV/2-121     AC G0Z2Y0.1
#=GS Q4FDA0_HBV/31-212    AC Q4FDA0.1
#=GS Q8QP30_HBV/1-130     AC Q8QP30.1
#=GS D3J645_HBV/31-84     AC D3J645.1
#=GS Q2EGE1_HBV/31-99     AC Q2EGE1.1
#=GS B9VAY4_HBV/2-183     AC B9VAY4.1
#=GS Q2EGD6_HBV/31-99     AC Q2EGD6.1
#=GS B7TV07_HBV/31-212    AC B7TV07.1
#=GS B4Z366_HBV/2-37      AC B4Z366.1
#=GS D3TK48_HBV/31-212    AC D3TK48.1
#=GS F1AEQ6_HBV/31-214    AC F1AEQ6.1
#=GS Q2F4Z0_HBV/31-212    AC Q2F4Z0.1
#=GS B5B4I0_HBV/31-212    AC B5B4I0.1
#=GS B0B392_HBV/31-176    AC B0B392.1
#=GS B0FD16_HBV/2-183     AC B0FD16.1
#=GS Q2EGG1_HBV/31-99     AC Q2EGG1.1
#=GS G0Z309_HBV/2-121     AC G0Z309.1
#=GS C3V8M2_HBV/2-78      AC C3V8M2.1
#=GS G9MD72_HBV/2-183     AC G9MD72.1
#=GS Q80H15_HBV/2-140     AC Q80H15.1
#=GS B7TUD9_HBV/31-212    AC B7TUD9.1
#=GS B7TV76_HBV/2-183     AC B7TV76.1
#=GS D8VBZ8_HBV/31-80     AC D8VBZ8.1
#=GS C7DN35_HBV/2-183     AC C7DN35.1
#=GS A9PLD7_HBV/1-39      AC A9PLD7.1
#=GS Q2TJD6_HBV/31-214    AC Q2TJD6.1
#=GS B4X6J3_HBV/31-87     AC B4X6J3.1
#=GS E0ZN82_HBV/31-182    AC E0ZN82.1
#=GS B7TTR8_HBV/2-183     AC B7TTR8.1
#=GS Q9E9A3_HBV/31-110    AC Q9E9A3.1
#=GS B6D690_HBV/31-68     AC B6D690.1
#=GS E0ZNU2_HBV/2-110     AC E0ZNU2.1
#=GS Q9QB18_HBV/2-183     AC Q9QB18.1
#=GS B0B356_HBV/2-183     AC B0B356.1
#=GS Q1XHG3_HBV/31-214    AC Q1XHG3.1
#=GS B4YL36_HBV/2-183     AC B4YL36.1
#=GS C4P143_HBV/31-76     AC C4P143.1
#=GS Q6QJC8_9HEPA/2-262   AC Q6QJC8.1
#=GS B5BUV1_HBV/31-214    AC B5BUV1.1
#=GS F5C1P0_HBV/33-214    AC F5C1P0.1
#=GS Q68027_HBV/2-183     AC Q68027.1
#=GS G1C905_HBV/2-183     AC G1C905.1
#=GS Q91SX7_HBV/31-212    AC Q91SX7.1
#=GS F4MJD0_HBV/31-81     AC F4MJD0.1
#=GS C7DMS4_HBV/2-183     AC C7DMS4.1
#=GS C7DM37_HBV/2-183     AC C7DM37.1
#=GS D5LCH2_HBV/2-183     AC D5LCH2.1
#=GS D8VBV6_HBV/31-65     AC D8VBV6.1
#=GS B4Z4V0_HBV/2-41      AC B4Z4V0.1
#=GS D3J5M7_HBV/31-70     AC D3J5M7.1
#=GS B4Z4P6_HBV/2-41      AC B4Z4P6.1
#=GS D0EEN6_HBV/31-214    AC D0EEN6.1
#=GS Q917J0_HBV/2-183     AC Q917J0.1
#=GS Q8B4G3_HBV/2-185     AC Q8B4G3.1
#=GS B4X6L0_HBV/30-86     AC B4X6L0.1
#=GS B3VB19_HBV/2-183     AC B3VB19.1
#=GS Q81095_HBV/2-185     AC Q81095.1
#=GS D5LDK6_HBV/31-212    AC D5LDK6.1
#=GS Q09L31_HBV/2-20      AC Q09L31.1
#=GS Q1MSS8_HBV/31-173    AC Q1MSS8.1
#=GS B4Z3I5_HBV/2-39      AC B4Z3I5.1
#=GS A9PLF5_HBV/1-39      AC A9PLF5.1
#=GS D3J6B5_HBV/31-70     AC D3J6B5.1
#=GS D8VBZ6_HBV/2-51      AC D8VBZ6.1
#=GS D6QVF4_HBV/2-182     AC D6QVF4.1
#=GS A4ZRF0_HBV/31-163    AC A4ZRF0.1
#=GS C4P1N4_HBV/31-76     AC C4P1N4.1
#=GS B5M5L1_HBV/31-212    AC B5M5L1.1
#=GS B4Z399_HBV/2-37      AC B4Z399.1
#=GS G1C8H5_HBV/2-183     AC G1C8H5.1
#=GS H1ACV1_HBV/2-183     AC H1ACV1.1
#=GS C1K1I2_HBV/31-212    AC C1K1I2.1
#=GS D3TK75_HBV/53-106    AC D3TK75.1
#=GS B5AT63_HBV/2-183     AC B5AT63.1
#=GS F1AES4_HBV/31-214    AC F1AES4.1
#=GS B4Z4J8_HBV/2-41      AC B4Z4J8.1
#=GS G1EII2_HBV/2-153     AC G1EII2.1
#=GS D6QW17_HBV/2-183     AC D6QW17.1
#=GS Q2LCA1_HBV/2-183     AC Q2LCA1.1
#=GS E0D394_HBV/31-82     AC E0D394.1
#=GS B5B479_HBV/2-183     AC B5B479.1
#=GS Q45F26_HBV/2-183     AC Q45F26.1
#=GS H9BMT3_HBV/2-166     AC H9BMT3.1
#=GS B9VL55_HBV/31-212    AC B9VL55.1
#=GS F4MJC6_HBV/31-81     AC F4MJC6.1
#=GS D3GIM4_HBV/2-183     AC D3GIM4.1
#=GS D3J6B7_HBV/31-70     AC D3J6B7.1
#=GS E0ZRW2_HBV/2-183     AC E0ZRW2.1
#=GS G1EIF9_HBV/2-183     AC G1EIF9.1
#=GS Q03732_HBV/49-230    AC Q03732.1
#=GS Q76B10_HBV/31-212    AC Q76B10.1
#=GS B5ATD1_HBV/2-183     AC B5ATD1.1
#=GS C1K1Q0_HBV/2-183     AC C1K1Q0.1
#=GS H9BMS8_HBV/24-182    AC H9BMS8.1
#=GS B5ASV7_HBV/31-212    AC B5ASV7.1
#=GS Q5U7U0_HBV/31-212    AC Q5U7U0.1
#=GS A9PLF0_HBV/1-39      AC A9PLF0.1
#=GS C7AYX5_HBV/2-185     AC C7AYX5.1
#=GS G9G9M8_HBV/2-183     AC G9G9M8.1
#=GS Q81147_HBV/31-111    AC Q81147.1
#=GS C4P1L7_HBV/31-76     AC C4P1L7.1
#=GS D0EEK9_HBV/31-214    AC D0EEK9.1
#=GS C4P1C7_HBV/31-76     AC C4P1C7.1
#=GS Q60GY6_HBV/31-71     AC Q60GY6.1
#=GS Q306G8_HBV/31-212    AC Q306G8.1
#=GS Q991K0_HBV/31-212    AC Q991K0.1
#=GS C4P1R4_HBV/31-76     AC C4P1R4.1
#=GS D5L237_9HEPA/39-225  AC D5L237.1
#=GS B6D691_HBV/2-39      AC B6D691.1
#=GS Q7TDP3_HBV/2-183     AC Q7TDP3.1
#=GS Q80MQ5_HBV/31-212    AC Q80MQ5.1
#=GS D5LCM6_HBV/31-212    AC D5LCM6.1
#=GS E0ZNX9_HBV/2-110     AC E0ZNX9.1
#=GS C6FHW9_HBV/2-185     AC C6FHW9.1
#=GS B9VK58_HBV/2-183     AC B9VK58.1
#=GS B0YGI9_HBV/31-214    AC B0YGI9.1
#=GS C7AYC3_HBV/31-214    AC C7AYC3.1
#=GS D0E5Y2_HBV/31-212    AC D0E5Y2.1
#=GS B4Z3K6_HBV/2-39      AC B4Z3K6.1
#=GS D3YGL5_HBV/2-183     AC D3YGL5.1
#=GS B4Z4L3_HBV/2-41      AC B4Z4L3.1
#=GS E7FK65_HBV/2-183     AC E7FK65.1
#=GS B2Y6V9_HBV/2-183     AC B2Y6V9.1
#=GS E0ZRY0_HBV/2-183     AC E0ZRY0.1
#=GS D2JMQ0_HBV/2-183     AC D2JMQ0.1
#=GS D4I4R7_HBV/2-183     AC D4I4R7.1
#=GS Q80GW6_HBV/112-173   AC Q80GW6.1
#=GS H6UN36_HBV/2-183     AC H6UN36.1
#=GS B0B354_HBV/2-183     AC B0B354.1
#=GS D5LD91_HBV/31-212    AC D5LD91.1
#=GS G9G9W2_HBV/31-80     AC G9G9W2.1
#=GS Q7TEE6_HBV/31-163    AC Q7TEE6.1
#=GS G3E5F6_HBV/2-183     AC G3E5F6.1
#=GS D0E636_HBV/31-212    AC D0E636.1
#=GS F5C1H8_HBV/33-214    AC F5C1H8.1
#=GS B9VL24_HBV/2-183     AC B9VL24.1
#=GS B4Z1T7_HBV/31-80     AC B4Z1T7.1
#=GS D8VBJ9_HBV/2-51      AC D8VBJ9.1
#=GS C4P160_HBV/31-76     AC C4P160.1
#=GS G9G922_HBV/31-212    AC G9G922.1
#=GS D3J5N1_HBV/31-70     AC D3J5N1.1
#=GS B6ULQ5_HBV/2-183     AC B6ULQ5.1
#=GS Q60GV8_HBV/31-71     AC Q60GV8.1
#=GS B7TUH4_HBV/31-212    AC B7TUH4.1
#=GS Q3LU00_HBV/31-212    AC Q3LU00.1
#=GS Q60GY7_HBV/31-71     AC Q60GY7.1
#=GS Q9YJW5_HBV/31-212    AC Q9YJW5.2
#=GS D8VC95_HBV/2-37      AC D8VC95.1
#=GS C1K1D8_HBV/81-153    AC C1K1D8.1
#=GS Q77BG3_HBV/1-96      AC Q77BG3.1
#=GS A9CM61_HBV/2-183     AC A9CM61.1
#=GS B4Z4W2_HBV/2-41      AC B4Z4W2.1
#=GS B4Z3S2_HBV/2-39      AC B4Z3S2.1
#=GS B9VKC5_HBV/2-183     AC B9VKC5.1
#=GS Q1MSR5_HBV/31-173    AC Q1MSR5.1
#=GS G0Z2Z8_HBV/2-121     AC G0Z2Z8.1
#=GS C4P1R2_HBV/31-76     AC C4P1R2.1
#=GS C1KT93_HBV/31-212    AC C1KT93.1
#=GS G9MD66_HBV/2-183     AC G9MD66.1
#=GS B2LWD2_HBV/31-210    AC B2LWD2.1
#=GS B8PTD7_HBV/2-183     AC B8PTD7.1
#=GS D8VBH7_HBV/2-115     AC D8VBH7.1
#=GS Q80GT5_HBV/2-103     AC Q80GT5.1
#=GS Q76MY5_HBV/2-183     AC Q76MY5.1
#=GS B3V8U3_HBV/2-183     AC B3V8U3.1
#=GS Q9QB09_HBV/2-183     AC Q9QB09.1
#=GS G8H3F2_HBV/2-131     AC G8H3F2.1
#=GS A9PLC6_HBV/1-39      AC A9PLC6.1
#=GS A4ZRE8_HBV/31-163    AC A4ZRE8.1
#=GS B4Z3H0_HBV/2-42      AC B4Z3H0.1
#=GS C1JZC9_HBV/2-182     AC C1JZC9.1
#=GS C4P188_HBV/31-76     AC C4P188.1
#=GS D0EEB8_HBV/2-185     AC D0EEB8.1
#=GS B4Z3N5_HBV/31-68     AC B4Z3N5.1
#=GS C7DSK5_HBV/2-183     AC C7DSK5.1
#=GS Q45F37_HBV/2-183     AC Q45F37.1
#=GS Q2EGD0_HBV/31-99     AC Q2EGD0.1
#=GS D3TK08_HBV/88-135    AC D3TK08.1
#=GS C7DN21_HBV/31-212    AC C7DN21.1
#=GS D5LD78_HBV/2-183     AC D5LD78.1
#=GS C4P174_HBV/31-76     AC C4P174.1
#=GS B5B495_HBV/2-183     AC B5B495.1
#=GS Q9E0T9_HBV/2-123     AC Q9E0T9.1
#=GS E3Q0J3_HBV/31-212    AC E3Q0J3.1
#=GS Q9E0W1_HBV/31-152    AC Q9E0W1.1
#=GS Q6R6J0_HBV/2-183     AC Q6R6J0.1
#=GS Q9WMC2_HBV/31-212    AC Q9WMC2.1
#=GS E3VLB7_HBV/2-183     AC E3VLB7.1
#=GS A0FDN0_HBV/31-212    AC A0FDN0.1
#=GS D8VC84_HBV/2-51      AC D8VC84.1
#=GS B4Z3V9_HBV/31-68     AC B4Z3V9.1
#=GS F5C1D0_HBV/2-183     AC F5C1D0.1
#=GS Q91EI2_HBV/31-214    AC Q91EI2.1
#=GS D0EYV9_HBV/2-157     AC D0EYV9.1
#=GS D2U628_HBV/2-183     AC D2U628.1
#=GS B4Z607_HBV/2-41      AC B4Z607.1
#=GS B5M5R7_HBV/31-212    AC B5M5R7.1
#=GS Q00K49_HBV/2-181     AC Q00K49.1
#=GS B3VAT0_HBV/2-183     AC B3VAT0.1
#=GS C7AY89_HBV/2-185     AC C7AY89.1
#=GS Q80GT4_HBV/31-132    AC Q80GT4.1
#=GS Q2L5A6_HBV/2-20      AC Q2L5A6.1
#=GS D3J6A1_HBV/31-70     AC D3J6A1.1
#=GS Q8VBH6_HBV/2-183     AC Q8VBH6.1
#=GS Q9E8L1_HBV/2-183     AC Q9E8L1.1
#=GS B7TV01_HBV/31-212    AC B7TV01.1
#=GS C7DSQ2_HBV/2-183     AC C7DSQ2.1
#=GS C6F513_HBV/2-185     AC C6F513.1
#=GS Q5R2N2_HBV/31-212    AC Q5R2N2.1
#=GS E0ZRQ9_HBV/31-212    AC E0ZRQ9.1
#=GS Q19K65_HBV/31-62     AC Q19K65.1
#=GS D2JMD9_HBV/31-212    AC D2JMD9.1
#=GS D8VCE9_HBV/31-66     AC D8VCE9.1
#=GS B9VK62_HBV/31-212    AC B9VK62.1
#=GS B5B4D9_HBV/65-144    AC B5B4D9.1
#=GS A4ZRE9_HBV/2-134     AC A4ZRE9.1
#=GS G1E7R4_HBV/2-183     AC G1E7R4.1
#=GS Q784Z8_HBV/2-183     AC Q784Z8.1
#=GS D5LBW2_HBV/31-212    AC D5LBW2.1
#=GS B6ULL1_HBV/31-212    AC B6ULL1.1
#=GS C7AY71_HBV/2-185     AC C7AY71.1
#=GS C9WDM7_HBV/2-183     AC C9WDM7.1
#=GS B3VAI2_HBV/2-183     AC B3VAI2.1
#=GS Q2EGG4_HBV/31-99     AC Q2EGG4.1
#=GS B7TU37_HBV/31-212    AC B7TU37.1
#=GS Q2EGC9_HBV/31-99     AC Q2EGC9.1
#=GS D8VBX2_HBV/2-51      AC D8VBX2.1
#=GS Q2EGG8_HBV/31-99     AC Q2EGG8.1
#=GS B3VB31_HBV/2-183     AC B3VB31.1
#=GS Q2L5G5_HBV/2-24      AC Q2L5G5.1
#=GS Q68073_HBV/31-212    AC Q68073.1
#=GS E7CU14_HBV/31-212    AC E7CU14.1
#=GS D9U5I1_HBV/2-183     AC D9U5I1.1
#=GS B4Z225_HBV/31-70     AC B4Z225.1
#=GS Q91HD8_HBV/2-185     AC Q91HD8.1
#=GS B9VKH9_HBV/31-212    AC B9VKH9.1
#=GS D8VBN4_HBV/31-80     AC D8VBN4.1
#=GS B4Z245_HBV/31-70     AC B4Z245.1
#=GS B2CY35_HBV/2-183     AC B2CY35.1
#=GS B3VAW5_HBV/2-183     AC B3VAW5.1
#=GS Q8VBG1_HBV/2-185     AC Q8VBG1.1
#=GS B4Z1R6_HBV/2-51      AC B4Z1R6.1
#=GS Q60H36_HBV/31-71     AC Q60H36.1
#=GS H9BMU2_HBV/25-191    AC H9BMU2.1
#=GS A1KR39_HBV/2-25      AC A1KR39.1
#=GS B0YK70_HBV/31-212    AC B0YK70.1
#=GS B4X6I0_HBV/31-87     AC B4X6I0.1
#=GS Q9WP82_HBV/31-214    AC Q9WP82.1
#=GS Q8B4G9_HBV/2-185     AC Q8B4G9.1
#=GS G0Z2W0_HBV/2-121     AC G0Z2W0.1
#=GS Q91A68_HBV/31-66     AC Q91A68.1
#=GS Q3LTY3_HBV/31-212    AC Q3LTY3.1
#=GS C4P1E6_HBV/31-76     AC C4P1E6.1
#=GS B4Z2G3_HBV/31-66     AC B4Z2G3.1
#=GS E0ZR92_HBV/2-183     AC E0ZR92.1
#=GS B4Z3K9_HBV/2-39      AC B4Z3K9.1
#=GS B4Z3X8_HBV/2-39      AC B4Z3X8.1
#=GS C4P1Q3_HBV/31-76     AC C4P1Q3.1
#=GS Q1T7E0_HBV/2-183     AC Q1T7E0.1
#=GS B4Z1M6_HBV/31-71     AC B4Z1M6.1
#=GS D8VBC9_HBV/2-115     AC D8VBC9.1
#=GS Q5DVZ5_HBV/31-212    AC Q5DVZ5.1
#=GS B0YK50_HBV/31-212    AC B0YK50.1
#=GS E0ZNT1_HBV/31-118    AC E0ZNT1.1
#=GS B3VAT6_HBV/2-183     AC B3VAT6.1
#=GS I0DG59_HBV/31-212    AC I0DG59.1
#=GS D3YGQ1_HBV/2-183     AC D3YGQ1.1
#=GS Q9WJE4_HBV/31-212    AC Q9WJE4.1
#=GS D3J675_HBV/31-68     AC D3J675.1
#=GS B4X6K4_HBV/30-86     AC B4X6K4.1
#=GS B4Z3Z0_HBV/2-39      AC B4Z3Z0.1
#=GS E0ZP52_HBV/2-110     AC E0ZP52.1
#=GS A9PLI1_HBV/1-39      AC A9PLI1.1
#=GS D3J5V3_HBV/31-88     AC D3J5V3.1
#=GS B4Z1H0_HBV/31-69     AC B4Z1H0.1
#=GS Q1RN58_HBV/31-212    AC Q1RN58.1
#=GS C4P1M2_HBV/31-76     AC C4P1M2.1
#=GS A8J4D5_HBV/31-212    AC A8J4D5.1
#=GS B9VKF5_HBV/2-183     AC B9VKF5.1
#=GS C4P1U8_HBV/31-76     AC C4P1U8.1
#=GS Q09KV4_HBV/2-20      AC Q09KV4.1
#=GS B6CJ02_HBV/31-214    AC B6CJ02.1
#=GS B2LRW8_HBV/2-183     AC B2LRW8.1
#=GS B4Z603_HBV/31-70     AC B4Z603.1
#=GS G1E7Y6_HBV/2-183     AC G1E7Y6.1
#=GS Q9J3T7_HBV/1-65      AC Q9J3T7.1
#=GS G3E565_HBV/2-183     AC G3E565.1
#=GS B0FCB6_HBV/2-80      AC B0FCB6.1
#=GS Q80JA9_HBV/2-183     AC Q80JA9.1
#=GS D9U5J2_HBV/2-183     AC D9U5J2.1
#=GS G1E7L5_HBV/2-183     AC G1E7L5.1
#=GS D3TK95_HBV/2-183     AC D3TK95.1
#=GS Q7T7W7_HBV/2-183     AC Q7T7W7.1
#=GS Q7TF68_HBV/31-88     AC Q7TF68.1
#=GS Q3LTX7_HBV/2-183     AC Q3LTX7.1
#=GS H3K3K6_HBV/2-185     AC H3K3K6.1
#=GS Q60H21_HBV/31-71     AC Q60H21.1
#=GS B4Z2C5_HBV/2-37      AC B4Z2C5.1
#=GS Q98ZJ7_HBV/31-213    AC Q98ZJ7.1
#=GS D3K2F1_HBV/31-210    AC D3K2F1.1
#=GS B3VAQ2_HBV/2-183     AC B3VAQ2.1
#=GS Q14U95_HBV/31-78     AC Q14U95.1
#=GS Q76MV6_HBV/2-183     AC Q76MV6.1
#=GS Q09KR5_HBV/2-20      AC Q09KR5.1
#=GS C7DM16_HBV/2-183     AC C7DM16.1
#=GS C1KT84_HBV/31-212    AC C1KT84.1
#=GS C7AYK9_HBV/31-215    AC C7AYK9.1
#=GS B0YK38_HBV/31-212    AC B0YK38.1
#=GS D9U5P5_HBV/2-149     AC D9U5P5.1
#=GS G1C985_HBV/2-183     AC G1C985.1
#=GS Q8VBG2_HBV/2-185     AC Q8VBG2.1
#=GS Q8JSV8_HBV/1-130     AC Q8JSV8.1
#=GS C1K1F2_HBV/2-83      AC C1K1F2.1
#=GS H6UGH8_HBV/2-183     AC H6UGH8.1
#=GS B5BPR0_HBV/31-212    AC B5BPR0.1
#=GS D5LB80_HBV/31-212    AC D5LB80.1
#=GS Q8QP37_HBV/1-132     AC Q8QP37.1
#=GS Q2L4M1_HBV/2-183     AC Q2L4M1.1
#=GS B4Z3S4_HBV/31-68     AC B4Z3S4.1
#=GS Q5DVY3_HBV/31-212    AC Q5DVY3.1
#=GS G1C8J6_HBV/2-183     AC G1C8J6.1
#=GS C1K230_HBV/2-183     AC C1K230.1
#=GS B7TUF4_HBV/2-183     AC B7TUF4.1
#=GS Q9WJE6_HBV/31-212    AC Q9WJE6.1
#=GS B4Z5Y3_HBV/2-42      AC B4Z5Y3.1
#=GS Q00K77_HBV/2-183     AC Q00K77.1
#=GS B3VAJ2_HBV/2-183     AC B3VAJ2.1
#=GS D8VBW6_HBV/2-25      AC D8VBW6.1
#=GS D6P5B1_HBV/2-183     AC D6P5B1.1
#=GS G9G8L0_HBV/31-212    AC G9G8L0.1
#=GS D0EYW6_HBV/2-157     AC D0EYW6.1
#=GS E0ZP02_HBV/2-110     AC E0ZP02.1
#=GS B7TUR0_HBV/31-212    AC B7TUR0.1
#=GS Q2L5B7_HBV/2-20      AC Q2L5B7.1
#=GS Q60GU4_HBV/31-71     AC Q60GU4.1
#=GS D8VC70_HBV/2-36      AC D8VC70.1
#=GS Q60GV9_HBV/31-71     AC Q60GV9.1
#=GS B4Z4S3_HBV/2-41      AC B4Z4S3.1
#=GS Q7TDQ8_HBV/2-183     AC Q7TDQ8.1
#=GS Q6UE49_HBV/2-183     AC Q6UE49.1
#=GS B4Z4N7_HBV/2-41      AC B4Z4N7.1
#=GS Q1HHA0_HBV/2-183     AC Q1HHA0.1
#=GS D3TK81_HBV/2-183     AC D3TK81.1
#=GS E2FKL3_HBV/2-153     AC E2FKL3.1
#=GS B5M5X5_HBV/31-212    AC B5M5X5.1
#=GS D0E595_HBV/31-212    AC D0E595.1
#=GS B0YGJ3_HBV/31-212    AC B0YGJ3.1
#=GS G0Z2Z1_HBV/2-121     AC G0Z2Z1.1
#=GS E9L2J5_HBV/31-214    AC E9L2J5.1
#=GS C1KT88_HBV/31-210    AC C1KT88.1
#=GS C4P1D2_HBV/31-76     AC C4P1D2.1
#=GS B4Z1V0_HBV/2-55      AC B4Z1V0.1
#=GS I0DG43_HBV/31-212    AC I0DG43.1
#=GS D3J5R3_HBV/31-57     AC D3J5R3.1
#=GS D8VC32_HBV/31-80     AC D8VC32.1
#=GS D0EYV5_HBV/2-158     AC D0EYV5.1
#=GS E0D382_HBV/31-82     AC E0D382.1
#=GS B5BPU1_HBV/31-212    AC B5BPU1.1
#=GS Q19SY9_HBV/2-183     AC Q19SY9.1
#=GS Q4FDD2_HBV/31-212    AC Q4FDD2.1
#=GS Q81166_HBV/2-183     AC Q81166.1
#=GS B5U715_HBV/31-212    AC B5U715.1
#=GS C4P1P9_HBV/31-76     AC C4P1P9.1
#=GS D8VCG4_HBV/2-51      AC D8VCG4.1
#=GS D3J5Y0_HBV/31-88     AC D3J5Y0.1
#=GS D5MSF0_HBV/31-212    AC D5MSF0.1
#=GS C7DMI3_HBV/31-212    AC C7DMI3.1
#=GS D3J6F8_HBV/31-67     AC D3J6F8.1
#=GS B5BPX3_HBV/2-183     AC B5BPX3.1
#=GS D8VBY9_HBV/31-79     AC D8VBY9.1
#=GS Q9YL92_HBV/2-183     AC Q9YL92.1
#=GS D3J653_HBV/31-84     AC D3J653.1
#=GS Q2F502_HBV/31-212    AC Q2F502.1
#=GS C7DQS7_HBV/2-183     AC C7DQS7.1
#=GS B7TTQ6_HBV/2-183     AC B7TTQ6.1
#=GS D3J6B8_HBV/31-70     AC D3J6B8.1
#=GS H2ERF5_HBV/2-183     AC H2ERF5.1
#=GS B3VAS2_HBV/2-183     AC B3VAS2.1
#=GS B4X6M5_HBV/31-86     AC B4X6M5.1
#=GS C7AY83_HBV/2-185     AC C7AY83.1
#=GS A6MFY6_HBV/2-183     AC A6MFY6.1
#=GS A1Z0N8_HBV/2-183     AC A1Z0N8.1
#=GS Q598R7_HBV/31-212    AC Q598R7.1
#=GS D3XGH1_HBV/2-183     AC D3XGH1.1
#=GS A0FDK3_HBV/80-154    AC A0FDK3.1
#=GS B4Z362_HBV/31-66     AC B4Z362.1
#=GS B7TTE5_HBV/31-212    AC B7TTE5.1
#=GS B4Z5S9_HBV/31-71     AC B4Z5S9.1
#=GS E0ZNY9_HBV/2-110     AC E0ZNY9.1
#=GS B4Z2B3_HBV/2-37      AC B4Z2B3.1
#=GS B9VK10_HBV/2-183     AC B9VK10.1
#=GS Q8B6N4_HBV/31-212    AC Q8B6N4.1
#=GS G1E7E0_HBV/2-183     AC G1E7E0.1
#=GS E0ZRA5_HBV/31-212    AC E0ZRA5.1
#=GS Q60H24_HBV/31-71     AC Q60H24.1
#=GS D3YFZ6_HBV/2-183     AC D3YFZ6.1
#=GS B7TTD4_HBV/2-183     AC B7TTD4.1
#=GS B4Z228_HBV/31-70     AC B4Z228.1
#=GS B2LRX5_HBV/2-183     AC B2LRX5.1
#=GS B4Z1X0_HBV/31-70     AC B4Z1X0.1
#=GS B4Z3M3_HBV/31-68     AC B4Z3M3.1
#=GS B4Z3N0_HBV/2-39      AC B4Z3N0.1
#=GS D4HMX3_HBV/1-78      AC D4HMX3.1
#=GS B4Z2W9_HBV/31-70     AC B4Z2W9.1
#=GS B3VBB4_HBV/2-183     AC B3VBB4.1
#=GS F5C1C2_HBV/43-214    AC F5C1C2.1
#=GS A5GZP4_HBV/31-212    AC A5GZP4.1
#=GS D8VB76_HBV/31-70     AC D8VB76.1
#=GS B3IVL8_HBV/31-212    AC B3IVL8.1
#=GS G9HVF3_HBV/2-183     AC G9HVF3.1
#=GS D3J658_HBV/31-88     AC D3J658.1
#=GS H6V5S5_HBV/2-183     AC H6V5S5.1
#=GS B4Z1N3_HBV/2-42      AC B4Z1N3.1
#=GS Q598Q8_HBV/2-185     AC Q598Q8.1
#=GS B4Z4N9_HBV/31-70     AC B4Z4N9.1
#=GS G0Z2W3_HBV/2-121     AC G0Z2W3.1
#=GS B4Z3A2_HBV/2-37      AC B4Z3A2.1
#=GS B5BPN2_HBV/31-212    AC B5BPN2.1
#=GS B4Z223_HBV/2-41      AC B4Z223.1
#=GS D8VBF7_HBV/2-21      AC D8VBF7.1
#=GS B5B4P3_HBV/2-183     AC B5B4P3.1
#=GS G9G8J7_HBV/2-183     AC G9G8J7.1
#=GS C4P1D5_HBV/31-76     AC C4P1D5.1
#=GS C7DMZ1_HBV/2-183     AC C7DMZ1.1
#=GS H2ERA2_HBV/2-183     AC H2ERA2.1
#=GS B6CIY9_HBV/31-212    AC B6CIY9.1
#=GS B4Z2R3_HBV/2-41      AC B4Z2R3.1
#=GS H9BMS7_HBV/2-160     AC H9BMS7.1
#=GS D2U648_HBV/2-183     AC D2U648.1
#=GS C1K1F1_HBV/31-112    AC C1K1F1.1
#=GS C4P1B3_HBV/31-76     AC C4P1B3.1
#=GS B4Z4Q4_HBV/2-41      AC B4Z4Q4.1
#=GS Q91SY9_HBV/31-212    AC Q91SY9.1
#=GS D3XGB9_HBV/2-183     AC D3XGB9.1
#=GS C3W420_HBV/2-183     AC C3W420.1
#=GS B6ULH3_HBV/31-212    AC B6ULH3.1
#=GS D3TII6_HBV/31-212    AC D3TII6.1
#=GS D5LF23_HBV/31-212    AC D5LF23.1
#=GS A0FDL7_HBV/2-183     AC A0FDL7.1
#=GS Q7TEC9_HBV/31-163    AC Q7TEC9.1
#=GS B5M640_HBV/31-212    AC B5M640.1
#=GS B4Z4I6_HBV/2-41      AC B4Z4I6.1
#=GS O09508_HBV/2-183     AC O09508.1
#=GS B4Z3J3_HBV/31-68     AC B4Z3J3.1
#=GS D2CGU6_HBV/31-212    AC D2CGU6.1
#=GS A9PLD6_HBV/1-39      AC A9PLD6.1
#=GS G1EIF3_HBV/2-183     AC G1EIF3.1
#=GS Q774G5_HBVH1/31-212  AC Q774G5.1
#=GS Q9E8L5_HBV/2-183     AC Q9E8L5.1
#=GS D3J5M4_HBV/31-70     AC D3J5M4.1
#=GS Q60GZ9_HBV/31-71     AC Q60GZ9.1
#=GS D3K2E4_HBV/31-212    AC D3K2E4.1
#=GS H2ERH2_HBV/2-181     AC H2ERH2.1
#=GS C9W209_HBV/2-183     AC C9W209.1
#=GS H9BMQ8_HBV/2-168     AC H9BMQ8.1
#=GS B4Z2A2_HBV/31-66     AC B4Z2A2.1
#=GS D6P5B5_HBV/31-108    AC D6P5B5.1
#=GS D3J609_HBV/31-89     AC D3J609.1
#=GS G1EIJ0_HBV/2-153     AC G1EIJ0.1
#=GS E0ZNU0_HBV/2-110     AC E0ZNU0.1
#=GS G9G983_HBV/2-183     AC G9G983.1
#=GS Q1PCX3_HBV/31-212    AC Q1PCX3.1
#=GS F5C046_HBV/31-53     AC F5C046.1
#=GS C1K1D7_HBV/110-182   AC C1K1D7.1
#=GS B4Z4N4_HBV/2-41      AC B4Z4N4.1
#=GS Q6XE95_HBV/2-185     AC Q6XE95.1
#=GS Q1MST6_HBV/31-173    AC Q1MST6.1
#=GS E0ZP50_HBV/2-110     AC E0ZP50.1
#=GS D8VC42_HBV/2-51      AC D8VC42.1
#=GS B9VK97_HBV/31-212    AC B9VK97.1
#=GS C4P120_HBV/31-76     AC C4P120.1
#=GS H2ERE4_HBV/2-183     AC H2ERE4.1
#=GS B1PI51_9HEPA/35-295  AC B1PI51.1
#=GS B6ULH5_HBV/91-168    AC B6ULH5.1
#=GS H9BMU7_HBV/2-168     AC H9BMU7.1
#=GS B4Z241_HBV/2-41      AC B4Z241.1
#=GS D3J679_HBV/31-68     AC D3J679.1
#=GS D3J5V0_HBV/31-89     AC D3J5V0.1
#=GS D8VBE9_HBV/31-159    AC D8VBE9.1
#=GS Q77BG1_HBV/1-96      AC Q77BG1.1
#=GS D4I4R9_HBV/2-185     AC D4I4R9.1
#=GS B6D6H2_HBV/2-130     AC B6D6H2.1
#=GS A0FDV3_HBV/31-202    AC A0FDV3.1
#=GS I0DG19_HBV/31-212    AC I0DG19.1
#=GS Q00K73_HBV/2-183     AC Q00K73.1
#=GS H2ERA1_HBV/31-212    AC H2ERA1.1
#=GS A1YTM0_HBV/31-212    AC A1YTM0.1
#=GS G1E8H0_HBV/2-183     AC G1E8H0.1
#=GS Q6I6V4_HBV/31-74     AC Q6I6V4.1
#=GS G1E7S6_HBV/2-183     AC G1E7S6.1
#=GS B4Z3G0_HBV/2-42      AC B4Z3G0.1
#=GS C3W3Z6_HBV/2-185     AC C3W3Z6.1
#=GS Q8JXJ6_HBV/32-136    AC Q8JXJ6.1
#=GS H2ERC9_HBV/31-212    AC H2ERC9.1
#=GS B5TZH3_HBV/31-211    AC B5TZH3.1
#=GS Q9QB19_HBV/2-183     AC Q9QB19.1
#=GS B6ULK3_HBV/31-212    AC B6ULK3.1
#=GS B7TTH9_HBV/2-183     AC B7TTH9.1
#=GS D3J6D5_HBV/31-70     AC D3J6D5.1
#=GS C4P139_HBV/31-76     AC C4P139.1
#=GS D3TIK2_HBV/2-183     AC D3TIK2.1
#=GS E0ZNH2_HBV/2-129     AC E0ZNH2.1
#=GS B5AT62_HBV/31-212    AC B5AT62.1
#=GS A9PLD3_HBV/1-39      AC A9PLD3.1
#=GS B4Z4L1_HBV/31-70     AC B4Z4L1.1
#=GS D3TK02_HBV/2-89      AC D3TK02.1
#=GS Q2L5H9_HBV/2-24      AC Q2L5H9.1
#=GS B0FCY2_HBV/31-212    AC B0FCY2.1
#=GS Q4FDK3_HBV/31-212    AC Q4FDK3.1
#=GS B0FCY3_HBV/2-183     AC B0FCY3.1
#=GS Q30BG9_HBV/31-113    AC Q30BG9.1
#=GS Q7THS4_HBV/2-183     AC Q7THS4.1
#=GS H9BMT1_HBV/2-160     AC H9BMT1.1
#=GS Q6XGT5_HBV/31-214    AC Q6XGT5.1
#=GS F5C1J2_HBV/2-183     AC F5C1J2.1
#=GS A4ZRF9_HBV/2-134     AC A4ZRF9.1
#=GS B3VB28_HBV/31-212    AC B3VB28.1
#=GS A1KR44_HBV/2-25      AC A1KR44.1
#=GS B9VKM2_HBV/2-183     AC B9VKM2.1
#=GS D3J648_HBV/31-88     AC D3J648.1
#=GS Q8B4N4_HBV/31-214    AC Q8B4N4.1
#=GS B4Z4L9_HBV/2-41      AC B4Z4L9.1
#=GS B6D6G7_HBV/2-51      AC B6D6G7.1
#=GS C3W408_HBV/2-183     AC C3W408.1
#=GS B4YL56_HBV/2-183     AC B4YL56.1
#=GS D8VB59_HBV/2-22      AC D8VB59.1
#=GS E0ZRE7_HBV/2-183     AC E0ZRE7.1
#=GS B6CIY1_HBV/31-214    AC B6CIY1.1
#=GS Q60H41_HBV/31-71     AC Q60H41.1
#=GS C7DY81_HBV/2-183     AC C7DY81.1
#=GS H9N866_HBV/2-183     AC H9N866.1
#=GS B4Z1X3_HBV/31-70     AC B4Z1X3.1
#=GS D3J5T5_HBV/31-88     AC D3J5T5.1
#=GS B5B490_HBV/31-212    AC B5B490.1
#=GS A7L345_HBV/2-159     AC A7L345.1
#=GS B4Z357_HBV/2-37      AC B4Z357.1
#=GS H6V897_HBV/31-56     AC H6V897.1
#=GS Q91SX4_HBV/31-212    AC Q91SX4.1
#=GS Q4FDI0_HBV/31-212    AC Q4FDI0.1
#=GS D8VBN1_HBV/31-80     AC D8VBN1.1
#=GS H9BMR8_HBV/2-168     AC H9BMR8.1
#=GS E5CZ49_HBV/2-183     AC E5CZ49.1
#=GS B7TUW9_HBV/31-212    AC B7TUW9.1
#=GS B4X6I1_HBV/30-86     AC B4X6I1.1
#=GS D0EDS1_HBV/2-183     AC D0EDS1.1
#=GS Q70HP9_HBV/2-132     AC Q70HP9.1
#=GS G9G8J6_HBV/31-212    AC G9G8J6.1
#=GS B2LWA5_HBV/31-212    AC B2LWA5.1
#=GS B4ZYU7_HBV/31-212    AC B4ZYU7.1
#=GS C4P1M3_HBV/31-76     AC C4P1M3.1
#=GS D2JMQ4_HBV/31-212    AC D2JMQ4.1
#=GS Q9QB11_HBV/2-183     AC Q9QB11.1
#=GS B4Z5W0_HBV/31-71     AC B4Z5W0.1
#=GS C4P1H1_HBV/31-76     AC C4P1H1.1
#=GS Q67912_HBV/31-212    AC Q67912.1
#=GS B5MEW4_HBV/2-183     AC B5MEW4.1
#=GS D7NL73_HBV/31-212    AC D7NL73.1
#=GS B7TUS2_HBV/31-212    AC B7TUS2.1
#=GS Q9QB15_HBV/2-183     AC Q9QB15.1
#=GS D8VBL4_HBV/2-20      AC D8VBL4.1
#=GS B6CIZ8_HBV/31-214    AC B6CIZ8.1
#=GS B4Z2F8_HBV/2-37      AC B4Z2F8.1
#=GS H6UGA4_HBV/2-183     AC H6UGA4.1
#=GS A5GZM1_HBV/31-212    AC A5GZM1.1
#=GS Q8UYB1_HBV/68-139    AC Q8UYB1.1
#=GS Q1MSQ5_HBV/31-172    AC Q1MSQ5.1
#=GS Q7TF68_HBV/85-118    AC Q7TF68.1
#=GS B6ULH5_HBV/31-93     AC B6ULH5.1
#=GS C7DSM3_HBV/31-212    AC C7DSM3.1
#=GS C4P0X4_HBV/31-76     AC C4P0X4.1
#=GS Q7THQ5_HBV/2-183     AC Q7THQ5.1
#=GS C4P183_HBV/31-76     AC C4P183.1
#=GS B3VB21_HBV/2-183     AC B3VB21.1
#=GS A0FDV4_HBV/2-173     AC A0FDV4.1
#=GS B1ABL7_HBV/31-210    AC B1ABL7.1
#=GS D3J5Q9_HBV/31-57     AC D3J5Q9.1
#=GS H6UGT9_HBV/31-212    AC H6UGT9.1
#=GS D8VBC0_HBV/31-80     AC D8VBC0.1
#=GS D8VBR7_HBV/2-36      AC D8VBR7.1
#=GS D8VBR1_HBV/2-51      AC D8VBR1.1
#=GS B4Z291_HBV/31-66     AC B4Z291.1
#=GS B4Z1K0_HBV/31-71     AC B4Z1K0.1
#=GS B4Z3W9_HBV/2-39      AC B4Z3W9.1
#=GS Q2LCB7_HBV/2-183     AC Q2LCB7.1
#=GS E0ZR98_HBV/31-212    AC E0ZR98.1
#=GS C4P1N7_HBV/31-76     AC C4P1N7.1
#=GS G1EIH9_HBV/2-153     AC G1EIH9.1
#=GS B4Z3H8_HBV/31-71     AC B4Z3H8.1
#=GS C9WDU3_HBV/2-183     AC C9WDU3.1
#=GS HBEAG_HPBDC/45-305   AC P30027.1
#=GS B7TUB1_HBV/31-212    AC B7TUB1.1
#=GS B4Z1F7_HBV/31-69     AC B4Z1F7.1
#=GS C1K1S6_HBV/2-183     AC C1K1S6.1
#=GS D9U580_HBV/2-89      AC D9U580.1
#=GS Q2L5B1_HBV/2-20      AC Q2L5B1.1
#=GS E0ZNW9_HBV/2-110     AC E0ZNW9.1
#=GS D8VB74_HBV/2-183     AC D8VB74.1
#=GS B4Z2P5_HBV/31-70     AC B4Z2P5.1
#=GS B4Z3T0_HBV/31-68     AC B4Z3T0.1
#=GS Q2L577_HBV/2-20      AC Q2L577.1
#=GS G9G9R2_HBV/31-212    AC G9G9R2.1
#=GS C3W3V3_HBV/2-183     AC C3W3V3.1
#=GS B4Z3N9_HBV/2-39      AC B4Z3N9.1
#=GS Q5U7S2_HBV/31-212    AC Q5U7S2.1
#=GS D4HMY4_HBV/1-78      AC D4HMY4.1
#=GS C7DNM7_HBV/31-212    AC C7DNM7.1
#=GS Q461C5_HBV/31-212    AC Q461C5.1
#=GS D0EE28_HBV/2-185     AC D0EE28.1
#=GS D3TK43_HBV/81-131    AC D3TK43.1
#=GS B1ABP0_HBV/31-130    AC B1ABP0.1
#=GS Q917J9_HBV/31-212    AC Q917J9.1
#=GS I0DG64_HBV/31-212    AC I0DG64.1
#=GS D0EYZ0_HBV/2-183     AC D0EYZ0.1
#=GS G0Z2Y3_HBV/2-121     AC G0Z2Y3.1
#=GS E0ZP10_HBV/2-110     AC E0ZP10.1
#=GS Q60H08_HBV/31-71     AC Q60H08.1
#=GS D3YGG6_HBV/2-183     AC D3YGG6.1
#=GS Q4AE49_HBV/31-212    AC Q4AE49.1
#=GS B6D683_HBV/2-113     AC B6D683.1
#=GS B5BPW9_HBV/2-183     AC B5BPW9.1
#=GS B4Z6B1_HBV/31-70     AC B4Z6B1.1
#=GS B4Z1J2_HBV/2-42      AC B4Z1J2.1
#=GS C4P1L6_HBV/31-76     AC C4P1L6.1
#=GS Q8VBJ4_HBV/2-183     AC Q8VBJ4.1
#=GS C9W1Y7_HBV/2-183     AC C9W1Y7.1
#=GS C7AYA6_HBV/31-214    AC C7AYA6.1
#=GS O92918_HBV/31-212    AC O92918.1
#=GS Q89714_HBV/31-212    AC Q89714.1
#=GS C4P169_HBV/31-76     AC C4P169.1
#=GS Q917I2_HBV/2-183     AC Q917I2.1
#=GS D0EE53_HBV/2-185     AC D0EE53.1
#=GS E0ZRL2_HBV/2-183     AC E0ZRL2.1
#=GS Q77N81_HBVF3/31-212  AC Q77N81.1
#=GS Q917I7_HBV/31-212    AC Q917I7.1
#=GS D2U676_HBV/2-183     AC D2U676.1
#=GS C7DNC9_HBV/2-183     AC C7DNC9.1
#=GS B4Z428_HBV/2-39      AC B4Z428.1
#=GS B4Z5W5_HBV/2-42      AC B4Z5W5.1
#=GS Q7TG31_9HEPA/2-262   AC Q7TG31.1
#=GS A5LG81_HBV/2-183     AC A5LG81.1
#=GS Q6R7M9_HBV/14-151    AC Q6R7M9.1
#=GS B6ULH9_HBV/31-99     AC B6ULH9.1
#=GS Q1MSM8_HBV/31-173    AC Q1MSM8.1
#=GS B4Z1X4_HBV/2-41      AC B4Z1X4.1
#=GS H3K3H8_HBV/2-183     AC H3K3H8.1
#=GS B0FCB0_HBV/31-109    AC B0FCB0.1
#=GS A7YEY3_HBV/31-212    AC A7YEY3.1
#=GS B7TTN1_HBV/31-212    AC B7TTN1.1
#=GS B4Z2K2_HBV/31-70     AC B4Z2K2.1
#=GS B4Z2X9_HBV/2-37      AC B4Z2X9.1
#=GS I0DG35_HBV/31-212    AC I0DG35.1
#=GS D0EDR4_HBV/2-183     AC D0EDR4.1
#=GS B4Z2A5_HBV/31-66     AC B4Z2A5.1
#=GS B3VAV3_HBV/31-212    AC B3VAV3.1
#=GS D3J643_HBV/31-88     AC D3J643.1
#=GS B0YK58_HBV/2-183     AC B0YK58.1
#=GS D8VBP2_HBV/31-80     AC D8VBP2.1
#=GS H6UGB0_HBV/2-183     AC H6UGB0.1
#=GS D3YG44_HBV/2-183     AC D3YG44.1
#=GS B3V8T1_HBV/2-183     AC B3V8T1.1
#=GS B4Z230_HBV/31-69     AC B4Z230.1
#=GS B5M542_HBV/31-212    AC B5M542.1
#=GS D0EE52_HBV/31-214    AC D0EE52.1
#=GS Q8VBH8_HBV/2-183     AC Q8VBH8.1
#=GS E0ZP69_HBV/31-58     AC E0ZP69.1
#=GS D8VBC3_HBV/31-212    AC D8VBC3.1
#=GS D0EDZ9_HBV/31-214    AC D0EDZ9.1
#=GS G1C8Q7_HBV/2-182     AC G1C8Q7.1
#=GS Q19SW3_HBV/2-183     AC Q19SW3.1
#=GS H9BMU4_HBV/25-191    AC H9BMU4.1
#=GS Q4FDA8_HBV/31-212    AC Q4FDA8.1
#=GS C7AY56_HBV/2-185     AC C7AY56.1
#=GS D3TK88_HBV/2-183     AC D3TK88.1
#=GS B6D693_HBV/31-67     AC B6D693.1
#=GS B4Z409_HBV/31-68     AC B4Z409.1
#=GS G9G942_HBV/2-183     AC G9G942.1
#=GS B3VBB8_HBV/2-183     AC B3VBB8.1
#=GS G1E7I9_HBV/31-84     AC G1E7I9.1
#=GS C7DMR7_HBV/2-183     AC C7DMR7.1
#=GS Q45F90_HBV/2-183     AC Q45F90.1
#=GS D6QW44_HBV/2-183     AC D6QW44.1
#=GS C4P1L2_HBV/31-76     AC C4P1L2.1
#=GS Q80GX2_HBV/2-181     AC Q80GX2.1
#=GS D3J5Q6_HBV/31-57     AC D3J5Q6.1
#=GS G1C951_HBV/2-183     AC G1C951.1
#=GS Q81143_HBV/31-111    AC Q81143.1
#=GS D2JMM6_HBV/2-183     AC D2JMM6.1
#=GS B3VB38_HBV/2-183     AC B3VB38.1
#=GS B3VAM2_HBV/31-212    AC B3VAM2.1
#=GS B4Z2S6_HBV/2-41      AC B4Z2S6.1
#=GS B9VL51_HBV/31-212    AC B9VL51.1
#=GS B6CIU6_HBV/31-212    AC B6CIU6.1
#=GS Q91T06_HBV/31-212    AC Q91T06.1
#=GS B4Z342_HBV/2-37      AC B4Z342.1
#=GS D8VBL7_HBV/2-51      AC D8VBL7.1
#=GS E0ZN94_HBV/2-153     AC E0ZN94.1
#=GS G9G8N1_HBV/2-183     AC G9G8N1.1
#=GS C3W4I6_HBV/2-183     AC C3W4I6.1
#=GS Q8QP28_HBV/1-130     AC Q8QP28.1
#=GS Q6X5H2_HBV/34-208    AC Q6X5H2.1
#=GS D3J621_HBV/31-88     AC D3J621.1
#=GS Q8JSV2_HBV/1-130     AC Q8JSV2.1
#=GS B7TTW7_HBV/2-183     AC B7TTW7.1
#=GS B3VBB3_HBV/31-212    AC B3VBB3.1
#=GS B4Z260_HBV/31-70     AC B4Z260.1
#=GS Q9J1L8_HBV/2-183     AC Q9J1L8.1
#=GS Q5R2R4_HBV/2-183     AC Q5R2R4.1
#=GS Q68RN6_HBV/2-183     AC Q68RN6.1
#=GS B3VB40_HBV/2-183     AC B3VB40.1
#=GS Q6XE94_HBV/2-185     AC Q6XE94.1
#=GS B4X6L1_HBV/31-87     AC B4X6L1.1
#=GS D3YGG0_HBV/2-183     AC D3YGG0.1
#=GS A9QPZ2_HBV/31-212    AC A9QPZ2.1
#=GS G3XLC3_HBV/31-212    AC G3XLC3.1
#=GS E0ZNE4_HBV/31-182    AC E0ZNE4.1
#=GS D8VB86_HBV/2-49      AC D8VB86.1
#=GS D3J5L3_HBV/31-57     AC D3J5L3.1
#=GS Q6I6V8_HBV/31-74     AC Q6I6V8.1
#=GS D8VBQ0_HBV/2-51      AC D8VBQ0.1
#=GS B2LRW7_HBV/31-212    AC B2LRW7.1
#=GS Q8VBJ1_HBV/2-183     AC Q8VBJ1.1
#=GS Q2L5C3_HBV/2-20      AC Q2L5C3.1
#=GS B8PTF8_HBV/2-183     AC B8PTF8.1
#=GS Q9E0W7_HBV/2-123     AC Q9E0W7.1
#=GS D3J5Q0_HBV/31-57     AC D3J5Q0.1
#=GS D3GIK4_HBV/2-183     AC D3GIK4.1
#=GS F5C052_HBV/31-53     AC F5C052.1
#=GS B3VAI8_HBV/2-183     AC B3VAI8.1
#=GS I0DG44_HBV/31-212    AC I0DG44.1
#=GS D6QVR6_HBV/2-183     AC D6QVR6.1
#=GS B4Z2T9_HBV/31-70     AC B4Z2T9.1
#=GS Q91PN5_HBV/128-182   AC Q91PN5.1
#=GS C4P1B0_HBV/31-76     AC C4P1B0.1
#=GS E0ZNE5_HBV/2-153     AC E0ZNE5.1
#=GS B7TU80_HBV/31-212    AC B7TU80.1
#=GS C3W469_HBV/2-183     AC C3W469.1
#=GS C4P1M7_HBV/31-76     AC C4P1M7.1
#=GS Q2TJG3_HBV/2-131     AC Q2TJG3.1
#=GS Q5G3J6_HBV/31-54     AC Q5G3J6.1
#=GS B4Z2M5_HBV/31-70     AC B4Z2M5.1
#=GS Q30BH5_HBV/31-113    AC Q30BH5.1
#=GS D3J638_HBV/31-88     AC D3J638.1
#=GS C4P1I1_HBV/31-76     AC C4P1I1.1
#=GS F5C044_HBV/31-53     AC F5C044.1
#=GS Q4FDM7_HBV/31-212    AC Q4FDM7.1
#=GS B5B4D8_HBV/31-96     AC B5B4D8.1
#=GS Q3LTY2_HBV/2-183     AC Q3LTY2.1
#=GS B2CY22_HBV/2-183     AC B2CY22.1
#=GS Q7TF60_HBV/31-212    AC Q7TF60.1
#=GS C4P1E2_HBV/31-76     AC C4P1E2.1
#=GS C4P1S7_HBV/31-76     AC C4P1S7.1
#=GS Q2L5G0_HBV/2-24      AC Q2L5G0.1
#=GS B4Z1I3_HBV/2-42      AC B4Z1I3.1
#=GS D8VCG0_HBV/31-80     AC D8VCG0.1
#=GS D3TK37_HBV/2-183     AC D3TK37.1
#=GS Q2LCB3_HBV/2-183     AC Q2LCB3.1
#=GS H9BMR0_HBV/2-168     AC H9BMR0.1
#=GS D2JMB0_HBV/2-183     AC D2JMB0.1
#=GS A1YTL5_HBV/31-212    AC A1YTL5.1
#=GS Q9YQ42_HBV/1-96      AC Q9YQ42.1
#=GS Q80GT5_HBV/100-149   AC Q80GT5.1
#=GS Q7TEC7_HBV/31-163    AC Q7TEC7.1
#=GS D0EE39_HBV/2-183     AC D0EE39.1
#=GS Q6X5H3_HBV/2-183     AC Q6X5H3.1
#=GS H9BMW6_HBV/2-166     AC H9BMW6.1
#=GS B7TUC9_HBV/31-212    AC B7TUC9.1
#=GS O91513_HBV/31-212    AC O91513.1
#=GS Q80J68_HBV/2-183     AC Q80J68.1
#=GS B5U727_HBV/31-212    AC B5U727.1
#=GS D8VB89_HBV/2-50      AC D8VB89.1
#=GS B6CIY3_HBV/31-214    AC B6CIY3.1
#=GS Q9IHD1_HBV/2-183     AC Q9IHD1.1
#=GS B9VK14_HBV/2-183     AC B9VK14.1
#=GS H9BMW2_HBV/2-160     AC H9BMW2.1
#=GS B0B2J0_HBV/2-183     AC B0B2J0.1
#=GS C1K1W2_HBV/2-183     AC C1K1W2.1
#=GS B4Z3W8_HBV/31-68     AC B4Z3W8.1
#=GS B4Z3M0_HBV/31-68     AC B4Z3M0.1
#=GS D3TK43_HBV/2-84      AC D3TK43.1
#=GS Q91A72_HBV/31-66     AC Q91A72.1
#=GS D6QW16_HBV/31-212    AC D6QW16.1
#=GS Q5UFT6_HBV/2-183     AC Q5UFT6.1
#=GS CAPSD_HBVGB/2-183    AC P0C6I8.1
#=GS G1E8A6_HBV/2-183     AC G1E8A6.1
#=GS Q8JXA8_HBV/31-212    AC Q8JXA8.1
#=GS Q8JSX0_HBV/1-130     AC Q8JSX0.1
#=GS B0B360_HBV/2-183     AC B0B360.1
#=GS Q91EI7_HBV/2-185     AC Q91EI7.1
#=GS C4P1M8_HBV/31-76     AC C4P1M8.1
#=GS G1C8B3_HBV/2-183     AC G1C8B3.1
#=GS D8VBR6_HBV/31-65     AC D8VBR6.1
#=GS B4Z1S5_HBV/31-80     AC B4Z1S5.1
#=GS Q910X1_HBV/2-183     AC Q910X1.1
#=GS G1ETT5_HBV/31-212    AC G1ETT5.1
#=GS Q9WP78_HBV/105-184   AC Q9WP78.1
#=GS B4Z1Y6_HBV/2-41      AC B4Z1Y6.1
#=GS Q67888_HBV/31-212    AC Q67888.1
#=GS A9PLG2_HBV/1-39      AC A9PLG2.1
#=GS B7TU81_HBV/2-183     AC B7TU81.1
#=GS Q60H39_HBV/31-71     AC Q60H39.1
#=GS C4P1Q6_HBV/31-76     AC C4P1Q6.1
#=GS Q30BH4_HBV/31-113    AC Q30BH4.1
#=GS D3YGP5_HBV/2-183     AC D3YGP5.1
#=GS B4Z3M1_HBV/2-39      AC B4Z3M1.1
#=GS D8VBT9_HBV/31-80     AC D8VBT9.1
#=GS C7AY33_HBV/31-214    AC C7AY33.1
#=GS B6CIY4_HBV/31-173    AC B6CIY4.1
#=GS H3K3H7_HBV/31-212    AC H3K3H7.1
#=GS Q9WMW7_HBV/2-90      AC Q9WMW7.1
#=GS Q2EGE2_HBV/31-99     AC Q2EGE2.1
#=GS D5LC81_HBV/31-212    AC D5LC81.1
#=GS G0Z2W9_HBV/2-121     AC G0Z2W9.1
#=GS D3J631_HBV/31-87     AC D3J631.1
#=GS B4Z5W2_HBV/2-42      AC B4Z5W2.1
#=GS B4YTC8_HBV/2-173     AC B4YTC8.1
#=GS D6P5B7_HBV/2-183     AC D6P5B7.1
#=GS Q8AZ51_HBV/2-185     AC Q8AZ51.1
#=GS B6ULJ6_HBV/31-212    AC B6ULJ6.1
#=GS Q5KR12_HBV/2-183     AC Q5KR12.1
#=GS A9PLD4_HBV/1-39      AC A9PLD4.1
#=GS G1E840_HBV/31-212    AC G1E840.1
#=GS Q765F9_HBV/31-214    AC Q765F9.1
#=GS E0ZNY1_HBV/2-110     AC E0ZNY1.1
#=GS B5BPQ6_HBV/31-212    AC B5BPQ6.1
#=GS Q2EGD9_HBV/31-99     AC Q2EGD9.1
#=GS Q8QXR1_HBV/31-214    AC Q8QXR1.1
#=GS G1E826_HBV/31-212    AC G1E826.1
#=GS B4Z286_HBV/2-37      AC B4Z286.1
#=GS G0XT56_HBV/31-198    AC G0XT56.1
#=GS H6UND5_HBV/2-183     AC H6UND5.1
#=GS D3J5L5_HBV/31-57     AC D3J5L5.1
#=GS Q80H08_HBV/2-183     AC Q80H08.1
#=GS D8VC86_HBV/31-80     AC D8VC86.1
#=GS D6P599_HBV/2-183     AC D6P599.1
#=GS Q19K67_HBV/31-62     AC Q19K67.1
#=GS B9VK04_HBV/2-183     AC B9VK04.1
#=GS B4Z457_HBV/31-68     AC B4Z457.1
#=GS Q8JN09_HBV/31-212    AC Q8JN09.1
#=GS B4Z3K0_HBV/2-39      AC B4Z3K0.1
#=GS B4Z1U7_HBV/2-51      AC B4Z1U7.1
#=GS B4Z4J0_HBV/31-70     AC B4Z4J0.1
#=GS Q917J3_HBV/31-212    AC Q917J3.1
#=GS B4Z421_HBV/31-68     AC B4Z421.1
#=GS G1E8N0_HBV/31-212    AC G1E8N0.1
#=GS E0ZNC0_HBV/2-153     AC E0ZNC0.1
#=GS D8VBB7_HBV/31-212    AC D8VBB7.1
#=GS Q7TF70_HBV/31-212    AC Q7TF70.1
#=GS Q17UT4_HBVAW/31-214  AC Q17UT4.1
#=GS Q8B4F9_HBV/2-185     AC Q8B4F9.1
#=GS D3J6D2_HBV/31-70     AC D3J6D2.1
#=GS E0ZNI4_HBV/2-153     AC E0ZNI4.1
#=GS G9G8W8_HBV/31-212    AC G9G8W8.1
#=GS B4Z3B8_HBV/2-37      AC B4Z3B8.1
#=GS Q8JSW7_HBV/1-130     AC Q8JSW7.1
#=GS E3WCQ6_HBV/31-212    AC E3WCQ6.1
#=GS G0Z2Y1_HBV/2-121     AC G0Z2Y1.1
#=GS D3TK74_HBV/31-86     AC D3TK74.1
#=GS Q8V1I4_HBV/2-183     AC Q8V1I4.1
#=GS Q598S2_HBV/2-183     AC Q598S2.1
#=GS Q3LTY6_HBV/31-212    AC Q3LTY6.1
#=GS D3J677_HBV/31-68     AC D3J677.1
#=GS Q68068_HBV/31-212    AC Q68068.1
#=GS C4P1T1_HBV/31-76     AC C4P1T1.1
#=GS B3VB46_HBV/2-183     AC B3VB46.1
#=GS Q9E9A2_HBV/2-81      AC Q9E9A2.1
#=GS C4P1A0_HBV/31-76     AC C4P1A0.1
#=GS Q60H16_HBV/31-71     AC Q60H16.1
#=GS B5U722_HBV/31-212    AC B5U722.1
#=GS D3J5P3_HBV/31-57     AC D3J5P3.1
#=GS Q80GT4_HBV/128-178   AC Q80GT4.1
#=GS B5TXV8_HBV/31-212    AC B5TXV8.1
#=GS B4Z4T4_HBV/31-70     AC B4Z4T4.1
#=GS B0B2V4_HBV/31-212    AC B0B2V4.1
#=GS B4Z3B4_HBV/2-37      AC B4Z3B4.1
#=GS B4Z2I6_HBV/2-37      AC B4Z2I6.1
#=GS B4Z3N8_HBV/31-68     AC B4Z3N8.1
#=GS Q9YKB0_HBV/31-212    AC Q9YKB0.1
#=GS D3G6Y5_HBV/2-183     AC D3G6Y5.1
#=GS Q1MSU1_HBV/31-173    AC Q1MSU1.1
#=GS G1E862_HBV/2-183     AC G1E862.1
#=GS A9PLE0_HBV/1-39      AC A9PLE0.1
#=GS Q6I6Q2_HBV/31-74     AC Q6I6Q2.1
#=GS Q6XE97_HBV/2-185     AC Q6XE97.1
#=GS Q805N5_HBV/2-183     AC Q805N5.1
#=GS C4P1D7_HBV/31-76     AC C4P1D7.1
#=GS C9WDE9_HBV/2-183     AC C9WDE9.1
#=GS D3J5N2_HBV/31-70     AC D3J5N2.1
#=GS C1KTB8_HBV/31-210    AC C1KTB8.1
#=GS G1C8L6_HBV/2-183     AC G1C8L6.1
#=GS Q68045_HBV/31-212    AC Q68045.1
#=GS D6QVS2_HBV/2-185     AC D6QVS2.1
#=GS B5TXQ5_HBV/2-183     AC B5TXQ5.1
#=GS Q6XGW2_HBV/2-185     AC Q6XGW2.1
#=GS CAPSD_HBVA2/2-185    AC P03149.1
#=GS Q5UFS3_HBV/2-183     AC Q5UFS3.1
#=GS G9G8K3_HBV/31-212    AC G9G8K3.1
#=GS G1E875_HBV/31-212    AC G1E875.1
#=GS Q2L584_HBV/2-20      AC Q2L584.1
#=GS B7TUM2_HBV/2-183     AC B7TUM2.1
#=GS HBEAG_HBVC7/31-212   AC Q913A8.1
#=GS Q9QB02_HBV/2-183     AC Q9QB02.1
#=GS A0MMM4_HBV/1-91      AC A0MMM4.1
#=GS Q60GY4_HBV/31-71     AC Q60GY4.1
#=GS Q1MSS6_HBV/31-173    AC Q1MSS6.1
#=GS H6UGE7_HBV/2-183     AC H6UGE7.1
#=GS D9U5A0_HBV/2-183     AC D9U5A0.1
#=GS D3J610_HBV/31-85     AC D3J610.1
#=GS D3GE33_HBV/31-212    AC D3GE33.1
#=GS D3J2Y9_HBV/31-197    AC D3J2Y9.1
#=GS D8VBM5_HBV/31-80     AC D8VBM5.1
#=GS Q2EIF6_HBV/31-212    AC Q2EIF6.1
#=GS HBEAG_HBVA5/31-214   AC Q81105.2
#=GS E0ZND2_HBV/31-182    AC E0ZND2.1
#=GS G9G989_HBV/2-183     AC G9G989.1
#=GS B4Z601_HBV/2-42      AC B4Z601.1
#=GS D8VCD4_HBV/31-65     AC D8VCD4.1
#=GS G9G8R6_HBV/2-52      AC G9G8R6.1
#=GS G1E834_HBV/2-183     AC G1E834.1
#=GS D8VCC8_HBV/31-65     AC D8VCC8.1
#=GS F5C038_HBV/31-53     AC F5C038.1
#=GS B0B357_HBV/2-183     AC B0B357.1
#=GS B4Z4R3_HBV/31-70     AC B4Z4R3.1
#=GS D8VBT0_HBV/31-80     AC D8VBT0.1
#=GS B0FCV4_HBV/31-212    AC B0FCV4.1
#=GS A7L348_HBV/2-161     AC A7L348.1
#=GS H2ERJ1_HBV/2-183     AC H2ERJ1.1
#=GS B4Z697_HBV/2-41      AC B4Z697.1
#=GS B4X6K5_HBV/31-87     AC B4X6K5.1
#=GS A9CM73_HBV/2-183     AC A9CM73.1
#=GS B4Z1L8_HBV/31-71     AC B4Z1L8.1
#=GS Q6X5G8_HBV/1-86      AC Q6X5G8.1
#=GS D3J5Y9_HBV/31-80     AC D3J5Y9.1
#=GS D3J633_HBV/31-87     AC D3J633.1
#=GS B4Z2R8_HBV/31-70     AC B4Z2R8.1
#=GS D3J6A8_HBV/31-70     AC D3J6A8.1
#=GS D2JMT1_HBV/31-212    AC D2JMT1.1
#=GS C4P1D3_HBV/31-76     AC C4P1D3.1
#=GS D0EDY6_HBV/31-214    AC D0EDY6.1
#=GS B4Z2T7_HBV/2-41      AC B4Z2T7.1
#=GS Q60GZ0_HBV/31-71     AC Q60GZ0.1
#=GS C4P0Z7_HBV/31-76     AC C4P0Z7.1
#=GS CAPSD_HBVG2/14-195   AC P0C683.1
#=GS Q60H29_HBV/31-71     AC Q60H29.1
#=GS C1K1P1_HBV/31-212    AC C1K1P1.1
#=GS Q6TYG9_HBV/31-182    AC Q6TYG9.1
#=GS D0EEP4_HBV/2-185     AC D0EEP4.1
#=GS B4Z451_HBV/31-68     AC B4Z451.1
#=GS B4Z694_HBV/2-41      AC B4Z694.1
#=GS Q6X5G9_HBV/8-146     AC Q6X5G9.1
#=GS D8VBH6_HBV/31-144    AC D8VBH6.1
#=GS B0FCG3_HBV/2-183     AC B0FCG3.1
#=GS Q9J0U5_HBV/31-212    AC Q9J0U5.1
#=GS E0ZN80_HBV/2-153     AC E0ZN80.1
#=GS D2JME9_HBV/31-212    AC D2JME9.1
#=GS Q60H11_HBV/31-71     AC Q60H11.1
#=GS G1E7Q1_HBV/2-183     AC G1E7Q1.1
#=GS G8H3F6_HBV/2-78      AC G8H3F6.1
#=GS CAPSD_ASHV/2-187     AC Q64897.1
#=GS CAPSD_HBVC9/2-183    AC P0C6H8.1
#=GS G1E8Q1_HBV/2-183     AC G1E8Q1.1
#=GS D3J628_HBV/31-87     AC D3J628.1
#=GS B9VKB7_HBV/31-212    AC B9VKB7.1
#=GS I0DG55_HBV/31-212    AC I0DG55.1
#=GS A7J8K5_HBV/88-135    AC A7J8K5.1
#=GS G9G988_HBV/31-212    AC G9G988.1
#=GS C1KTB7_HBV/31-210    AC C1KTB7.1
#=GS G1E8B8_HBV/2-183     AC G1E8B8.1
#=GS B4Z661_HBV/2-41      AC B4Z661.1
#=GS D3J635_HBV/31-88     AC D3J635.1
#=GS C7AYT4_HBV/2-185     AC C7AYT4.1
#=GS B9VJY8_HBV/31-212    AC B9VJY8.1
#=GS Q7THQ6_HBV/31-103    AC Q7THQ6.1
#=GS Q4FDH2_HBV/31-212    AC Q4FDH2.1
#=GS B9VAY3_HBV/31-212    AC B9VAY3.1
#=GS D0UEA2_HBV/2-183     AC D0UEA2.1
#=GS C4P1C8_HBV/31-76     AC C4P1C8.1
#=GS A4F516_HBV/2-185     AC A4F516.1
#=GS B7TTN2_HBV/2-183     AC B7TTN2.1
#=GS G4XME2_HBV/31-212    AC G4XME2.1
#=GS A9PLF2_HBV/1-39      AC A9PLF2.1
#=GS Q75TL7_HBV/31-212    AC Q75TL7.1
#=GS D8VB88_HBV/31-79     AC D8VB88.1
#=GS D6QVW2_HBV/2-183     AC D6QVW2.1
#=GS B4Z2P1_HBV/2-41      AC B4Z2P1.1
#=GS B4Z2S9_HBV/2-41      AC B4Z2S9.1
#=GS C4P0X9_HBV/31-76     AC C4P0X9.1
#=GS C4P1R0_HBV/31-76     AC C4P1R0.1
#=GS A4ZRF8_HBV/31-163    AC A4ZRF8.1
#=GS B4Z652_HBV/2-41      AC B4Z652.1
#=GS Q8V1M5_HBV/31-212    AC Q8V1M5.1
#=GS Q9QB16_HBV/2-183     AC Q9QB16.1
#=GS A0FDK2_HBV/109-183   AC A0FDK2.1
#=GS Q60H13_HBV/31-71     AC Q60H13.1
#=GS B4Z5X0_HBV/31-71     AC B4Z5X0.1
#=GS D0EE27_HBV/31-214    AC D0EE27.1
#=GS D3XGG0_HBV/2-183     AC D3XGG0.1
#=GS Q8QHR7_HBV/31-212    AC Q8QHR7.1
#=GS C1K221_HBV/2-183     AC C1K221.1
#=GS B4Z3L4_HBV/31-68     AC B4Z3L4.1
#=GS Q8UYB8_HBV/31-212    AC Q8UYB8.1
#=GS Q2F510_HBV/31-212    AC Q2F510.1
#=GS Q60GX6_HBV/31-71     AC Q60GX6.1
#=GS G4XMQ0_HBV/31-212    AC G4XMQ0.1
#=GS Q81150_HBV/2-82      AC Q81150.1
#=GS G1C931_HBV/2-183     AC G1C931.1
#=GS B4X6N1_HBV/31-86     AC B4X6N1.1
#=GS Q67900_HBV/2-164     AC Q67900.1
#=GS Q9QMN9_HBV/2-183     AC Q9QMN9.1
#=GS Q1MSP4_HBV/31-173    AC Q1MSP4.1
#=GS B7TV87_HBV/2-183     AC B7TV87.1
#=GS C3W3S9_HBV/2-183     AC C3W3S9.1
#=GS Q80GZ5_HBV/2-183     AC Q80GZ5.1
#=GS Q91T08_HBV/31-214    AC Q91T08.1
#=GS C7AY70_HBV/31-214    AC C7AY70.1
#=GS Q19SZ5_HBV/2-183     AC Q19SZ5.1
#=GS Q917J2_HBV/31-212    AC Q917J2.1
#=GS Q8VBI0_HBV/2-181     AC Q8VBI0.1
#=GS Q8VBI9_HBV/2-183     AC Q8VBI9.1
#=GS B4Z649_HBV/2-41      AC B4Z649.1
#=GS Q2LC99_HBV/2-183     AC Q2LC99.1
#=GS Q6TYG3_HBV/31-182    AC Q6TYG3.1
#=GS Q6X5H0_HBV/1-130     AC Q6X5H0.1
#=GS B4Z5T9_HBV/2-42      AC B4Z5T9.1
#=GS D3YFY3_HBV/31-212    AC D3YFY3.1
#=GS B4Z446_HBV/2-39      AC B4Z446.1
#=GS C6F506_HBV/2-185     AC C6F506.1
#=GS D9U1L4_HBV/2-183     AC D9U1L4.1
#=GS C7DN67_HBV/2-185     AC C7DN67.1
#=GS Q6TYF3_HBV/31-182    AC Q6TYF3.1
#=GS D3J6A6_HBV/31-70     AC D3J6A6.1
#=GS D3YGR9_HBV/2-183     AC D3YGR9.1
#=GS D6P5A7_HBV/2-183     AC D6P5A7.1
#=GS Q2PWX0_HBV/2-185     AC Q2PWX0.1
#=GS Q6TYH8_HBV/31-182    AC Q6TYH8.1
#=GS G9G9N5_HBV/2-183     AC G9G9N5.1
#=GS G1E7Z2_HBV/31-212    AC G1E7Z2.1
#=GS D6QVT4_HBV/31-212    AC D6QVT4.1
#=GS A7L360_HBV/31-190    AC A7L360.1
#=GS C7DN34_HBV/31-212    AC C7DN34.1
#=GS Q918J1_HBV/2-183     AC Q918J1.1
#=GS CAPSD_DHBV3/2-262    AC P0C6J8.1
#=GS H2ER50_HBV/2-183     AC H2ER50.1
#=GS C4P1F0_HBV/31-76     AC C4P1F0.1
#=GS B4Z675_HBV/31-70     AC B4Z675.1
#=GS Q2L5H8_HBV/2-24      AC Q2L5H8.1
#=GS B5B4E8_HBV/113-180   AC B5B4E8.1
#=GS D2U5Y8_HBV/2-183     AC D2U5Y8.1
#=GS E0ZN96_HBV/31-182    AC E0ZN96.1
#=GS D8VC72_HBV/31-80     AC D8VC72.1
#=GS G8H3F6_HBV/76-103    AC G8H3F6.1
#=GS D8VCI8_HBV/2-37      AC D8VCI8.1
#=GS B6ULN3_HBV/2-183     AC B6ULN3.1
#=GS Q81113_HBV/49-230    AC Q81113.1
#=GS B7TTN8_HBV/31-212    AC B7TTN8.1
#=GS B4Z4I7_HBV/31-70     AC B4Z4I7.1
#=GS B4Z2Y6_HBV/31-66     AC B4Z2Y6.1
#=GS Q2L599_HBV/2-20      AC Q2L599.1
#=GS G9G8N8_HBV/2-183     AC G9G8N8.1
#=GS Q784K9_HBVF5/2-183   AC Q784K9.1
#=GS B4Z201_HBV/2-41      AC B4Z201.1
#=GS C1KTA8_HBV/31-212    AC C1KTA8.1
#=GS B4Z1M9_HBV/31-71     AC B4Z1M9.1
#=GS C0LKE3_HBV/2-183     AC C0LKE3.1
#=GS B2CSC5_HBV/2-183     AC B2CSC5.1
#=GS B4Z3N2_HBV/31-68     AC B4Z3N2.1
#=GS D8VBX4_HBV/2-51      AC D8VBX4.1
#=GS B4Z3S5_HBV/2-39      AC B4Z3S5.1
#=GS B4Z207_HBV/2-41      AC B4Z207.1
#=GS Q9WNA2_HBV/31-212    AC Q9WNA2.1
#=GS B9VK42_HBV/31-212    AC B9VK42.1
#=GS Q6RSF9_9HEPA/45-305  AC Q6RSF9.1
#=GS B5ASY5_HBV/2-183     AC B5ASY5.1
#=GS H6UGM0_HBV/2-183     AC H6UGM0.1
#=GS Q765C2_HBV/31-214    AC Q765C2.1
#=GS H6V893_HBV/31-56     AC H6V893.1
#=GS B4Z699_HBV/31-70     AC B4Z699.1
#=GS B4Z3Q6_HBV/31-68     AC B4Z3Q6.1
#=GS Q6TYF6_HBV/31-182    AC Q6TYF6.1
#=GS B4Z344_HBV/31-66     AC B4Z344.1
#=GS C9WE59_HBV/2-183     AC C9WE59.1
#=GS B4Z273_HBV/31-66     AC B4Z273.1
#=GS Q1MSU6_HBV/31-173    AC Q1MSU6.1
#=GS A4ZRF4_HBV/31-163    AC A4ZRF4.1
#=GS B6ULQ2_HBV/2-181     AC B6ULQ2.1
#=GS B4Z2I1_HBV/2-37      AC B4Z2I1.1
#=GS H6V8C9_HBV/31-56     AC H6V8C9.1
#=GS B5B4A3_HBV/2-183     AC B5B4A3.1
#=GS B3IVL5_HBV/31-212    AC B3IVL5.1
#=GS D6QVQ9_HBV/2-183     AC D6QVQ9.1
#=GS E0ZP81_HBV/2-110     AC E0ZP81.1
#=GS C9WDF2_HBV/31-212    AC C9WDF2.1
#=GS B4Z3P1_HBV/31-68     AC B4Z3P1.1
#=GS B0B374_HBV/2-183     AC B0B374.1
#=GS H1ZN42_HBV/2-183     AC H1ZN42.1
#=GS D8VC56_HBV/2-51      AC D8VC56.1
#=GS C6F4K3_HBV/2-185     AC C6F4K3.1
#=GS B4Z3P8_HBV/2-39      AC B4Z3P8.1
#=GS G1C924_HBV/2-183     AC G1C924.1
#=GS Q6TYG5_HBV/31-182    AC Q6TYG5.1
#=GS D0EE58_HBV/31-214    AC D0EE58.1
#=GS G9G9N4_HBV/31-212    AC G9G9N4.1
#=GS C7AYW3_HBV/31-214    AC C7AYW3.1
#=GS B4Z2K0_HBV/2-41      AC B4Z2K0.1
#=GS C4P0Y8_HBV/31-76     AC C4P0Y8.1
#=GS B9VK18_HBV/31-212    AC B9VK18.1
#=GS C4P0X3_HBV/31-76     AC C4P0X3.1
#=GS I0DG58_HBV/31-212    AC I0DG58.1
#=GS B4Z413_HBV/2-39      AC B4Z413.1
#=GS D3J6A7_HBV/31-70     AC D3J6A7.1
#=GS B4Z2X2_HBV/31-70     AC B4Z2X2.1
#=GS B4Z2R2_HBV/31-70     AC B4Z2R2.1
#=GS Q00K69_HBV/2-183     AC Q00K69.1
#=GS D3TK68_HBV/53-106    AC D3TK68.1
#=GS B4Z1J1_HBV/31-71     AC B4Z1J1.1
#=GS G8Z910_HBV/2-139     AC G8Z910.1
#=GS Q1MSP7_HBV/31-173    AC Q1MSP7.1
#=GS Q2PWW6_HBV/2-185     AC Q2PWW6.1
#=GS B4Z398_HBV/31-66     AC B4Z398.1
#=GS B3VAJ5_HBV/2-183     AC B3VAJ5.1
#=GS B7TU12_HBV/31-212    AC B7TU12.1
#=GS B4Z3Y7_HBV/2-39      AC B4Z3Y7.1
#=GS C4P1J2_HBV/31-76     AC C4P1J2.1
#=GS G1E841_HBV/2-183     AC G1E841.1
#=GS B4Z3F6_HBV/31-71     AC B4Z3F6.1
#=GS Q7TG32_9HEPA/45-305  AC Q7TG32.1
#=GS Q2L5H3_HBV/2-24      AC Q2L5H3.1
#=GS B4Z2K8_HBV/31-70     AC B4Z2K8.1
#=GS B6ULI4_HBV/31-95     AC B6ULI4.1
#=GS Q2EGH6_HBV/31-99     AC Q2EGH6.1
#=GS B3VAI6_HBV/2-183     AC B3VAI6.1
#=GS F1AES5_HBV/2-185     AC F1AES5.1
#=GS Q1MSL8_HBV/31-173    AC Q1MSL8.1
#=GS B5TXK3_HBV/31-212    AC B5TXK3.1
#=GS C4P1G2_HBV/31-76     AC C4P1G2.1
#=GS Q404G3_HBV/2-183     AC Q404G3.1
#=GS Q8QP17_HBV/1-130     AC Q8QP17.1
#=GS D8VBH1_HBV/2-115     AC D8VBH1.1
#=GS D3YG14_HBV/2-183     AC D3YG14.1
#=GS D3YG56_HBV/2-183     AC D3YG56.1
#=GS Q8QMM3_HBV/31-212    AC Q8QMM3.1
#=GS D8VC22_HBV/2-25      AC D8VC22.1
#=GS C4P1J5_HBV/31-76     AC C4P1J5.1
#=GS D6P5B6_HBV/76-154    AC D6P5B6.1
#=GS Q507F6_HBV/31-163    AC Q507F6.1
#=GS Q14U93_HBV/31-78     AC Q14U93.1
#=GS E0ZN89_HBV/2-153     AC E0ZN89.1
#=GS Q91PP3_HBV/30-156    AC Q91PP3.1
#=GS D3G6Y4_HBV/31-212    AC D3G6Y4.1
#=GS B9VKG7_HBV/2-183     AC B9VKG7.1
#=GS D2JMR8_HBV/2-183     AC D2JMR8.1
#=GS Q2LCD3_HBV/2-183     AC Q2LCD3.1
#=GS G9HVE5_HBV/31-212    AC G9HVE5.1
#=GS Q00K89_HBV/2-183     AC Q00K89.1
#=GS Q80AG7_HBV/2-183     AC Q80AG7.1
#=GS Q80AG8_HBV/2-183     AC Q80AG8.1
#=GS B4Z4P3_HBV/2-41      AC B4Z4P3.1
#=GS D3J5T4_HBV/31-88     AC D3J5T4.1
#=GS B9VK34_HBV/2-183     AC B9VK34.1
#=GS Q917H9_HBV/31-214    AC Q917H9.1
#=GS B9VKY8_HBV/2-183     AC B9VKY8.1
#=GS D7NL28_HBV/2-183     AC D7NL28.1
#=GS Q91A47_HBV/31-66     AC Q91A47.1
#=GS Q6RSG8_9HEPA/2-262   AC Q6RSG8.1
#=GS D3TJ97_HBV/74-118    AC D3TJ97.1
#=GS B4Z6B4_HBV/31-70     AC B4Z6B4.1
#=GS Q2TJG4_HBV/2-131     AC Q2TJG4.1
#=GS D3YGF4_HBV/2-183     AC D3YGF4.1
#=GS E0ZNI1_HBV/2-153     AC E0ZNI1.1
#=GS C4P1H7_HBV/31-76     AC C4P1H7.1
#=GS B7TU56_HBV/2-183     AC B7TU56.1
#=GS Q30BH2_HBV/31-113    AC Q30BH2.1
#=GS B6CIV3_HBV/31-173    AC B6CIV3.1
#=GS HBEAG_HBVB2/31-212   AC P0C6G7.1
#=GS B4Z330_HBV/2-37      AC B4Z330.1
#=GS C4P149_HBV/31-76     AC C4P149.1
#=GS B5LIK3_HBV/2-162     AC B5LIK3.1
#=GS B2Y6S7_HBV/22-205    AC B2Y6S7.1
#=GS B5LIJ7_HBV/2-162     AC B5LIJ7.1
#=GS G0Z306_HBV/2-121     AC G0Z306.1
#=GS B4Z1R5_HBV/31-80     AC B4Z1R5.1
#=GS C7DMJ7_HBV/31-212    AC C7DMJ7.1
#=GS D9U5B8_HBV/88-135    AC D9U5B8.1
#=GS C4P1K6_HBV/31-76     AC C4P1K6.1
#=GS D8VBS5_HBV/2-183     AC D8VBS5.1
#=GS C4P1E1_HBV/31-76     AC C4P1E1.1
#=GS Q6QZQ8_9HEPA/2-262   AC Q6QZQ8.1
#=GS B6ULH0_HBV/31-56     AC B6ULH0.1
#=GS Q8JSW9_HBV/1-130     AC Q8JSW9.1
#=GS B2LW91_HBV/2-183     AC B2LW91.1
#=GS G0Z2Z5_HBV/2-121     AC G0Z2Z5.1
#=GS Q8B4G4_HBV/31-214    AC Q8B4G4.1
#=GS C7DSI4_HBV/2-183     AC C7DSI4.1
#=GS B5M5Y0_HBV/31-212    AC B5M5Y0.1
#=GS C4P1H4_HBV/31-76     AC C4P1H4.1
#=GS B5TXZ4_HBV/2-183     AC B5TXZ4.1
#=GS H6V8B1_HBV/31-56     AC H6V8B1.1
#=GS C7DMV8_HBV/31-212    AC C7DMV8.1
#=GS C7AYR6_HBV/31-214    AC C7AYR6.1
#=GS D8VBU6_HBV/2-48      AC D8VBU6.1
#=GS B4Z3M9_HBV/31-68     AC B4Z3M9.1
#=GS C3V8M4_HBV/2-85      AC C3V8M4.1
#=GS Q8QHN8_HBV/31-212    AC Q8QHN8.1
#=GS C4P1B4_HBV/31-76     AC C4P1B4.1
#=GS E3VLB3_HBV/19-200    AC E3VLB3.1
#=GS F1AEY4_HBV/31-212    AC F1AEY4.1
#=GS D0UEC3_HBV/2-183     AC D0UEC3.1
#=GS B4Z1W6_HBV/2-41      AC B4Z1W6.1
#=GS C9WDA0_HBV/2-183     AC C9WDA0.1
#=GS D5LFK8_HBV/2-183     AC D5LFK8.1
#=GS C4P146_HBV/31-76     AC C4P146.1
#=GS D0EZ09_HBV/2-183     AC D0EZ09.1
#=GS G1E7K8_HBV/31-212    AC G1E7K8.1
#=GS B9VJZ6_HBV/2-183     AC B9VJZ6.1
#=GS D3J630_HBV/31-87     AC D3J630.1
#=GS B4Y4M0_HBV/2-183     AC B4Y4M0.1
#=GS C4P1P7_HBV/31-76     AC C4P1P7.1
#=GS B7TTZ2_HBV/2-183     AC B7TTZ2.1
#=GS B7TTM5_HBV/2-183     AC B7TTM5.1
#=GS B4Z2N1_HBV/31-70     AC B4Z2N1.1
#=GS B7TUC0_HBV/2-183     AC B7TUC0.1
#=GS Q80AH3_HBV/2-183     AC Q80AH3.1
#=GS C4P1B7_HBV/31-76     AC C4P1B7.1
#=GS C7DMN1_HBV/2-183     AC C7DMN1.1
#=GS D0EE73_HBV/2-185     AC D0EE73.1
#=GS D0EE84_HBV/31-214    AC D0EE84.1
#=GS C4P1J8_HBV/31-76     AC C4P1J8.1
#=GS D2JMJ1_HBV/2-183     AC D2JMJ1.1
#=GS D8VBA0_HBV/31-80     AC D8VBA0.1
#=GS B4Y4H5_HBV/2-183     AC B4Y4H5.1
#=GS Q2I360_HBV/2-183     AC Q2I360.1
#=GS Q60GV1_HBV/31-71     AC Q60GV1.1
#=GS B4Z2P3_HBV/31-70     AC B4Z2P3.1
#=GS G1ETU4_HBV/2-183     AC G1ETU4.1
#=GS Q8QSB1_HBV/31-212    AC Q8QSB1.1
#=GS A9QPX3_HBV/2-183     AC A9QPX3.1
#=GS F5C1S7_HBV/2-185     AC F5C1S7.1
#=GS Q1MSJ7_HBV/31-173    AC Q1MSJ7.1
#=GS G1EII8_HBV/2-153     AC G1EII8.1
#=GS H2ERG1_HBV/2-79      AC H2ERG1.1
#=GS E0D3B2_HBV/31-212    AC E0D3B2.1
#=GS Q2EGD7_HBV/31-84     AC Q2EGD7.1
#=GS Q6XGH9_HBV/2-183     AC Q6XGH9.1
#=GS Q9QMP3_HBV/2-183     AC Q9QMP3.1
#=GS B4Z2W0_HBV/31-70     AC B4Z2W0.1
#=GS Q60GX4_HBV/31-71     AC Q60GX4.1
#=GS D8VC67_HBV/2-36      AC D8VC67.1
#=GS G0VSF5_HBV/2-185     AC G0VSF5.1
#=GS C1K1I3_HBV/2-183     AC C1K1I3.1
#=GS A4ZRG2_HBV/31-163    AC A4ZRG2.1
#=GS B3VAZ3_HBV/2-183     AC B3VAZ3.1
#=GS CAPSD_HBVC8/2-183    AC Q81164.1
#=GS D3J6E8_HBV/31-70     AC D3J6E8.1
#=GS G8H3G4_HBV/2-131     AC G8H3G4.1
#=GS C7DSK4_HBV/31-212    AC C7DSK4.1
#=GS C3W4H3_HBV/31-212    AC C3W4H3.1
#=GS Q5Q0Y3_HBV/2-183     AC Q5Q0Y3.1
#=GS E0ZRN1_HBV/31-212    AC E0ZRN1.1
#=GS Q6RSE8_9HEPA/2-262   AC Q6RSE8.1
#=GS B0FCA5_HBV/2-183     AC B0FCA5.1
#=GS D2U608_HBV/2-183     AC D2U608.1
#=GS C7AYA0_HBV/31-214    AC C7AYA0.1
#=GS Q2PXI3_HBV/31-150    AC Q2PXI3.1
#=GS B3VAU6_HBV/2-183     AC B3VAU6.1
#=GS Q67850_9HEPA/45-305  AC Q67850.1
#=GS Q60H09_HBV/31-71     AC Q60H09.1
#=GS A9CM48_HBV/2-183     AC A9CM48.1
#=GS D6QVE7_HBV/2-183     AC D6QVE7.1
#=GS B9VK50_HBV/2-183     AC B9VK50.1
#=GS B3VB72_HBV/2-183     AC B3VB72.1
#=GS Q80SD7_HBV/31-212    AC Q80SD7.1
#=GS B3V3S1_HBV/2-183     AC B3V3S1.1
#=GS G1C8R4_HBV/2-183     AC G1C8R4.1
#=GS G1C8W3_HBV/2-183     AC G1C8W3.1
#=GS D8VCI0_HBV/31-80     AC D8VCI0.1
#=GS B4Z4N3_HBV/31-70     AC B4Z4N3.1
#=GS D6QW03_HBV/31-212    AC D6QW03.1
#=GS C4P111_HBV/31-76     AC C4P111.1
#=GS E3Q0L2_HBV/31-212    AC E3Q0L2.1
#=GS C1K1G2_HBV/2-183     AC C1K1G2.1
#=GS H6UNE7_HBV/2-183     AC H6UNE7.1
#=GS CAPSD_HBVH3/2-183    AC P0C6I6.1
#=GS B5A2H6_HBV/31-212    AC B5A2H6.1
#=GS B4Z433_HBV/31-68     AC B4Z433.1
#=GS Q1MSS5_HBV/31-167    AC Q1MSS5.1
#=GS C7DNL4_HBV/2-183     AC C7DNL4.1
#=GS B4Z2H1_HBV/31-66     AC B4Z2H1.1
#=GS Q9WP56_HBV/31-87     AC Q9WP56.1
#=GS B5B4D9_HBV/2-67      AC B5B4D9.1
#=GS D3J5V6_HBV/31-89     AC D3J5V6.1
#=GS B9VJX7_HBV/2-183     AC B9VJX7.1
#=GS D8VBB2_HBV/2-130     AC D8VBB2.1
#=GS B0B393_HBV/2-147     AC B0B393.1
#=GS B4Z3K3_HBV/2-39      AC B4Z3K3.1
#=GS B4Z1N9_HBV/2-42      AC B4Z1N9.1
#=GS D5LCA9_HBV/2-183     AC D5LCA9.1
#=GS Q60GX7_HBV/31-71     AC Q60GX7.1
#=GS Q8QSB6_HBV/31-212    AC Q8QSB6.1
#=GS Q2EGC5_HBV/31-99     AC Q2EGC5.1
#=GS B0B2M4_HBV/31-212    AC B0B2M4.1
#=GS D6QVJ5_HBV/2-183     AC D6QVJ5.1
#=GS B2LW97_HBV/2-183     AC B2LW97.1
#=GS O91510_HBV/31-212    AC O91510.1
#=GS D8VCF4_HBV/31-65     AC D8VCF4.1
#=GS B5M5C3_HBV/31-212    AC B5M5C3.1
#=GS HBEAG_HBVC3/31-212   AC P0C6H5.1
#=GS B4Z636_HBV/2-41      AC B4Z636.1
#=GS C7AYP9_HBV/2-185     AC C7AYP9.1
#=GS C4P1Q9_HBV/31-76     AC C4P1Q9.1
#=GS Q8VBJ0_HBV/2-183     AC Q8VBJ0.1
#=GS D0E5Q6_HBV/31-212    AC D0E5Q6.1
#=GS Q917K0_HBV/2-183     AC Q917K0.1
#=GS B4Z356_HBV/31-66     AC B4Z356.1
#=GS D3J6G0_HBV/32-69     AC D3J6G0.1
#=GS Q1PCY1_HBV/31-212    AC Q1PCY1.1
#=GS G9MD65_HBV/2-183     AC G9MD65.1
#=GS Q6XJX8_HBV/2-183     AC Q6XJX8.1
#=GS D5LB94_HBV/31-212    AC D5LB94.1
#=GS Q8AZ19_HBV/2-183     AC Q8AZ19.1
#=GS D8VCH3_HBV/2-37      AC D8VCH3.1
#=GS P90190_HBV/2-183     AC P90190.1
#=GS Q8VBH0_HBV/2-183     AC Q8VBH0.1
#=GS G1E8A0_HBV/2-183     AC G1E8A0.1
#=GS B5ATC2_HBV/2-183     AC B5ATC2.1
#=GS D0EYY9_HBV/31-212    AC D0EYY9.1
#=GS C4P151_HBV/31-76     AC C4P151.1
#=GS Q8AZ33_HBV/31-214    AC Q8AZ33.1
#=GS Q2EGG5_HBV/31-99     AC Q2EGG5.1
#=GS B4Z1U1_HBV/2-51      AC B4Z1U1.1
#=GS H6UG68_HBV/31-212    AC H6UG68.1
#=GS B0FD52_HBV/2-183     AC B0FD52.1
#=GS D3J5P4_HBV/31-57     AC D3J5P4.1
#=GS D2U658_HBV/2-183     AC D2U658.1
#=GS A4ZRF3_HBV/2-134     AC A4ZRF3.1
#=GS B4Z2T2_HBV/2-41      AC B4Z2T2.1
#=GS D0UE38_HBV/2-183     AC D0UE38.1
#=GS F1AET0_HBV/2-185     AC F1AET0.1
#=GS Q9QMH8_HBV/31-212    AC Q9QMH8.1
#=GS Q45F57_HBV/2-183     AC Q45F57.1
#=GS Q2L576_HBV/2-20      AC Q2L576.1
#=GS D6P596_HBV/31-212    AC D6P596.1
#=GS B3VB80_HBV/2-183     AC B3VB80.1
#=GS Q2L593_HBV/2-20      AC Q2L593.1
#=GS D6P5A9_HBV/2-183     AC D6P5A9.1
#=GS A1KR35_HBV/2-25      AC A1KR35.1
#=GS B4Z2L2_HBV/2-41      AC B4Z2L2.1
#=GS B2Y6W5_HBV/31-212    AC B2Y6W5.1
#=GS D4I4T3_HBV/2-185     AC D4I4T3.1
#=GS B4Z1Z5_HBV/2-41      AC B4Z1Z5.1
#=GS B5B4K5_HBV/31-212    AC B5B4K5.1
#=GS D0EE59_HBV/2-185     AC D0EE59.1
#=GS H9BMR4_HBV/2-168     AC H9BMR4.1
#=GS H9BMW4_HBV/2-160     AC H9BMW4.1
#=GS B4Z2E4_HBV/31-66     AC B4Z2E4.1
#=GS B4Z6A9_HBV/2-41      AC B4Z6A9.1
#=GS D8VBQ4_HBV/31-80     AC D8VBQ4.1
#=GS B5AT79_HBV/2-183     AC B5AT79.1
#=GS D2JMM1_HBV/31-212    AC D2JMM1.1
#=GS G8H3G1_HBV/2-131     AC G8H3G1.1
#=GS D8VBF9_HBV/2-130     AC D8VBF9.1
#=GS H6UGJ6_HBV/2-183     AC H6UGJ6.1
#=GS B9VL76_HBV/2-183     AC B9VL76.1
#=GS C4P1C1_HBV/31-76     AC C4P1C1.1
#=GS Q80J61_HBV/2-36      AC Q80J61.1
#=GS B5ATC1_HBV/31-212    AC B5ATC1.1
#=GS C7DY80_HBV/31-212    AC C7DY80.1
#=GS C3W3X7_HBV/2-183     AC C3W3X7.1
#=GS A9PLH0_HBV/1-39      AC A9PLH0.1
#=GS Q2L573_HBV/2-20      AC Q2L573.1
#=GS F4MJJ9_HBV/31-81     AC F4MJJ9.1
#=GS Q6RSG4_9HEPA/45-305  AC Q6RSG4.1
#=GS C1K1J0_HBV/2-183     AC C1K1J0.1
#=GS D3J656_HBV/31-88     AC D3J656.1
#=GS Q60GV3_HBV/31-71     AC Q60GV3.1
#=GS D8VBE6_HBV/31-54     AC D8VBE6.1
#=GS B0YK57_HBV/31-212    AC B0YK57.1
#=GS D8VBY6_HBV/31-80     AC D8VBY6.1
#=GS D8VBG8_HBV/2-25      AC D8VBG8.1
#=GS B4Z4M0_HBV/31-70     AC B4Z4M0.1
#=GS C9WD93_HBV/2-183     AC C9WD93.1
#=GS C4P1P5_HBV/31-76     AC C4P1P5.1
#=GS G9G961_HBV/31-212    AC G9G961.1
#=GS C4P1G9_HBV/31-76     AC C4P1G9.1
#=GS G3E5H7_HBV/2-183     AC G3E5H7.1
#=GS B6D6F3_HBV/2-125     AC B6D6F3.1
#=GS D3J5X5_HBV/31-89     AC D3J5X5.1
#=GS Q1MSM9_HBV/31-140    AC Q1MSM9.1
#=GS Q9PWT3_HBV/2-183     AC Q9PWT3.1
#=GS D3TIH9_HBV/31-212    AC D3TIH9.1
#=GS B2Y6J5_HBV/2-183     AC B2Y6J5.1
#=GS Q9J3T9_HBV/1-65      AC Q9J3T9.1
#=GS Q67959_HBV/2-183     AC Q67959.1
#=GS Q67970_HBV/2-183     AC Q67970.1
#=GS Q80MM3_HBV/2-182     AC Q80MM3.1
#=GS E5RD60_HBV/31-212    AC E5RD60.1
#=GS D3J5M9_HBV/31-70     AC D3J5M9.1
#=GS Q1MSW5_HBV/31-173    AC Q1MSW5.1
#=GS B4Z2C2_HBV/2-37      AC B4Z2C2.1
#=GS Q9J3T8_HBV/1-65      AC Q9J3T8.1
#=GS D2JMI1_HBV/31-212    AC D2JMI1.1
#=GS I0DG63_HBV/31-212    AC I0DG63.1
#=GS C4P165_HBV/31-76     AC C4P165.1
#=GS D3TK75_HBV/2-57      AC D3TK75.1
#=GS E0ZP14_HBV/2-110     AC E0ZP14.1
#=GS B7TUB2_HBV/2-183     AC B7TUB2.1
#=GS C7DMV2_HBV/2-183     AC C7DMV2.1
#=GS C9WDD0_HBV/2-183     AC C9WDD0.1
#=GS Q2AC05_HBV/1-165     AC Q2AC05.1
#=GS B4Z1N0_HBV/2-42      AC B4Z1N0.1
#=GS Q45F25_HBV/31-212    AC Q45F25.1
#=GS C4P110_HBV/31-76     AC C4P110.1
#=GS B5M5Q7_HBV/31-212    AC B5M5Q7.1
#=GS XCORE_HBVC4/178-359  AC Q67863.1
#=GS Q6XJX9_HBV/2-183     AC Q6XJX9.1
#=GS E2FKL2_HBV/31-182    AC E2FKL2.1
#=GS C9D7M8_HBV/31-214    AC C9D7M8.1
#=GS Q6I6V2_HBV/31-74     AC Q6I6V2.1
#=GS H6UGI4_HBV/2-183     AC H6UGI4.1
#=GS Q6UFV8_HBV/1-135     AC Q6UFV8.1
#=GS B5M5V1_HBV/31-212    AC B5M5V1.1
#=GS B4Z2D3_HBV/31-66     AC B4Z2D3.1
#=GS D5LDM0_HBV/31-212    AC D5LDM0.1
#=GS Q5G3F3_HBV/31-54     AC Q5G3F3.1
#=GS B4X6H8_HBV/30-86     AC B4X6H8.1
#=GS B4Z5U7_HBV/2-42      AC B4Z5U7.1
#=GS G0Z2Z0_HBV/2-121     AC G0Z2Z0.1
#=GS Q2LCE1_HBV/2-183     AC Q2LCE1.1
#=GS D9U5K5_HBV/31-212    AC D9U5K5.1
#=GS C7DML2_HBV/2-183     AC C7DML2.1
#=GS E0ZNA0_HBV/2-153     AC E0ZNA0.1
#=GS A9PLF9_HBV/1-39      AC A9PLF9.1
#=GS B4Z1W2_HBV/2-41      AC B4Z1W2.1
#=GS C4P1I5_HBV/31-76     AC C4P1I5.1
#=GS B4Z6C1_HBV/2-41      AC B4Z6C1.1
#=GS H9BMS1_HBV/1-146     AC H9BMS1.1
#=GS B4Z624_HBV/2-41      AC B4Z624.1
#=GS Q5G3J0_HBV/31-54     AC Q5G3J0.1
#=GS C4P1P0_HBV/31-76     AC C4P1P0.1
#=GS D3J5S3_HBV/31-57     AC D3J5S3.1
#=GS D3K2E5_HBV/2-183     AC D3K2E5.1
#=GS H9BMR2_HBV/2-168     AC H9BMR2.1
#=GS H9BE10_HBV/2-183     AC H9BE10.1
#=GS Q9DUH2_HBV/2-183     AC Q9DUH2.1
#=GS B4Z4T8_HBV/2-41      AC B4Z4T8.1
#=GS Q4FDG4_HBV/31-212    AC Q4FDG4.1
#=GS Q7T432_HBV/31-212    AC Q7T432.1
#=GS D0UE53_HBV/2-183     AC D0UE53.1
#=GS G0Z2W4_HBV/2-121     AC G0Z2W4.1
#=GS G0Z2X2_HBV/2-121     AC G0Z2X2.1
#=GS Q507G1_HBV/31-163    AC Q507G1.1
#=GS B5BPK0_HBV/31-212    AC B5BPK0.1
#=GS Q9WFB1_9HEPA/45-305  AC Q9WFB1.1
#=GS G9G9T4_HBV/31-82     AC G9G9T4.1
#=GS G9G8Z0_HBV/2-183     AC G9G8Z0.1
#=GS B6CEV8_HBV/2-183     AC B6CEV8.1
#=GS C4P1B2_HBV/31-76     AC C4P1B2.1
#=GS Q60H35_HBV/31-71     AC Q60H35.1
#=GS Q60GW0_HBV/31-71     AC Q60GW0.1
#=GS D9U5E1_HBV/2-183     AC D9U5E1.1
#=GS Q80GU1_HBV/2-183     AC Q80GU1.1
#=GS B0YK51_HBV/2-183     AC B0YK51.1
#=GS D9U1L3_HBV/31-212    AC D9U1L3.1
#=GS B4Z2F0_HBV/2-37      AC B4Z2F0.1
#=GS B0FDA2_HBV/31-212    AC B0FDA2.1
#=GS E0ZP08_HBV/2-110     AC E0ZP08.1
#=GS B4Z3C6_HBV/31-66     AC B4Z3C6.1
#=GS E8Z629_HBV/2-183     AC E8Z629.1
#=GS B4Z216_HBV/31-70     AC B4Z216.1
#=GS D8VCI1_HBV/2-51      AC D8VCI1.1
#=GS F5C1F8_HBV/2-183     AC F5C1F8.1
#=GS Q8BCA9_HBV/2-185     AC Q8BCA9.1
#=GS E5CZ11_HBV/2-183     AC E5CZ11.1
#=GS Q7TF73_HBV/34-215    AC Q7TF73.1
#=GS Q68042_HBV/31-212    AC Q68042.1
#=GS Q8QP15_HBV/1-130     AC Q8QP15.1
#=GS C7DY97_HBV/31-212    AC C7DY97.1
#=GS CAPSD_WHV3/2-188     AC P69712.1
#=GS C1K1D7_HBV/31-115    AC C1K1D7.1
#=GS A9PLF8_HBV/1-39      AC A9PLF8.1
#=GS Q9E0Q1_HBV/2-123     AC Q9E0Q1.1
#=GS D6P5B4_HBV/2-183     AC D6P5B4.1
#=GS Q765C9_HBV/31-214    AC Q765C9.1
#=GS F1AEP2_HBV/31-214    AC F1AEP2.1
#=GS Q8VBJ8_HBV/2-183     AC Q8VBJ8.1
#=GS B6ULG3_HBV/31-212    AC B6ULG3.1
#=GS Q15194_HBV/31-214    AC Q15194.1
#=GS B4Z212_HBV/31-70     AC B4Z212.1
#=GS D3TK36_HBV/31-212    AC D3TK36.1
#=GS E0ZNA3_HBV/2-138     AC E0ZNA3.1
#=GS D3J5X8_HBV/31-88     AC D3J5X8.1
#=GS Q80JB3_HBV/2-181     AC Q80JB3.1
#=GS Q6I6T4_HBV/31-71     AC Q6I6T4.1
#=GS G8Z908_HBV/31-168    AC G8Z908.1
#=GS D0EDU7_HBV/2-183     AC D0EDU7.1
#=GS Q8UZL3_HBV/31-212    AC Q8UZL3.1
#=GS Q6XEA5_HBV/2-183     AC Q6XEA5.1
#=GS B8PTF1_HBV/2-183     AC B8PTF1.1
#=GS D3TK02_HBV/88-135    AC D3TK02.1
#=GS B4Z3T9_HBV/31-68     AC B4Z3T9.1
#=GS B4Z4I4_HBV/31-70     AC B4Z4I4.1
#=GS D3J6H0_HBV/31-70     AC D3J6H0.1
#=GS B4Z690_HBV/31-70     AC B4Z690.1
#=GS B4Z415_HBV/31-68     AC B4Z415.1
#=GS E0ZS18_HBV/2-185     AC E0ZS18.1
#=GS D0UDX1_HBV/103-180   AC D0UDX1.1
#=GS G1E854_HBV/31-212    AC G1E854.1
#=GS Q19K62_HBV/31-62     AC Q19K62.1
#=GS D3J647_HBV/31-84     AC D3J647.1
#=GS Q80J98_HBV/31-212    AC Q80J98.1
#=GS B4Z3X2_HBV/2-39      AC B4Z3X2.1
#=GS Q67986_HBV/2-183     AC Q67986.1
#=GS B5B4I1_HBV/2-183     AC B5B4I1.1
#=GS D8VBA3_HBV/31-80     AC D8VBA3.1
#=GS H6URY3_HBV/31-212    AC H6URY3.1
#=GS B0FD82_HBV/2-181     AC B0FD82.1
#=GS E3Q0M6_HBV/31-212    AC E3Q0M6.1
#=GS D4HMY7_HBV/1-52      AC D4HMY7.1
#=GS Q80GV9_HBV/31-212    AC Q80GV9.1
#=GS B4Z1T8_HBV/2-51      AC B4Z1T8.1
#=GS C4P0X7_HBV/31-76     AC C4P0X7.1
#=GS B6ULN7_HBV/2-63      AC B6ULN7.1
#=GS C4P162_HBV/31-76     AC C4P162.1
#=GS Q7TDR6_HBV/2-183     AC Q7TDR6.1
#=GS Q5R2M8_HBV/2-181     AC Q5R2M8.1
#=GS C7DMN7_HBV/2-183     AC C7DMN7.1
#=GS B7TUI1_HBV/31-212    AC B7TUI1.1
#=GS B6D694_HBV/2-38      AC B6D694.1
#=GS H2ERE3_HBV/31-212    AC H2ERE3.1
#=GS B4Z473_HBV/2-39      AC B4Z473.1
#=GS Q7T7X4_HBV/2-183     AC Q7T7X4.1
#=GS G9G9T0_HBV/2-52      AC G9G9T0.1
#=GS B5B4P2_HBV/31-212    AC B5B4P2.1
#=GS B6ULN1_HBV/2-183     AC B6ULN1.1
#=GS C0LKF9_HBV/2-183     AC C0LKF9.1
#=GS Q1MSN5_HBV/31-173    AC Q1MSN5.1
#=GS B5U737_HBV/2-183     AC B5U737.1
#=GS Q09L28_HBV/2-20      AC Q09L28.1
#=GS B4Z5S5_HBV/2-42      AC B4Z5S5.1
#=GS Q2I364_HBV/2-183     AC Q2I364.1
#=GS D3J601_HBV/31-80     AC D3J601.1
#=GS B2CY28_HBV/2-183     AC B2CY28.1
#=GS B3IUP4_HBV/31-212    AC B3IUP4.1
#=GS O39881_HBV/2-183     AC O39881.1
#=GS B4Z283_HBV/2-37      AC B4Z283.1
#=GS Q8QP26_HBV/1-130     AC Q8QP26.1
#=GS Q9WP85_HBV/102-174   AC Q9WP85.1
#=GS Q2EGF4_HBV/31-90     AC Q2EGF4.1
#=GS C4P1R3_HBV/31-76     AC C4P1R3.1
#=GS Q77MX7_HBV/2-183     AC Q77MX7.1
#=GS G1EIJ9_HBV/2-153     AC G1EIJ9.1
#=GS B4Z1T2_HBV/2-50      AC B4Z1T2.1
#=GS A3RFF4_HBV/31-65     AC A3RFF4.1
#=GS C1K1J7_HBV/2-183     AC C1K1J7.1
#=GS B4Z234_HBV/31-70     AC B4Z234.1
#=GS B4Z274_HBV/2-37      AC B4Z274.1
#=GS Q91SZ3_HBV/31-212    AC Q91SZ3.1
#=GS B4Z5U8_HBV/31-71     AC B4Z5U8.1
#=GS B3VAM8_HBV/2-183     AC B3VAM8.1
#=GS Q09L23_HBV/2-20      AC Q09L23.1
#=GS Q7TED4_HBV/31-163    AC Q7TED4.1
#=GS B4X6J2_HBV/31-87     AC B4X6J2.1
#=GS C9W1Z3_HBV/2-183     AC C9W1Z3.1
#=GS B0FCA4_HBV/31-212    AC B0FCA4.1
#=GS B4Z5V7_HBV/31-71     AC B4Z5V7.1
#=GS C1KTA3_HBV/31-210    AC C1KTA3.1
#=GS Q2L572_HBV/2-23      AC Q2L572.1
#=GS Q86846_HBV/31-212    AC Q86846.1
#=GS Q1MSM1_HBV/31-173    AC Q1MSM1.1
#=GS Q2L583_HBV/2-20      AC Q2L583.1
#=GS B7TUR7_HBV/2-183     AC B7TUR7.1
#=GS C7AYS2_HBV/31-214    AC C7AYS2.1
#=GS D3J5P7_HBV/31-57     AC D3J5P7.1
#=GS G3E5H6_HBV/31-212    AC G3E5H6.1
#=GS B2WSS9_HBV/2-183     AC B2WSS9.1
#=GS B4Z4J6_HBV/31-70     AC B4Z4J6.1
#=GS B4Z1F4_HBV/31-69     AC B4Z1F4.1
#=GS A1KR31_HBV/2-25      AC A1KR31.1
#=GS B4Z320_HBV/31-66     AC B4Z320.1
#=GS B4Z416_HBV/2-39      AC B4Z416.1
#=GS D5LEY9_HBV/2-183     AC D5LEY9.1
#=GS D8VC13_HBV/2-48      AC D8VC13.1
#=GS D8VBK9_HBV/31-80     AC D8VBK9.1
#=GS Q6R7M5_HBV/14-151    AC Q6R7M5.1
#=GS B6D6F6_HBV/2-64      AC B6D6F6.1
#=GS B9VK73_HBV/2-183     AC B9VK73.1
#=GS Q9WJC2_HBV/31-212    AC Q9WJC2.1
#=GS Q4FDG0_HBV/31-212    AC Q4FDG0.1
#=GS D3J5S2_HBV/31-57     AC D3J5S2.1
#=GS B4X6J9_HBV/31-87     AC B4X6J9.1
#=GS C1KTB9_HBV/31-210    AC C1KTB9.1
#=GS D9U5F8_HBV/31-212    AC D9U5F8.1
#=GS A4ZRE5_HBV/31-163    AC A4ZRE5.1
#=GS C4P1K7_HBV/31-76     AC C4P1K7.1
#=GS Q09KS0_HBV/2-20      AC Q09KS0.1
#=GS B4Z2X0_HBV/2-41      AC B4Z2X0.1
#=GS D4I4U1_HBV/2-185     AC D4I4U1.1
#=GS Q6I6T0_HBV/31-71     AC Q6I6T0.1
#=GS D8VC01_HBV/31-80     AC D8VC01.1
#=GS C7DY92_HBV/31-212    AC C7DY92.1
#=GS C1KT94_HBV/31-210    AC C1KT94.1
#=GS H2ERA8_HBV/31-212    AC H2ERA8.1
#=GS D3J6G5_HBV/31-70     AC D3J6G5.1
#=GS Q8VBI7_HBV/2-183     AC Q8VBI7.1
#=GS B4Z4P5_HBV/31-70     AC B4Z4P5.1
#=GS D8VBW3_HBV/2-36      AC D8VBW3.1
#=GS H6UGR5_HBV/2-183     AC H6UGR5.1
#=GS B4Z2A0_HBV/31-66     AC B4Z2A0.1
#=GS C1KTB4_HBV/31-212    AC C1KTB4.1
#=GS G1E7W1_HBV/31-212    AC G1E7W1.1
#=GS B1ABP8_HBV/31-212    AC B1ABP8.1
#=GS Q9E0U1_HBV/2-123     AC Q9E0U1.1
#=GS C7AY27_HBV/31-214    AC C7AY27.1
#=GS C4P108_HBV/31-76     AC C4P108.1
#=GS B3VAL8_HBV/2-183     AC B3VAL8.1
#=GS D2U5Z6_HBV/2-183     AC D2U5Z6.1
#=GS D3TJA3_HBV/2-81      AC D3TJA3.1
#=GS D3J5Z9_HBV/31-79     AC D3J5Z9.1
#=GS D3YGB2_HBV/2-183     AC D3YGB2.1
#=GS Q6X5G6_HBV/1-122     AC Q6X5G6.1
#=GS D4I4T1_HBV/2-185     AC D4I4T1.1
#=GS Q2L4L6_HBV/2-183     AC Q2L4L6.1
#=GS E0ZNI6_HBV/2-153     AC E0ZNI6.1
#=GS Q8JXB2_HBV/31-212    AC Q8JXB2.1
#=GS Q09KS8_HBV/2-20      AC Q09KS8.1
#=GS B6CIU8_HBV/31-212    AC B6CIU8.1
#=GS B4Z383_HBV/31-66     AC B4Z383.1
#=GS C7AYZ1_HBV/31-214    AC C7AYZ1.1
#=GS D8VBE3_HBV/31-80     AC D8VBE3.1
#=GS C4P176_HBV/31-76     AC C4P176.1
#=GS D8VBA4_HBV/2-51      AC D8VBA4.1
#=GS E0ZRS8_HBV/2-183     AC E0ZRS8.1
#=GS C1KT96_HBV/31-210    AC C1KT96.1
#=GS E5RPL4_HBV/31-212    AC E5RPL4.1
#=GS B4X6L2_HBV/31-88     AC B4X6L2.1
#=GS HBEAG_WMHBV/31-211   AC P0C6J0.1
#=GS C4P180_HBV/31-76     AC C4P180.1
#=GS B5TXZ3_HBV/31-212    AC B5TXZ3.1
#=GS G3E543_HBV/31-212    AC G3E543.1
#=GS Q6I6R4_HBV/31-71     AC Q6I6R4.1
#=GS B4Z1H7_HBV/2-42      AC B4Z1H7.1
#=GS Q9YJW4_HBV/31-212    AC Q9YJW4.1
#=GS Q9YZT7_HBV/31-212    AC Q9YZT7.1
#=GS G1C8B9_HBV/2-57      AC G1C8B9.1
#=GS H6V5M7_HBV/2-183     AC H6V5M7.1
#=GS D6QW24_HBV/2-183     AC D6QW24.1
#=GS B3V8U7_HBV/31-212    AC B3V8U7.1
#=GS B4Z327_HBV/2-37      AC B4Z327.1
#=GS E0ZP12_HBV/2-110     AC E0ZP12.1
#=GS B5M5K3_HBV/31-212    AC B5M5K3.1
#=GS D8VBU2_HBV/2-48      AC D8VBU2.1
#=GS B4Z1R0_HBV/2-42      AC B4Z1R0.1
#=GS H9N886_HBV/2-183     AC H9N886.1
#=GS Q68RN7_HBV/31-212    AC Q68RN7.1
#=GS C4P154_HBV/31-76     AC C4P154.1
#=GS Q91SY4_HBV/31-212    AC Q91SY4.1
#=GS D5LDY5_HBV/2-183     AC D5LDY5.1
#=GS D8VC26_HBV/31-208    AC D8VC26.1
#=GS E0ZRS1_HBV/31-212    AC E0ZRS1.1
#=GS B4Z335_HBV/31-66     AC B4Z335.1
#=GS D6QVW1_HBV/31-212    AC D6QVW1.1
#=GS B9VL40_HBV/2-183     AC B9VL40.1
#=GS D6P5B9_HBV/2-183     AC D6P5B9.1
#=GS C1KTA9_HBV/31-212    AC C1KTA9.1
#=GS A4ZRE7_HBV/2-134     AC A4ZRE7.1
#=GS B0B355_HBV/2-183     AC B0B355.1
#=GS D8VC81_HBV/2-37      AC D8VC81.1
#=GS F5C1C9_HBV/43-224    AC F5C1C9.1
#=GS B3VAN6_HBV/2-183     AC B3VAN6.1
#=GS C9W215_HBV/2-183     AC C9W215.1
#=GS Q67904_HBV/2-164     AC Q67904.1
#=GS C4P157_HBV/31-76     AC C4P157.1
#=GS G1EIF1_HBV/2-183     AC G1EIF1.1
#=GS B4Z2Q1_HBV/2-41      AC B4Z2Q1.1
#=GS C7DSL6_HBV/2-183     AC C7DSL6.1
#=GS D0E6D1_HBV/31-212    AC D0E6D1.1
#=GS B7TTK0_HBV/2-183     AC B7TTK0.1
#=GS H6V5L5_HBV/2-183     AC H6V5L5.1
#=GS D3J625_HBV/31-88     AC D3J625.1
#=GS B4YTC1_HBV/31-212    AC B4YTC1.1
#=GS G1C8V6_HBV/2-183     AC G1C8V6.1
#=GS E0ZRR0_HBV/2-183     AC E0ZRR0.1
#=GS E0ZNH8_HBV/2-153     AC E0ZNH8.1
#=GS B4Z3S8_HBV/2-39      AC B4Z3S8.1
#=GS D8V9U7_HBV/29-130    AC D8V9U7.1
#=GS H6UGF3_HBV/2-183     AC H6UGF3.1
#=GS B4Z648_HBV/31-70     AC B4Z648.1
#=GS B4Z3L1_HBV/31-68     AC B4Z3L1.1
#=GS H6V8A5_HBV/31-56     AC H6V8A5.1
#=GS E0ZNX3_HBV/2-110     AC E0ZNX3.1
#=GS I0DG57_HBV/31-212    AC I0DG57.1
#=GS B4X6K1_HBV/31-87     AC B4X6K1.1
#=GS C4P1R5_HBV/31-76     AC C4P1R5.1
#=GS Q7TED3_HBV/31-163    AC Q7TED3.1
#=GS C6F4K2_HBV/31-214    AC C6F4K2.1
#=GS D3J623_HBV/31-88     AC D3J623.1
#=GS I0DG33_HBV/31-212    AC I0DG33.1
#=GS Q2L597_HBV/2-20      AC Q2L597.1
#=GS D5LCW2_HBV/31-212    AC D5LCW2.1
#=GS B7TUU2_HBV/31-212    AC B7TUU2.1
#=GS Q9E0N4_HBV/2-123     AC Q9E0N4.1
#=GS B4Z368_HBV/31-66     AC B4Z368.1
#=GS B4Z2Q7_HBV/2-41      AC B4Z2Q7.1
#=GS Q404F1_HBV/2-183     AC Q404F1.1
#=GS C1K1I9_HBV/31-212    AC C1K1I9.1
#=GS Q2L5G3_HBV/2-24      AC Q2L5G3.1
#=GS Q8QMF0_HBV/2-139     AC Q8QMF0.1
#=GS D0EEG4_HBV/2-185     AC D0EEG4.1
#=GS C0LKM1_HBV/2-183     AC C0LKM1.1
#=GS Q9J3T6_HBV/1-65      AC Q9J3T6.1
#=GS Q4FDF2_HBV/31-212    AC Q4FDF2.1
#=GS B4Z3I4_HBV/31-68     AC B4Z3I4.1
#=GS D3J650_HBV/31-88     AC D3J650.1
#=GS Q8VBG7_HBV/2-183     AC Q8VBG7.1
#=GS D5LCC7_HBV/2-183     AC D5LCC7.1
#=GS B4Z4I1_HBV/31-70     AC B4Z4I1.1
#=GS D3J5Y1_HBV/31-88     AC D3J5Y1.1
#=GS E5KUG2_9HEPA/2-262   AC E5KUG2.1
#=GS B4Z374_HBV/31-66     AC B4Z374.1
#=GS B6ULK4_HBV/31-212    AC B6ULK4.1
#=GS C1KT89_HBV/31-210    AC C1KT89.1
#=GS B4Z353_HBV/31-66     AC B4Z353.1
#=GS Q1JUS7_HBV/31-117    AC Q1JUS7.1
#=GS C7DMJ8_HBV/2-183     AC C7DMJ8.1
#=GS G0Z311_HBV/2-121     AC G0Z311.1
#=GS B4Z617_HBV/31-70     AC B4Z617.1
#=GS C4P1C5_HBV/31-76     AC C4P1C5.1
#=GS G0Z2W2_HBV/2-121     AC G0Z2W2.1
#=GS B4Z418_HBV/31-68     AC B4Z418.1
#=GS Q6XGK7_HBV/2-185     AC Q6XGK7.1
#=GS B7TTS9_HBV/2-183     AC B7TTS9.1
#=GS B4ZYU8_HBV/2-183     AC B4ZYU8.1
#=GS B3VB94_HBV/2-183     AC B3VB94.1
#=GS B4Z1S2_HBV/31-79     AC B4Z1S2.1
#=GS Q1MSW0_HBV/31-173    AC Q1MSW0.1
#=GS B4Z3M6_HBV/31-68     AC B4Z3M6.1
#=GS B9VJZ2_HBV/2-183     AC B9VJZ2.1
#=GS B0B2K9_HBV/31-212    AC B0B2K9.1
#=GS H1ACV5_HBV/2-183     AC H1ACV5.1
#=GS Q45F35_HBV/2-183     AC Q45F35.1
#=GS E0ZP54_HBV/2-110     AC E0ZP54.1
#=GS B4Z3V6_HBV/31-68     AC B4Z3V6.1
#=GS G1C8X0_HBV/2-183     AC G1C8X0.1
#=GS C1KTC0_HBV/31-212    AC C1KTC0.1
#=GS B4X6M8_HBV/31-86     AC B4X6M8.1
#=GS C7AYE7_HBV/31-214    AC C7AYE7.1
#=GS Q68RM8_HBV/2-183     AC Q68RM8.1
#=GS D8VCA1_HBV/2-41      AC D8VCA1.1
#=GS Q1XHF9_HBV/2-183     AC Q1XHF9.1
#=GS B2MUD8_HBV/31-186    AC B2MUD8.1
#=GS C4P1B1_HBV/31-76     AC C4P1B1.1
#=GS Q9WRK6_HBV/31-214    AC Q9WRK6.1
#=GS B4Z419_HBV/2-39      AC B4Z419.1
#=GS C4P1S2_HBV/31-71     AC C4P1S2.1
#=GS D3TK30_HBV/2-183     AC D3TK30.1
#=GS B4X6J0_HBV/31-87     AC B4X6J0.1
#=GS Q80J55_HBV/2-181     AC Q80J55.1
#=GS Q9WIK5_HBV/31-212    AC Q9WIK5.1
#=GS Q67976_HBV/2-183     AC Q67976.1
#=GS D6QVS8_HBV/2-183     AC D6QVS8.1
#=GS C4P1N9_HBV/31-76     AC C4P1N9.1
#=GS B4Z235_HBV/2-41      AC B4Z235.1
#=GS B4Z688_HBV/2-41      AC B4Z688.1
#=GS HBEAG_DHBVQ/45-305   AC Q89860.1
#=GS B1ABK2_HBV/31-212    AC B1ABK2.1
#=GS B9VKD2_HBV/2-183     AC B9VKD2.1
#=GS D7NL54_HBV/2-183     AC D7NL54.1
#=GS Q2L5G7_HBV/2-24      AC Q2L5G7.1
#=GS D6QVL4_HBV/2-183     AC D6QVL4.1
#=GS B5ATF8_HBV/106-183   AC B5ATF8.1
#=GS B4Z1W4_HBV/2-41      AC B4Z1W4.1
#=GS B4Z5V1_HBV/31-70     AC B4Z5V1.1
#=GS F4MJJ6_HBV/31-81     AC F4MJJ6.1
#=GS A9PLC9_HBV/1-39      AC A9PLC9.1
#=GS B5U708_HBV/31-212    AC B5U708.1
#=GS Q8QSB5_HBV/31-212    AC Q8QSB5.1
#=GS B4Z350_HBV/31-66     AC B4Z350.1
#=GS B4Z393_HBV/2-37      AC B4Z393.1
#=GS B6D679_HBV/31-80     AC B6D679.1
#=GS D8VBR3_HBV/31-80     AC D8VBR3.1
#=GS B0B353_HBV/2-183     AC B0B353.1
#=GS Q6X5F7_HBV/27-208    AC Q6X5F7.1
#=GS B5TXW5_HBV/31-212    AC B5TXW5.1
#=GS D0EDV4_HBV/2-183     AC D0EDV4.1
#=GS B9VKN1_HBV/2-183     AC B9VKN1.1
#=GS Q91A49_HBV/31-66     AC Q91A49.1
#=GS A9PLI6_HBV/1-44      AC A9PLI6.1
#=GS B6D6D1_HBV/31-96     AC B6D6D1.1
#=GS D5LCC6_HBV/31-212    AC D5LCC6.1
#=GS B4Z4L0_HBV/2-40      AC B4Z4L0.1
#=GS D3J5S6_HBV/31-57     AC D3J5S6.1
#=GS A6H2M3_HBV/31-212    AC A6H2M3.1
#=GS Q8JSX4_HBV/1-130     AC Q8JSX4.1
#=GS B4X6L3_HBV/31-87     AC B4X6L3.1
#=GS H6UGH2_HBV/2-183     AC H6UGH2.1
#=GS G1C8Y3_HBV/31-212    AC G1C8Y3.1
#=GS C7DN60_HBV/2-183     AC C7DN60.1
#=GS C3V8M4_HBV/83-156    AC C3V8M4.1
#=GS D3J644_HBV/31-88     AC D3J644.1
#=GS H6V8A3_HBV/31-56     AC H6V8A3.1
#=GS D0EE99_HBV/2-185     AC D0EE99.1
#=GS D8VCE4_HBV/2-35      AC D8VCE4.1
#=GS D8VBV1_HBV/2-36      AC D8VBV1.1
#=GS D2U632_HBV/2-183     AC D2U632.1
#=GS G1E848_HBV/2-183     AC G1E848.1
#=GS B0FCJ6_HBV/31-212    AC B0FCJ6.1
#=GS Q8QP25_HBV/1-130     AC Q8QP25.1
#=GS A9PLG6_HBV/1-39      AC A9PLG6.1
#=GS D0EE78_HBV/2-185     AC D0EE78.1
#=GS C4P1U5_HBV/31-76     AC C4P1U5.1
#=GS E0ZNY3_HBV/2-110     AC E0ZNY3.1
#=GS Q6UBK3_HBV/31-214    AC Q6UBK3.1
#=GS Q4FDL1_HBV/31-212    AC Q4FDL1.1
#=GS A9PLH6_HBV/1-39      AC A9PLH6.1
#=GS C4P1L9_HBV/31-76     AC C4P1L9.1
#=GS B4Z1I0_HBV/2-42      AC B4Z1I0.1
#=GS H9BMQ7_HBV/25-191    AC H9BMQ7.1
#=GS H6UND9_HBV/2-185     AC H6UND9.1
#=GS B5BPS2_HBV/31-212    AC B5BPS2.1
#=GS Q6I6R8_HBV/31-71     AC Q6I6R8.1
#=GS A9PLG9_HBV/1-39      AC A9PLG9.1
#=GS C4P1M0_HBV/31-76     AC C4P1M0.1
#=GS Q2L5C2_HBV/2-20      AC Q2L5C2.1
#=GS Q8QP36_HBV/1-132     AC Q8QP36.1
#=GS D3J6G9_HBV/31-70     AC D3J6G9.1
#=GS F5C055_HBV/31-53     AC F5C055.1
#=GS Q2EID6_HBV/31-212    AC Q2EID6.1
#=GS Q8JSV4_HBV/1-130     AC Q8JSV4.1
#=GS Q77BG5_HBV/1-96      AC Q77BG5.1
#=GS C7DY86_HBV/31-212    AC C7DY86.1
#=GS Q6UE58_HBV/2-183     AC Q6UE58.1
#=GS Q60H30_HBV/31-71     AC Q60H30.1
#=GS HBEAG_WHV1/32-218    AC P0C6J2.1
#=GS Q6I6S6_HBV/31-71     AC Q6I6S6.1
#=GS E5RDB6_HBV/31-212    AC E5RDB6.1
#=GS D6P5A6_HBV/31-212    AC D6P5A6.1
#=GS B9VKX1_HBV/2-183     AC B9VKX1.1
#=GS D0EEE5_HBV/2-185     AC D0EEE5.1
#=GS E0ZRX3_HBV/31-212    AC E0ZRX3.1
#=GS G1E8L1_HBV/2-183     AC G1E8L1.1
#=GS H6UG62_HBV/2-183     AC H6UG62.1
#=GS Q1MSR8_HBV/31-173    AC Q1MSR8.1
#=GS G1E8B2_HBV/2-183     AC G1E8B2.1
#=GS H1ACX5_HBV/2-183     AC H1ACX5.1
#=GS D2JMU8_HBV/2-183     AC D2JMU8.1
#=GS C4P1S9_HBV/31-76     AC C4P1S9.1
#=GS Q0PMM4_HBV/31-214    AC Q0PMM4.1
#=GS Q00K97_HBV/2-183     AC Q00K97.1
#=GS B4Z606_HBV/31-70     AC B4Z606.1
#=GS B2WSQ0_HBV/31-212    AC B2WSQ0.1
#=GS B3VB03_HBV/2-183     AC B3VB03.1
#=GS B1ABK9_HBV/31-172    AC B1ABK9.1
#=GS I0DG71_HBV/31-212    AC I0DG71.1
#=GS D8VC44_HBV/2-51      AC D8VC44.1
#=GS B4Z4M8_HBV/2-41      AC B4Z4M8.1
#=GS Q6XGI0_HBV/31-212    AC Q6XGI0.1
#=GS C0LKM5_HBV/2-183     AC C0LKM5.1
#=GS B4Z1Y0_HBV/2-41      AC B4Z1Y0.1
#=GS H6UG75_HBV/2-183     AC H6UG75.1
#=GS D4I4S9_HBV/2-185     AC D4I4S9.1
#=GS Q8B4G0_HBV/31-214    AC Q8B4G0.1
#=GS A7L355_HBV/2-161     AC A7L355.1
#=GS I0DG85_HBV/31-212    AC I0DG85.1
#=GS D3TJ91_HBV/2-183     AC D3TJ91.1
#=GS Q76MV5_HBV/2-183     AC Q76MV5.1
#=GS D5LD77_HBV/31-212    AC D5LD77.1
#=GS Q2L5E5_HBV/2-24      AC Q2L5E5.1
#=GS B4Z5U2_HBV/2-42      AC B4Z5U2.1
#=GS D8VBK6_HBV/31-80     AC D8VBK6.1
#=GS C1K1T8_HBV/2-183     AC C1K1T8.1
#=GS B4Z4W8_HBV/2-41      AC B4Z4W8.1
#=GS B7TUN4_HBV/31-212    AC B7TUN4.1
#=GS Q8QXR0_HBV/2-185     AC Q8QXR0.1
#=GS G0Z2V6_HBV/2-121     AC G0Z2V6.1
#=GS A9PLF7_HBV/1-39      AC A9PLF7.1
#=GS D8VBK1_HBV/31-80     AC D8VBK1.1
#=GS H9BMV3_HBV/2-168     AC H9BMV3.1
#=GS D2JMP9_HBV/31-212    AC D2JMP9.1
#=GS D2JMF9_HBV/2-183     AC D2JMF9.1
#=GS E5D5N7_HBV/1-176     AC E5D5N7.1
#=GS D3J6E5_HBV/31-70     AC D3J6E5.1
#=GS B4Z1I9_HBV/2-42      AC B4Z1I9.1
#=GS B5M5B3_HBV/31-212    AC B5M5B3.1
#=GS C4T8V6_HBV/2-183     AC C4T8V6.1
#=GS D3TKA1_HBV/31-212    AC D3TKA1.1
#=GS A9PLG5_HBV/1-39      AC A9PLG5.1
#=GS D8VC99_HBV/2-36      AC D8VC99.1
#=GS D8VBW8_HBV/31-80     AC D8VBW8.1
#=GS B4Z276_HBV/31-66     AC B4Z276.1
#=GS B4Z2Y2_HBV/2-37      AC B4Z2Y2.1
#=GS C6F512_HBV/31-214    AC C6F512.1
#=GS B4Z1F1_HBV/31-69     AC B4Z1F1.1
#=GS Q9QB13_HBV/2-183     AC Q9QB13.1
#=GS B6D6C9_HBV/31-142    AC B6D6C9.1
#=GS B6D6G6_HBV/31-80     AC B6D6G6.1
#=GS B4X6J1_HBV/31-87     AC B4X6J1.1
#=GS B3VB76_HBV/2-183     AC B3VB76.1
#=GS D3YG20_HBV/2-183     AC D3YG20.1
#=GS B3VAQ9_HBV/2-183     AC B3VAQ9.1
#=GS D9U5B1_HBV/82-146    AC D9U5B1.1
#=GS Q404G7_HBV/2-183     AC Q404G7.1
#=GS D8VBL3_HBV/2-51      AC D8VBL3.1
#=GS D8VCC3_HBV/2-51      AC D8VCC3.1
#=GS Q80JA6_HBV/2-183     AC Q80JA6.1
#=GS Q9QMN0_HBV/2-183     AC Q9QMN0.1
#=GS G9G8K4_HBV/2-183     AC G9G8K4.1
#=GS C1KTB5_HBV/31-212    AC C1KTB5.1
#=GS B8PTH1_HBV/31-212    AC B8PTH1.1
#=GS HBEAG_HBVB4/31-212   AC P0C6G9.1
#=GS C1K1K8_HBV/2-181     AC C1K1K8.1
#=GS C3W4C3_HBV/2-183     AC C3W4C3.1
#=GS Q8VBG3_HBV/2-185     AC Q8VBG3.1
#=GS B9VKC9_HBV/2-183     AC B9VKC9.1
#=GS B4Z317_HBV/31-66     AC B4Z317.1
#=GS Q6RSE9_9HEPA/45-305  AC Q6RSE9.1
#=GS Q7TF65_HBV/31-212    AC Q7TF65.1
#=GS E0ZP26_HBV/2-110     AC E0ZP26.1
#=GS D2JMM2_HBV/2-183     AC D2JMM2.1
#=GS B4Z389_HBV/31-66     AC B4Z389.1
#=GS C4P1H3_HBV/31-76     AC C4P1H3.1
#=GS B7TTZ8_HBV/2-183     AC B7TTZ8.1
#=GS D6P5C0_HBV/31-214    AC D6P5C0.1
#=GS B5M5F5_HBV/31-212    AC B5M5F5.1
#=GS Q1JUS7_HBV/112-178   AC Q1JUS7.1
#=GS A7YEW0_HBV/31-212    AC A7YEW0.1
#=GS B7TUY9_HBV/2-183     AC B7TUY9.1
#=GS B4Z3B1_HBV/2-37      AC B4Z3B1.1
#=GS G1C8N7_HBV/2-183     AC G1C8N7.1
#=GS D3J605_HBV/31-56     AC D3J605.1
#=GS C9WDK5_HBV/31-212    AC C9WDK5.1
#=GS G1E7N9_HBV/2-183     AC G1E7N9.1
#=GS C0LKB1_HBV/2-183     AC C0LKB1.1
#=GS G1C8G1_HBV/2-183     AC G1C8G1.1
#=GS B4Z226_HBV/2-41      AC B4Z226.1
#=GS C3W3S3_HBV/2-183     AC C3W3S3.1
#=GS C4P1U1_HBV/31-76     AC C4P1U1.1
#=GS Q91SZ1_HBV/31-212    AC Q91SZ1.1
#=GS E9L5E7_HBV/31-212    AC E9L5E7.1
#=GS C1K1B8_HBV/2-61      AC C1K1B8.1
#=GS D3J5U4_HBV/31-88     AC D3J5U4.1
#=GS Q80H01_HBV/31-212    AC Q80H01.1
#=GS Q1MSP2_HBV/31-173    AC Q1MSP2.1
#=GS B4Z396_HBV/2-37      AC B4Z396.1
#=GS D6P591_HBV/31-212    AC D6P591.1
#=GS Q81151_HBV/2-82      AC Q81151.1
#=GS C7DMU4_HBV/31-212    AC C7DMU4.1
#=GS E0ZNW3_HBV/2-20      AC E0ZNW3.1
#=GS B4Z1Z7_HBV/31-70     AC B4Z1Z7.1
#=GS G0YVN4_HBV/2-183     AC G0YVN4.1
#=GS A9CM52_HBV/2-183     AC A9CM52.1
#=GS B4Z3F4_HBV/2-42      AC B4Z3F4.1
#=GS D3J691_HBV/31-70     AC D3J691.1
#=GS Q7TDQ5_HBV/2-183     AC Q7TDQ5.1
#=GS Q9WP65_HBV/31-204    AC Q9WP65.1
#=GS Q91A86_HBV/31-66     AC Q91A86.1
#=GS C7AYU0_HBV/2-185     AC C7AYU0.1
#=GS D0EE85_HBV/2-185     AC D0EE85.1
#=GS CAPSD_GSHV/2-187     AC P0C6J1.1
#=GS B4Z2Z2_HBV/31-66     AC B4Z2Z2.1
#=GS B4Z1S0_HBV/2-50      AC B4Z1S0.1
#=GS D0UE34_HBV/2-183     AC D0UE34.1
#=GS F5C048_HBV/31-53     AC F5C048.1
#=GS CAPSD_HBVF1/2-183    AC P0C6I4.1
#=GS C6F5D0_HBV/31-214    AC C6F5D0.1
#=GS A8D6S6_HBV/31-212    AC A8D6S6.1
#=GS A9PLH2_HBV/1-39      AC A9PLH2.1
#=GS B4Z404_HBV/2-39      AC B4Z404.1
#=GS B4Z243_HBV/2-41      AC B4Z243.1
#=GS D0EYW2_HBV/2-157     AC D0EYW2.1
#=GS H9BMU3_HBV/2-168     AC H9BMU3.1
#=GS E3Q0K6_HBV/2-183     AC E3Q0K6.1
#=GS B0FCH7_HBV/31-212    AC B0FCH7.1
#=GS B5BPP0_HBV/31-212    AC B5BPP0.1
#=GS C9W1X7_HBV/31-212    AC C9W1X7.1
#=GS B4Z390_HBV/2-37      AC B4Z390.1
#=GS C7DSM4_HBV/2-183     AC C7DSM4.1
#=GS B5M5B7_HBV/31-212    AC B5M5B7.1
#=GS Q80J75_HBV/31-210    AC Q80J75.1
#=GS F4MJD6_HBV/31-81     AC F4MJD6.1
#=GS Q8VBH7_HBV/2-183     AC Q8VBH7.1
#=GS C4P0Y4_HBV/31-76     AC C4P0Y4.1
#=GS Q60GZ7_HBV/31-71     AC Q60GZ7.1
#=GS C1JYZ9_HBV/2-183     AC C1JYZ9.1
#=GS Q8QP33_HBV/1-130     AC Q8QP33.1
#=GS D3J6F5_HBV/31-70     AC D3J6F5.1
#=GS Q60H01_HBV/31-71     AC Q60H01.1
#=GS C4P0Z9_HBV/31-76     AC C4P0Z9.1
#=GS C4P1Q1_HBV/31-76     AC C4P1Q1.1
#=GS Q2EGF2_HBV/31-99     AC Q2EGF2.1
#=GS Q2L5D2_HBV/2-20      AC Q2L5D2.1
#=GS CAPSD_HPBDC/2-262    AC P0C6K1.1
#=GS Q0PML4_HBV/31-106    AC Q0PML4.1
#=GS G9G9L4_HBV/2-183     AC G9G9L4.1
#=GS B5ASV2_HBV/2-183     AC B5ASV2.1
#=GS B4X6H7_HBV/31-87     AC B4X6H7.1
#=GS B4Z2S8_HBV/31-70     AC B4Z2S8.1
#=GS B9VKK6_HBV/2-183     AC B9VKK6.1
#=GS D8VBG2_HBV/2-24      AC D8VBG2.1
#=GS B4Z5Y2_HBV/31-71     AC B4Z5Y2.1
#=GS B4Z3V1_HBV/2-39      AC B4Z3V1.1
#=GS B4Z682_HBV/2-41      AC B4Z682.1
#=GS Q77BH3_HBV/1-96      AC Q77BH3.1
#=GS Q60H18_HBV/31-71     AC Q60H18.1
#=GS Q8QSB4_HBV/31-212    AC Q8QSB4.1
#=GS H9BMU0_HBV/2-121     AC H9BMU0.1
#=GS Q6UE48_HBV/2-183     AC Q6UE48.1
#=GS E0ZRB2_HBV/2-183     AC E0ZRB2.1
#=GS Q8JN02_HBV/31-212    AC Q8JN02.1
#=GS B7TUI8_HBV/2-183     AC B7TUI8.1
#=GS E0ZRX4_HBV/2-183     AC E0ZRX4.1
#=GS C4P148_HBV/31-76     AC C4P148.1
#=GS G9G8X6_HBV/2-50      AC G9G8X6.1
#=GS B3V8U8_HBV/2-183     AC B3V8U8.1
#=GS B7TU44_HBV/2-183     AC B7TU44.1
#=GS C4P1U3_HBV/31-76     AC C4P1U3.1
#=GS E0ZNV1_HBV/2-110     AC E0ZNV1.1
#=GS Q8VBJ3_HBV/2-185     AC Q8VBJ3.1
#=GS C7AYZ7_HBV/31-214    AC C7AYZ7.1
#=GS Q60GY5_HBV/31-71     AC Q60GY5.1
#=GS B3VB78_HBV/2-183     AC B3VB78.1
#=GS C4P168_HBV/31-76     AC C4P168.1
#=GS B6ULI1_HBV/31-95     AC B6ULI1.1
#=GS E0ZRY6_HBV/2-183     AC E0ZRY6.1
#=GS B4Z1Y5_HBV/31-70     AC B4Z1Y5.1
#=GS B4Z3N6_HBV/2-39      AC B4Z3N6.1
#=GS Q91A53_HBV/31-66     AC Q91A53.1
#=GS Q09L03_HBV/2-20      AC Q09L03.1
#=GS B4Z2K5_HBV/31-70     AC B4Z2K5.1
#=GS B4Z1V3_HBV/2-41      AC B4Z1V3.1
#=GS D0EYV8_HBV/2-157     AC D0EYV8.1
#=GS D3J5Y4_HBV/31-88     AC D3J5Y4.1
#=GS C4P104_HBV/31-76     AC C4P104.1
#=GS G1E7K9_HBV/2-183     AC G1E7K9.1
#=GS Q6TYG1_HBV/31-182    AC Q6TYG1.1
#=GS A6YJZ4_HBV/2-181     AC A6YJZ4.1
#=GS Q4FDI7_HBV/31-212    AC Q4FDI7.1
#=GS C4P0Y9_HBV/31-76     AC C4P0Y9.1
#=GS B6D682_HBV/31-142    AC B6D682.1
#=GS Q5G3J2_HBV/31-54     AC Q5G3J2.1
#=GS D8VCI5_HBV/2-51      AC D8VCI5.1
#=GS Q2EIE4_HBV/31-212    AC Q2EIE4.1
#=GS B4Z1Q6_HBV/31-71     AC B4Z1Q6.1
#=GS D3YGC4_HBV/2-183     AC D3YGC4.1
#=GS G9G9V5_HBV/31-212    AC G9G9V5.1
#=GS Q6J324_HBV/31-214    AC Q6J324.1
#=GS Q5G3G4_HBV/2-25      AC Q5G3G4.1
#=GS E0ZNC9_HBV/31-182    AC E0ZNC9.1
#=GS G1C8P3_HBV/2-183     AC G1C8P3.1
#=GS G1E819_HBV/31-81     AC G1E819.1
#=GS Q69597_HBV/2-183     AC Q69597.1
#=GS E0ZNY7_HBV/2-110     AC E0ZNY7.1
#=GS B4Z1W7_HBV/31-70     AC B4Z1W7.1
#=GS D8VC02_HBV/2-51      AC D8VC02.1
#=GS B4Z3R8_HBV/31-68     AC B4Z3R8.1
#=GS C7AYL0_HBV/2-186     AC C7AYL0.1
#=GS CAPSD_HBVA8/2-185    AC P0C697.1
#=GS H9BMS9_HBV/2-160     AC H9BMS9.1
#=GS Q2MLQ9_HBV/2-183     AC Q2MLQ9.1
#=GS D3J6A9_HBV/31-70     AC D3J6A9.1
#=GS B4Z401_HBV/2-39      AC B4Z401.1
#=GS D4I4T7_HBV/2-185     AC D4I4T7.1
#=GS B4X6L4_HBV/31-87     AC B4X6L4.1
#=GS B2Y6I9_HBV/2-185     AC B2Y6I9.1
#=GS C4P1K2_HBV/31-76     AC C4P1K2.1
#=GS Q91T03_HBV/31-212    AC Q91T03.1
#=GS C4P132_HBV/31-76     AC C4P132.1
#=GS B5BUT9_HBV/31-214    AC B5BUT9.1
#=GS B4Z5V9_HBV/2-42      AC B4Z5V9.1
#=GS B9VK54_HBV/2-183     AC B9VK54.1
#=GS B4YL23_HBV/2-183     AC B4YL23.1
#=GS Q9E0Q9_HBV/2-123     AC Q9E0Q9.1
#=GS D6P5A0_HBV/2-183     AC D6P5A0.1
#=GS B4Z3W5_HBV/31-68     AC B4Z3W5.1
#=GS D4I4R0_HBV/2-183     AC D4I4R0.1
#=GS D8VBB1_HBV/31-159    AC D8VBB1.1
#=GS Q2L586_HBV/2-20      AC Q2L586.1
#=GS Q80JB2_HBV/31-210    AC Q80JB2.1
#=GS B6ULG4_HBV/31-210    AC B6ULG4.1
#=GS Q991K1_HBV/105-183   AC Q991K1.1
#=GS G9G8Y2_HBV/31-68     AC G9G8Y2.1
#=GS B2LWA1_HBV/31-212    AC B2LWA1.1
#=GS D3TKE9_HBV/2-183     AC D3TKE9.1
#=GS D3TK55_HBV/2-183     AC D3TK55.1
#=GS B5B483_HBV/31-212    AC B5B483.1
#=GS G8Z915_HBV/2-139     AC G8Z915.1
#=GS Q8QMM5_HBV/31-212    AC Q8QMM5.1
#=GS C1K235_HBV/2-183     AC C1K235.1
#=GS B7TUQ4_HBV/2-183     AC B7TUQ4.1
#=GS G0Z2Y9_HBV/2-121     AC G0Z2Y9.1
#=GS A1KR48_HBV/2-25      AC A1KR48.1
#=GS B7TUA0_HBV/31-212    AC B7TUA0.1
#=GS C7DQR7_HBV/31-214    AC C7DQR7.1
#=GS C7AYN0_HBV/2-185     AC C7AYN0.1
#=GS D8VCE6_HBV/31-66     AC D8VCE6.1
#=GS B4Z2H7_HBV/31-66     AC B4Z2H7.1
#=GS G1EIH1_HBV/2-153     AC G1EIH1.1
#=GS Q5UFS8_HBV/2-183     AC Q5UFS8.1
#=GS G3E5I4_HBV/2-183     AC G3E5I4.1
#=GS C4P1V3_HBV/31-76     AC C4P1V3.1
#=GS E0ZRV7_HBV/2-183     AC E0ZRV7.1
#=GS A9PLC7_HBV/1-39      AC A9PLC7.1
#=GS C4P1Q8_HBV/31-76     AC C4P1Q8.1
#=GS C3W3Q5_HBV/2-183     AC C3W3Q5.1
#=GS Q2PJM9_HBV/33-94     AC Q2PJM9.1
#=GS Q67968_HBV/2-184     AC Q67968.1
#=GS E0ZRF9_HBV/2-183     AC E0ZRF9.1
#=GS H9BMS6_HBV/23-181    AC H9BMS6.1
#=GS C0LK95_HBV/2-183     AC C0LK95.1
#=GS Q91SY5_HBV/31-212    AC Q91SY5.1
#=GS B4Z410_HBV/2-39      AC B4Z410.1
#=GS A9PLG0_HBV/1-39      AC A9PLG0.1
#=GS Q0KG53_HBV/31-214    AC Q0KG53.1
#=GS Q09KW2_HBV/2-20      AC Q09KW2.1
#=GS B4Z454_HBV/31-68     AC B4Z454.1
#=GS D5LCW3_HBV/2-183     AC D5LCW3.1
#=GS B4Z1L3_HBV/2-42      AC B4Z1L3.1
#=GS C4P130_HBV/31-76     AC C4P130.1
#=GS C4P1H5_HBV/31-76     AC C4P1H5.1
#=GS B0FD15_HBV/31-212    AC B0FD15.1
#=GS C7AYU6_HBV/2-185     AC C7AYU6.1
#=GS G0Z302_HBV/2-121     AC G0Z302.1
#=GS C3W3Q0_HBV/2-183     AC C3W3Q0.1
#=GS I0DG68_HBV/31-212    AC I0DG68.1
#=GS Q09KU6_HBV/2-20      AC Q09KU6.1
#=GS Q68032_HBV/31-212    AC Q68032.1
#=GS B4X6L5_HBV/31-87     AC B4X6L5.1
#=GS D3TIT2_HBV/2-181     AC D3TIT2.1
#=GS A9PLH9_HBV/1-39      AC A9PLH9.1
#=GS E0ZNB4_HBV/2-142     AC E0ZNB4.1
#=GS B4Z1H3_HBV/31-71     AC B4Z1H3.1
#=GS B4Z3Q7_HBV/2-39      AC B4Z3Q7.1
#=GS Q4R1S4_HBV/31-214    AC Q4R1S4.1
#=GS D8VC15_HBV/31-80     AC D8VC15.1
#=GS C7AYE8_HBV/2-185     AC C7AYE8.1
#=GS D8VBW9_HBV/2-51      AC D8VBW9.1
#=GS Q6I6R6_HBV/31-71     AC Q6I6R6.1
#=GS D3J5R1_HBV/31-57     AC D3J5R1.1
#=GS D8VCC1_HBV/2-51      AC D8VCC1.1
#=GS Q2L591_HBV/2-20      AC Q2L591.1
#=GS Q9DLM5_HBV/31-212    AC Q9DLM5.1
#=GS Q6XGS0_HBV/2-185     AC Q6XGS0.1
#=GS B4Z2V5_HBV/2-41      AC B4Z2V5.1
#=GS Q003Y9_HBV/2-183     AC Q003Y9.1
#=GS D6P592_HBV/2-183     AC D6P592.1
#=GS D8VBI5_HBV/31-128    AC D8VBI5.1
#=GS B9VKQ2_HBV/31-212    AC B9VKQ2.1
#=GS A6YJZ8_HBV/2-181     AC A6YJZ8.1
#=GS Q91T10_HBV/31-214    AC Q91T10.1
#=GS Q6X5G1_HBV/1-122     AC Q6X5G1.1
#=GS Q0PMK1_HBV/105-184   AC Q0PMK1.1
#=GS Q6XGP3_HBV/31-214    AC Q6XGP3.1
#=GS E0ZS07_HBV/2-183     AC E0ZS07.1
#=GS H9BMS3_HBV/1-150     AC H9BMS3.1
#=GS C7AYY5_HBV/31-214    AC C7AYY5.1
#=GS B4Z424_HBV/31-68     AC B4Z424.1
#=GS B4Z1J5_HBV/2-42      AC B4Z1J5.1
#=GS B3VAX1_HBV/2-183     AC B3VAX1.1
#=GS E9L2J6_HBV/2-185     AC E9L2J6.1
#=GS I0DG26_HBV/31-212    AC I0DG26.1
#=GS Q6XJY2_HBV/2-185     AC Q6XJY2.1
#=GS B4Z363_HBV/2-37      AC B4Z363.1
#=GS B5B4I8_HBV/2-183     AC B5B4I8.1
#=GS D8VBW2_HBV/31-65     AC D8VBW2.1
#=GS G1E8D1_HBV/31-212    AC G1E8D1.1
#=GS B2WSQ1_HBV/2-183     AC B2WSQ1.1
#=GS Q60H38_HBV/31-71     AC Q60H38.1
#=GS E0ZS02_HBV/2-183     AC E0ZS02.1
#=GS H6V5L1_HBV/2-183     AC H6V5L1.1
#=GS Q1MSP3_HBV/31-173    AC Q1MSP3.1
#=GS B4Z3X1_HBV/31-68     AC B4Z3X1.1
#=GS E0D379_HBV/31-82     AC E0D379.1
#=GS G0Z2Z4_HBV/2-121     AC G0Z2Z4.1
#=GS B4Z655_HBV/2-41      AC B4Z655.1
#=GS D3J5Q4_HBV/31-57     AC D3J5Q4.1
#=GS D8VBI0_HBV/2-47      AC D8VBI0.1
#=GS C4P0Y0_HBV/31-76     AC C4P0Y0.1
#=GS B4Z4J5_HBV/2-41      AC B4Z4J5.1
#=GS D6QVX6_HBV/2-183     AC D6QVX6.1
#=GS Q6I6U2_HBV/31-71     AC Q6I6U2.1
#=GS E0ZNY5_HBV/2-110     AC E0ZNY5.1
#=GS B4Z4R4_HBV/2-41      AC B4Z4R4.1
#=GS H6V5N1_HBV/2-183     AC H6V5N1.1
#=GS B4Z4T1_HBV/31-70     AC B4Z4T1.1
#=GS CAPSD_HBVA4/2-185    AC P0C693.1
#=GS H6UG93_HBV/2-183     AC H6UG93.1
#=GS Q7T7W8_HBV/31-212    AC Q7T7W8.1
#=GS E0ZR79_HBV/2-183     AC E0ZR79.1
#=GS D3TJ97_HBV/113-183   AC D3TJ97.1
#=GS B8PTH2_HBV/2-183     AC B8PTH2.1
#=GS B5B4B9_HBV/2-183     AC B5B4B9.1
#=GS A9PLD9_HBV/1-39      AC A9PLD9.1
#=GS D2JME0_HBV/2-183     AC D2JME0.1
#=GS C7AYJ9_HBV/31-214    AC C7AYJ9.1
#=GS H1ACW7_HBV/2-183     AC H1ACW7.1
#=GS D3J5Q3_HBV/31-57     AC D3J5Q3.1
#=GS B3VB87_HBV/31-212    AC B3VB87.1
#=GS B4Z3D2_HBV/31-66     AC B4Z3D2.1
#=GS B4Z5X4_HBV/2-42      AC B4Z5X4.1
#=GS D5LBL8_HBV/31-212    AC D5LBL8.1
#=GS A0MML1_HBV/31-212    AC A0MML1.1
#=GS B4X6M6_HBV/31-86     AC B4X6M6.1
#=GS B4Z4W5_HBV/2-41      AC B4Z4W5.1
#=GS CAPSD_HBVB6/2-183    AC Q67924.1
#=GS Q2EGE0_HBV/31-99     AC Q2EGE0.1
#=GS Q60GV2_HBV/31-71     AC Q60GV2.1
#=GS Q45F28_HBV/2-183     AC Q45F28.1
#=GS G9MD73_HBV/2-183     AC G9MD73.1
#=GS B1PI52_9HEPA/2-262   AC B1PI52.1
#=GS B6ULG2_HBV/31-151    AC B6ULG2.1
#=GS H6V8D3_HBV/31-56     AC H6V8D3.1
#=GS Q8QP38_HBV/1-132     AC Q8QP38.1
#=GS B9VKW7_HBV/31-212    AC B9VKW7.1
#=GS Q9J1L9_HBV/2-183     AC Q9J1L9.1
#=GS C4P1C4_HBV/31-76     AC C4P1C4.1
#=GS Q6XGM9_HBV/31-214    AC Q6XGM9.1
#=GS B5TY07_HBV/2-183     AC B5TY07.1
#=GS C7AYQ4_HBV/31-214    AC C7AYQ4.1
#=GS E0ZN88_HBV/31-182    AC E0ZN88.1
#=GS D7NL27_HBV/31-212    AC D7NL27.1
#=GS Q45F56_HBV/31-212    AC Q45F56.1
#=GS D8VBY7_HBV/2-51      AC D8VBY7.1
#=GS D3J5L7_HBV/31-57     AC D3J5L7.1
#=GS Q67836_HBV/31-91     AC Q67836.1
#=GS C7AYD6_HBV/2-185     AC C7AYD6.1
#=GS Q2F4Y3_HBV/31-214    AC Q2F4Y3.1
#=GS CAPSD_HBVA7/2-185    AC P0C696.1
#=GS B0FDA3_HBV/2-183     AC B0FDA3.1
#=GS Q09KU3_HBV/2-20      AC Q09KU3.1
#=GS E0ZNF9_HBV/2-147     AC E0ZNF9.1
#=GS D3TJ90_HBV/31-212    AC D3TJ90.1
#=GS Q91SZ7_HBV/31-64     AC Q91SZ7.1
#=GS G1C8E7_HBV/2-183     AC G1C8E7.1
#=GS A0FDK2_HBV/31-110    AC A0FDK2.1
#=GS D8VBA9_HBV/2-51      AC D8VBA9.1
#=GS B4Z4N1_HBV/2-41      AC B4Z4N1.1
#=GS Q6X5F9_HBV/1-130     AC Q6X5F9.1
#=GS C4P1E9_HBV/31-76     AC C4P1E9.1
#=GS B4Z2P6_HBV/2-41      AC B4Z2P6.1
#=GS B4Z3D5_HBV/31-71     AC B4Z3D5.1
#=GS Q2EGC8_HBV/31-99     AC Q2EGC8.1
#=GS D5LF24_HBV/2-183     AC D5LF24.1
#=GS D0E5E6_HBV/31-212    AC D0E5E6.1
#=GS Q1XHF5_HBV/31-212    AC Q1XHF5.1
#=GS Q5R2Q8_HBV/2-183     AC Q5R2Q8.1
#=GS Q1MSM4_HBV/31-173    AC Q1MSM4.1
#=GS B4Z623_HBV/31-70     AC B4Z623.1
#=GS Q81123_HBV/2-183     AC Q81123.1
#=GS B5AT31_HBV/2-183     AC B5AT31.1
#=GS B8PTF7_HBV/31-212    AC B8PTF7.1
#=GS Q60GW2_HBV/31-71     AC Q60GW2.1
#=GS Q2LCD7_HBV/2-183     AC Q2LCD7.1
#=GS B4Z615_HBV/31-70     AC B4Z615.1
#=GS Q8JXG3_HBV/2-183     AC Q8JXG3.1
#=GS Q6TYG4_HBV/31-182    AC Q6TYG4.1
#=GS Q5G3J5_HBV/2-25      AC Q5G3J5.1
#=GS Q6I6W8_HBV/31-78     AC Q6I6W8.1
#=GS B5M5X1_HBV/31-212    AC B5M5X1.1
#=GS Q68079_HBV/2-183     AC Q68079.1
#=GS D8VCD7_HBV/31-66     AC D8VCD7.1
#=GS D8VCE7_HBV/2-37      AC D8VCE7.1
#=GS Q1PCY5_HBV/31-212    AC Q1PCY5.1
#=GS C6L4A4_HBV/13-141    AC C6L4A4.1
#=GS Q1MSL1_HBV/31-173    AC Q1MSL1.1
#=GS B1A0B0_HBV/2-183     AC B1A0B0.1
#=GS B6D6H8_HBV/2-113     AC B6D6H8.1
#=GS B4Z6A8_HBV/31-70     AC B4Z6A8.1
#=GS C7AY49_HBV/31-214    AC C7AY49.1
#=GS B5LX88_HBV/31-212    AC B5LX88.1
#=GS Q60GZ6_HBV/31-71     AC Q60GZ6.1
#=GS E0ZP65_HBV/2-110     AC E0ZP65.1
#=GS C3W3V9_HBV/2-183     AC C3W3V9.1
#=GS E0ZRV2_HBV/2-183     AC E0ZRV2.1
#=GS C4P125_HBV/31-76     AC C4P125.1
#=GS Q8V1M1_HBV/31-212    AC Q8V1M1.1
#=GS A9PLG7_HBV/1-39      AC A9PLG7.1
#=GS D3J6D0_HBV/31-70     AC D3J6D0.1
#=GS B3VAI0_HBV/2-183     AC B3VAI0.1
#=GS B5LXZ1_HBV/2-183     AC B5LXZ1.1
#=GS B7TUN5_HBV/2-183     AC B7TUN5.1
#=GS Q5G3J7_HBV/2-25      AC Q5G3J7.1
#=GS B3VB56_HBV/2-183     AC B3VB56.1
#=GS G8H3F5_HBV/2-131     AC G8H3F5.1
#=GS D8VCB1_HBV/2-51      AC D8VCB1.1
#=GS D5MSF4_HBV/2-183     AC D5MSF4.1
#=GS D3J5K9_HBV/31-57     AC D3J5K9.1
#=GS D4HMX5_HBV/1-77      AC D4HMX5.1
#=GS C6F4Q2_HBV/2-185     AC C6F4Q2.1
#=GS D3TK01_HBV/117-164   AC D3TK01.1
#=GS D2U5Z2_HBV/2-183     AC D2U5Z2.1
#=GS E3Q0Q3_HBV/2-183     AC E3Q0Q3.1
#=GS HBEAG_WHV3/32-218    AC P0C6J4.1
#=GS O42042_HBV/31-212    AC O42042.1
#=GS Q2EX67_HBV/31-212    AC Q2EX67.1
#=GS B6D699_HBV/2-49      AC B6D699.1
#=GS Q8AYV1_HBV/2-185     AC Q8AYV1.1
#=GS C4P1T6_HBV/31-76     AC C4P1T6.1
#=GS D2U652_HBV/2-183     AC D2U652.1
#=GS B7TV27_HBV/2-183     AC B7TV27.1
#=GS Q8QSB0_HBV/31-212    AC Q8QSB0.1
#=GS B2Y6J2_HBV/2-185     AC B2Y6J2.1
#=GS Q5G3H5_HBV/31-54     AC Q5G3H5.1
#=GS B4Z3H6_HBV/2-42      AC B4Z3H6.1
#=GS D3TK67_HBV/82-135    AC D3TK67.1
#=GS E8Z628_HBV/31-212    AC E8Z628.1
#=GS A0FDK8_HBV/2-183     AC A0FDK8.1
#=GS Q69611_HBV/2-183     AC Q69611.1
#=GS B9VKH5_HBV/31-212    AC B9VKH5.1
#=GS B4Z1P1_HBV/31-71     AC B4Z1P1.1
#=GS Q8QSB7_HBV/31-212    AC Q8QSB7.1
#=GS G1EII0_HBV/2-153     AC G1EII0.1
#=GS HBEAG_HBVC0/31-212   AC P0C6H2.1
#=GS HBEAG_HBVC0/31-212   DR PDB; 3OX8 F; 1-9;
#=GS HBEAG_HBVC0/31-212   DR PDB; 3OXS C; 1-9;
#=GS HBEAG_HBVC0/31-212   DR PDB; 3OXR C; 1-9;
#=GS HBEAG_HBVC0/31-212   DR PDB; 3OX8 C; 1-9;
#=GS B4Z3L5_HBV/2-39      AC B4Z3L5.1
#=GS B6ULN8_HBV/1-74      AC B6ULN8.1
#=GS Q3LTZ7_HBV/31-212    AC Q3LTZ7.1
#=GS Q8UYB1_HBV/31-72     AC Q8UYB1.1
#=GS B4Z4U9_HBV/31-70     AC B4Z4U9.1
#=GS G1E7W8_HBV/2-183     AC G1E7W8.1
#=GS Q9E0U7_HBV/2-123     AC Q9E0U7.1
#=GS F4MJE5_HBV/31-81     AC F4MJE5.1
#=GS C7AYQ5_HBV/2-185     AC C7AYQ5.1
#=GS C4P106_HBV/31-76     AC C4P106.1
#=GS Q917I6_HBV/2-183     AC Q917I6.1
#=GS D9U5A5_HBV/2-183     AC D9U5A5.1
#=GS C4P1N1_HBV/31-76     AC C4P1N1.1
#=GS G0Z2V9_HBV/2-121     AC G0Z2V9.1
#=GS B4Z3L7_HBV/31-68     AC B4Z3L7.1
#=GS B5M504_HBV/31-212    AC B5M504.1
#=GS C4P198_HBV/31-76     AC C4P198.1
#=GS E1U7M6_HBV/2-183     AC E1U7M6.1
#=GS Q6I6P4_HBV/31-74     AC Q6I6P4.1
#=GS H9BMS5_HBV/1-133     AC H9BMS5.1
#=GS C4P1S8_HBV/31-76     AC C4P1S8.1
#=GS Q8QP11_HBV/1-130     AC Q8QP11.1
#=GS Q4R1T2_HBV/31-214    AC Q4R1T2.1
#=GS D3YFX7_HBV/2-183     AC D3YFX7.1
#=GS B4Z360_HBV/2-37      AC B4Z360.1
#=GS D8VCD1_HBV/31-66     AC D8VCD1.1
#=GS D3J5W3_HBV/31-73     AC D3J5W3.1
#=GS Q6XGI7_HBV/31-212    AC Q6XGI7.1
#=GS Q17UT2_HBVAW/2-185   AC Q17UT2.1
#=GS Q91A76_HBV/31-66     AC Q91A76.1
#=GS E0ZND6_HBV/2-153     AC E0ZND6.1
#=GS D0EEH6_HBV/2-185     AC D0EEH6.1
#=GS C1KTA2_HBV/31-210    AC C1KTA2.1
#=GS C4P0Y6_HBV/31-76     AC C4P0Y6.1
#=GS Q6TYF5_HBV/31-182    AC Q6TYF5.1
#=GS G1C8U2_HBV/2-183     AC G1C8U2.1
#=GS Q910N8_HBV/31-212    AC Q910N8.1
#=GS C4P1H8_HBV/31-76     AC C4P1H8.1
#=GS B9VKL4_HBV/31-212    AC B9VKL4.1
#=GS B3V8T7_HBV/31-212    AC B3V8T7.1
#=GS CAPSD_HBVC1/2-183    AC Q81102.1
#=GS B4X6K7_HBV/31-87     AC B4X6K7.1
#=GS Q6X5H5_HBV/1-117     AC Q6X5H5.1
#=GS E7D6T5_9HEPA/45-305  AC E7D6T5.1
#=GS B4Z620_HBV/31-70     AC B4Z620.1
#=GS D3J6C0_HBV/31-70     AC D3J6C0.1
#=GS B4Z4I9_HBV/2-41      AC B4Z4I9.1
#=GS D8V9T7_HBV/31-80     AC D8V9T7.1
#=GS Q2TJE2_HBV/31-212    AC Q2TJE2.1
#=GS G0XT57_HBV/31-202    AC G0XT57.1
#=GS C4P1D9_HBV/31-76     AC C4P1D9.1
#=GS H9BMT8_HBV/26-179    AC H9BMT8.1
#=GS B4Z2L4_HBV/2-41      AC B4Z2L4.1
#=GS B5ASY4_HBV/31-212    AC B5ASY4.1
#=GS B4X6L9_HBV/31-86     AC B4X6L9.1
#=GS Q81145_HBV/31-111    AC Q81145.1
#=GS B4Z359_HBV/31-66     AC B4Z359.1
#=GS B9VKD9_HBV/31-212    AC B9VKD9.1
#=GS E0ZNY4_HBV/31-139    AC E0ZNY4.1
#=GS B4Z3C3_HBV/31-66     AC B4Z3C3.1
#=GS Q19K66_HBV/31-62     AC Q19K66.1
#=GS A4F2U7_HBV/31-212    AC A4F2U7.1
#=GS Q1MST0_HBV/31-173    AC Q1MST0.1
#=GS B4Z2R5_HBV/31-70     AC B4Z2R5.1
#=GS Q6X7Z7_9HEPA/45-305  AC Q6X7Z7.1
#=GS H6V5T3_HBV/2-183     AC H6V5T3.1
#=GS A9QPZ9_HBV/2-183     AC A9QPZ9.1
#=GS B4Z365_HBV/31-66     AC B4Z365.1
#=GS B9VKB3_HBV/2-183     AC B9VKB3.1
#=GS B5TXK6_HBV/2-183     AC B5TXK6.1
#=GS B2Y6Z3_HBV/31-212    AC B2Y6Z3.1
#=GS D3J5U5_HBV/31-88     AC D3J5U5.1
#=GS B4Z1Z8_HBV/2-41      AC B4Z1Z8.1
#=GS B4Z1P2_HBV/2-42      AC B4Z1P2.1
#=GS C4P1L1_HBV/31-76     AC C4P1L1.1
#=GS Q2L5E9_HBV/2-24      AC Q2L5E9.1
#=GS Q9W8I1_9HEPA/45-305  AC Q9W8I1.1
#=GS D3J5Q5_HBV/31-57     AC D3J5Q5.1
#=GS B4Z676_HBV/2-41      AC B4Z676.1
#=GS G1EII5_HBV/2-153     AC G1EII5.1
#=GS B4Z354_HBV/2-37      AC B4Z354.1
#=GS E0ZRL8_HBV/2-183     AC E0ZRL8.1
#=GS A9QPV4_HBV/2-183     AC A9QPV4.1
#=GS I0DG31_HBV/31-212    AC I0DG31.1
#=GS B4Z2E9_HBV/31-66     AC B4Z2E9.1
#=GS A5LGA5_HBV/2-183     AC A5LGA5.1
#=GS D3J5R4_HBV/31-57     AC D3J5R4.1
#=GS D9U5P2_HBV/2-181     AC D9U5P2.1
#=GS C4P1A2_HBV/31-76     AC C4P1A2.1
#=GS Q77N76_HBVF4/31-212  AC Q77N76.1
#=GS Q1MSR3_HBV/31-173    AC Q1MSR3.1
#=GS Q80H44_HBV/31-116    AC Q80H44.1
#=GS H2E6Z3_HBV/2-164     AC H2E6Z3.1
#=GS D8VCH8_HBV/2-40      AC D8VCH8.1
#=GS E0ZNF0_HBV/2-153     AC E0ZNF0.1
#=GS Q991K1_HBV/31-108    AC Q991K1.1
#=GS F1CFC2_HBV/2-183     AC F1CFC2.1
#=GS A7M6U0_HBV/2-183     AC A7M6U0.1
#=GS Q8JSX1_HBV/1-130     AC Q8JSX1.1
#=GS C4P1I2_HBV/31-76     AC C4P1I2.1
#=GS A9PLD8_HBV/1-39      AC A9PLD8.1
#=GS Q9QMJ0_HBV/31-212    AC Q9QMJ0.1
#=GS B7TTZ1_HBV/31-212    AC B7TTZ1.1
#=GS Q60H25_HBV/31-71     AC Q60H25.1
#=GS B0FCB5_HBV/31-109    AC B0FCB5.1
#=GS C4P0Y7_HBV/31-76     AC C4P0Y7.1
#=GS G9G9D1_HBV/2-183     AC G9G9D1.1
#=GS B0YGL0_HBV/2-183     AC B0YGL0.1
#=GS A1YTL6_HBV/2-183     AC A1YTL6.1
#=GS D3J6B2_HBV/31-70     AC D3J6B2.1
#=GS B4Z406_HBV/31-68     AC B4Z406.1
#=GS D8VBU8_HBV/31-68     AC D8VBU8.1
#=GS HBEAG_ASHV/32-217    AC Q64896.1
#=GS D0EEK3_HBV/2-185     AC D0EEK3.1
#=GS Q8VBK1_HBV/2-183     AC Q8VBK1.1
#=GS D8VC10_HBV/31-52     AC D8VC10.1
#=GS C4P112_HBV/31-76     AC C4P112.1
#=GS Q7TF64_HBV/31-212    AC Q7TF64.1
#=GS Q14UA4_HBV/31-78     AC Q14UA4.1
#=GS G3E564_HBV/31-212    AC G3E564.1
#=GS B4Z1K9_HBV/31-71     AC B4Z1K9.1
#=GS C7DMG3_HBV/2-183     AC C7DMG3.1
#=GS C6L680_HBV/2-183     AC C6L680.1
#=GS Q6I6V0_HBV/31-74     AC Q6I6V0.1
#=GS F5C1L2_HBV/43-224    AC F5C1L2.1
#=GS C9W1Z5_HBV/2-183     AC C9W1Z5.1
#=GS C4P1M1_HBV/31-76     AC C4P1M1.1
#=GS G1E894_HBV/2-183     AC G1E894.1
#=GS B4YKX4_HBV/31-212    AC B4YKX4.1
#=GS D8VC27_HBV/2-179     AC D8VC27.1
#=GS C4P1K3_HBV/31-76     AC C4P1K3.1
#=GS D8VB83_HBV/2-51      AC D8VB83.1
#=GS Q2L5E1_HBV/2-20      AC Q2L5E1.1
#=GS B4Z282_HBV/31-66     AC B4Z282.1
#=GS D3GE55_HBV/2-183     AC D3GE55.1
#=GS D0EEF1_HBV/2-185     AC D0EEF1.1
#=GS Q60GW9_HBV/31-71     AC Q60GW9.1
#=GS Q8QSB3_HBV/31-212    AC Q8QSB3.1
#=GS I0DG39_HBV/31-212    AC I0DG39.1
#=GS Q91A52_HBV/31-66     AC Q91A52.1
#=GS D8VC18_HBV/31-66     AC D8VC18.1
#=GS B3VB64_HBV/2-183     AC B3VB64.1
#=GS B6CEW3_HBV/2-183     AC B6CEW3.1
#=GS B4X6H9_HBV/31-87     AC B4X6H9.1
#=GS C4P129_HBV/31-76     AC C4P129.1
#=GS D5LF84_HBV/2-183     AC D5LF84.1
#=GS Q507G0_HBV/31-163    AC Q507G0.1
#=GS D8VCJ3_HBV/2-37      AC D8VCJ3.1
#=GS A7L358_HBV/2-161     AC A7L358.1
#=GS G9HVG6_HBV/31-212    AC G9HVG6.1
#=GS I0DG62_HBV/31-212    AC I0DG62.1
#=GS E5RN32_HBV/1-162     AC E5RN32.1
#=GS B4Z487_HBV/31-68     AC B4Z487.1
#=GS C4P1A8_HBV/31-76     AC C4P1A8.1
#=GS Q1MSR1_HBV/31-173    AC Q1MSR1.1
#=GS H9BMW5_HBV/28-192    AC H9BMW5.1
#=GS B3VB37_HBV/31-212    AC B3VB37.1
#=GS O91521_HBV/31-212    AC O91521.1
#=GS B4Z4K7_HBV/2-41      AC B4Z4K7.1
#=GS B4Z311_HBV/31-66     AC B4Z311.1
#=GS Q80GX7_HBV/2-183     AC Q80GX7.1
#=GS B4Z1V6_HBV/2-40      AC B4Z1V6.1
#=GS Q6I6Q0_HBV/31-74     AC Q6I6Q0.1
#=GS D3J5P5_HBV/31-57     AC D3J5P5.1
#=GS C4P1U4_HBV/31-76     AC C4P1U4.1
#=GS Q77ZZ2_HBVE4/31-212  AC Q77ZZ2.1
#=GS Q77BG7_HBV/1-96      AC Q77BG7.1
#=GS C0LKI7_HBV/2-183     AC C0LKI7.1
#=GS Q917I5_HBV/2-183     AC Q917I5.1
#=GS A1KR43_HBV/2-25      AC A1KR43.1
#=GS D8VC89_HBV/31-66     AC D8VC89.1
#=GS E7CT97_HBV/31-212    AC E7CT97.1
#=GS Q8JSW4_HBV/1-130     AC Q8JSW4.1
#=GS D6QVI2_HBV/2-183     AC D6QVI2.1
#=GS E0ZNU4_HBV/2-110     AC E0ZNU4.1
#=GS Q6TYH2_HBV/31-182    AC Q6TYH2.1
#=GS G1E861_HBV/31-212    AC G1E861.1
#=GS Q1JUT1_HBV/31-117    AC Q1JUT1.1
#=GS Q9DH31_HBV/31-212    AC Q9DH31.1
#=GS Q991K3_HBV/31-144    AC Q991K3.1
#=GS Q19SV5_HBV/2-183     AC Q19SV5.1
#=GS H6UGU0_HBV/2-183     AC H6UGU0.1
#=GS H6UNC3_HBV/2-183     AC H6UNC3.1
#=GS C4P1J0_HBV/31-76     AC C4P1J0.1
#=GS Q67916_HBV/2-183     AC Q67916.1
#=GS Q60GX0_HBV/31-71     AC Q60GX0.1
#=GS Q9QBE8_HBV/2-183     AC Q9QBE8.1
#=GS D8VBZ5_HBV/31-80     AC D8VBZ5.1
#=GS B4Z4J9_HBV/31-70     AC B4Z4J9.1
#=GS B4X6K0_HBV/31-87     AC B4X6K0.1
#=GS D8VC61_HBV/2-51      AC D8VC61.1
#=GS B0B2J5_HBV/2-183     AC B0B2J5.1
#=GS Q80IL2_HBV/31-212    AC Q80IL2.1
#=GS Q2L5H5_HBV/2-24      AC Q2L5H5.1
#=GS Q6TYH3_HBV/31-182    AC Q6TYH3.1
#=GS E0ZNC7_HBV/2-153     AC E0ZNC7.1
#=GS D5LE99_HBV/2-183     AC D5LE99.1
#=GS C7DNE7_HBV/31-212    AC C7DNE7.1
#=GS Q1MSL4_HBV/31-173    AC Q1MSL4.1
#=GS E0ZNG9_HBV/2-153     AC E0ZNG9.1
#=GS Q91S86_HBV/31-210    AC Q91S86.1
#=GS D8VBT1_HBV/2-51      AC D8VBT1.1
#=GS D0EEI2_HBV/2-185     AC D0EEI2.1
#=GS Q9QAF4_HBV/2-183     AC Q9QAF4.1
#=GS A9CM56_HBV/2-183     AC A9CM56.1
#=GS H6UN55_HBV/2-183     AC H6UN55.1
#=GS E9RGY0_HBV/31-212    AC E9RGY0.1
#=GS B4Z5R9_HBV/2-42      AC B4Z5R9.1
#=GS F4MJE0_HBV/31-81     AC F4MJE0.1
#=GS A7L363_HBV/2-161     AC A7L363.1
#=GS C1K1F6_HBV/31-210    AC C1K1F6.1
#=GS Q7TED6_HBV/31-163    AC Q7TED6.1
#=GS Q8JSW6_HBV/1-130     AC Q8JSW6.1
#=GS D3XGC5_HBV/2-183     AC D3XGC5.1
#=GS G0Z2V1_HBV/2-121     AC G0Z2V1.1
#=GS B4X6I9_HBV/31-87     AC B4X6I9.1
#=GS B9VL28_HBV/31-212    AC B9VL28.1
#=GS A5GZN7_HBV/31-212    AC A5GZN7.1
#=GS D4I4Q8_HBV/2-183     AC D4I4Q8.1
#=GS Q1MSP0_HBV/31-147    AC Q1MSP0.1
#=GS B6ULK9_HBV/91-168    AC B6ULK9.1
#=GS Q1MSV9_HBV/31-173    AC Q1MSV9.1
#=GS Q9QAC5_HBV/2-183     AC Q9QAC5.1
#=GS B4Z3Y3_HBV/31-68     AC B4Z3Y3.1
#=GS Q7T7V4_HBV/31-212    AC Q7T7V4.1
#=GS A9PLH4_HBV/1-39      AC A9PLH4.1
#=GS Q5R2R6_HBV/31-212    AC Q5R2R6.1
#=GS B5B478_HBV/31-212    AC B5B478.1
#=GS B9VKM7_HBV/2-183     AC B9VKM7.1
#=GS C0IRW8_HBV/2-183     AC C0IRW8.1
#=GS B0B2V5_HBV/2-183     AC B0B2V5.1
#=GS F5C086_HBV/2-183     AC F5C086.1
#=GS Q6XGQ7_HBV/31-214    AC Q6XGQ7.1
#=GS Q9QB05_HBV/2-183     AC Q9QB05.1
#=GS C7AY65_HBV/2-185     AC C7AY65.1
#=GS D3J611_HBV/31-88     AC D3J611.1
#=GS Q9QB04_HBV/2-183     AC Q9QB04.1
#=GS D3J5M8_HBV/31-70     AC D3J5M8.1
#=GS C4P145_HBV/31-76     AC C4P145.1
#=GS Q76MY6_HBV/2-183     AC Q76MY6.1
#=GS H9BMS2_HBV/1-150     AC H9BMS2.1
#=GS B9VKA5_HBV/2-183     AC B9VKA5.1
#=GS Q2L585_HBV/2-20      AC Q2L585.1
#=GS H2ER82_HBV/2-183     AC H2ER82.1
#=GS C7DN28_HBV/2-183     AC C7DN28.1
#=GS C4P194_HBV/31-76     AC C4P194.1
#=GS Q67901_HBV/31-193    AC Q67901.1
#=GS E7CU15_HBV/2-183     AC E7CU15.1
#=GS D3J5T6_HBV/31-88     AC D3J5T6.1
#=GS A9PLJ0_HBV/1-44      AC A9PLJ0.1
#=GS B4Z3U2_HBV/31-68     AC B4Z3U2.1
#=GS Q98VI4_HBV/31-212    AC Q98VI4.1
#=GS Q9J3T5_HBV/1-65      AC Q9J3T5.1
#=GS C3W3W5_HBV/2-183     AC C3W3W5.1
#=GS B4YLC2_HBV/31-212    AC B4YLC2.1
#=GS H2ERF0_HBV/2-183     AC H2ERF0.1
#=GS B4Z315_HBV/2-37      AC B4Z315.1
#=GS D8VBL0_HBV/2-51      AC D8VBL0.1
#=GS Q67982_HBV/31-212    AC Q67982.1
#=GS D8VBP8_HBV/2-50      AC D8VBP8.1
#=GS B4Z297_HBV/31-66     AC B4Z297.1
#=GS D3J5L9_HBV/31-57     AC D3J5L9.1
#=GS Q6XGT4_HBV/2-185     AC Q6XGT4.1
#=GS Q80B44_HBV/31-212    AC Q80B44.1
#=GS Q91T07_HBV/31-214    AC Q91T07.1
#=GS B2CSB8_HBV/2-183     AC B2CSB8.1
#=GS B5AT48_HBV/31-212    AC B5AT48.1
#=GS G1EII7_HBV/2-153     AC G1EII7.1
#=GS Q2LCC5_HBV/2-183     AC Q2LCC5.1
#=GS Q765V7_HBV/31-212    AC Q765V7.1
#=GS D3J5Y5_HBV/31-88     AC D3J5Y5.1
#=GS Q9DH46_HBV/2-183     AC Q9DH46.1
#=GS D8VC97_HBV/2-37      AC D8VC97.1
#=GS I0DG22_HBV/31-212    AC I0DG22.1
#=GS C4P114_HBV/31-76     AC C4P114.1
#=GS B4Z6A2_HBV/31-70     AC B4Z6A2.1
#=GS G9MD68_HBV/2-183     AC G9MD68.1
#=GS C7DQS1_HBV/2-183     AC C7DQS1.1
#=GS B4Z3Y6_HBV/31-68     AC B4Z3Y6.1
#=GS C4P118_HBV/31-76     AC C4P118.1
#=GS D8VCB3_HBV/2-36      AC D8VCB3.1
#=GS B4Z4J3_HBV/31-70     AC B4Z4J3.1
#=GS Q6I6P2_HBV/31-74     AC Q6I6P2.1
#=GS B4Z1U4_HBV/2-51      AC B4Z1U4.1
#=GS B2CZI1_HBV/31-212    AC B2CZI1.1
#=GS B6ULL5_HBV/31-212    AC B6ULL5.1
#=GS B4Z630_HBV/2-41      AC B4Z630.1
#=GS G0Z313_HBV/2-121     AC G0Z313.1
#=GS D8VC52_HBV/31-78     AC D8VC52.1
#=GS Q6TYF1_HBV/31-182    AC Q6TYF1.1
#=GS B5BUU7_HBV/31-214    AC B5BUU7.1
#=GS B4Z3P5_HBV/2-39      AC B4Z3P5.1
#=GS D3J5U2_HBV/31-88     AC D3J5U2.1
#=GS HBEAG_HPBDB/45-305   AC P17190.2
#=GS CAPSD_WHV2/2-187     AC P06433.1
#=GS Q67880_HBV/2-183     AC Q67880.1
#=GS Q99HT9_HBV/31-212    AC Q99HT9.1
#=GS Q45F39_HBV/2-183     AC Q45F39.1
#=GS G1E7M7_HBV/2-183     AC G1E7M7.1
#=GS Q8VBG8_HBV/2-185     AC Q8VBG8.1
#=GS A8WE40_HBV/16-177    AC A8WE40.1
#=GS Q30BH6_HBV/31-113    AC Q30BH6.1
#=GS B5AT99_HBV/2-183     AC B5AT99.1
#=GS D6QVN3_HBV/2-183     AC D6QVN3.1
#=GS B4Z5Z5_HBV/2-42      AC B4Z5Z5.1
#=GS B4Z2V4_HBV/31-70     AC B4Z2V4.1
#=GS Q6UB18_HBV/1-65      AC Q6UB18.1
#=GS E5RN26_HBV/1-162     AC E5RN26.1
#=GS B8PTH9_HBV/2-183     AC B8PTH9.1
#=GS D9U5N1_HBV/31-212    AC D9U5N1.1
#=GS B4Z2C4_HBV/31-66     AC B4Z2C4.1
#=GS G3E5C7_HBV/31-212    AC G3E5C7.1
#=GS C3W4K5_HBV/2-183     AC C3W4K5.1
#=GS CAPSD_HBVA5/2-185    AC P0C694.1
#=GS Q45F65_HBV/2-183     AC Q45F65.1
#=GS E0ZNT4_HBV/31-139    AC E0ZNT4.1
#=GS D3J5W4_HBV/31-79     AC D3J5W4.1
#=GS B4Z4K4_HBV/2-41      AC B4Z4K4.1
#=GS C4P1I7_HBV/31-76     AC C4P1I7.1
#=GS B4Z616_HBV/2-41      AC B4Z616.1
#=GS Q9QB06_HBV/2-183     AC Q9QB06.1
#=GS Q507G2_HBV/31-163    AC Q507G2.1
#=GS C4P1G7_HBV/31-76     AC C4P1G7.1
#=GS A2T1E3_HBV/2-183     AC A2T1E3.1
#=GS E0ZNH4_HBV/31-182    AC E0ZNH4.1
#=GS B5ATD6_HBV/83-148    AC B5ATD6.1
#=GS B4Z2R0_HBV/2-41      AC B4Z2R0.1
#=GS B4Z481_HBV/31-68     AC B4Z481.1
#=GS Q9E0W3_HBV/2-123     AC Q9E0W3.1
#=GS Q9IHC8_HBV/31-111    AC Q9IHC8.1
#=GS C4P195_HBV/31-76     AC C4P195.1
#=GS A0FDW1_HBV/2-183     AC A0FDW1.1
#=GS D3J627_HBV/31-88     AC D3J627.1
#=GS O91544_HBV/31-212    AC O91544.1
#=GS C7DNI0_HBV/2-183     AC C7DNI0.1
#=GS D0EE46_HBV/2-185     AC D0EE46.1
#=GS D8VCC5_HBV/31-80     AC D8VCC5.1
#=GS Q8VBG6_HBV/2-185     AC Q8VBG6.1
#=GS B4Z5S8_HBV/2-42      AC B4Z5S8.1
#=GS Q2EGC0_HBV/31-99     AC Q2EGC0.1
#=GS G4XMD8_HBV/31-59     AC G4XMD8.1
#=GS Q0GBW8_9HEPA/2-188   AC Q0GBW8.1
#=GS D3J5L4_HBV/31-57     AC D3J5L4.1
#=GS C4P1U7_HBV/31-76     AC C4P1U7.1
#=GS G0Z2W1_HBV/2-121     AC G0Z2W1.1
#=GS C7AYM9_HBV/31-214    AC C7AYM9.1
#=GS B5U709_HBV/2-183     AC B5U709.1
#=GS E0ZNZ9_HBV/2-110     AC E0ZNZ9.1
#=GS D3J5P1_HBV/31-57     AC D3J5P1.1
#=GS D8VBJ3_HBV/31-80     AC D8VBJ3.1
#=GS Q598Q5_HBV/14-195    AC Q598Q5.1
#=GS G1E8H6_HBV/31-212    AC G1E8H6.1
#=GS B3VB17_HBV/2-183     AC B3VB17.1
#=GS D6QW51_HBV/2-183     AC D6QW51.1
#=GS Q2L4K2_HBV/2-183     AC Q2L4K2.1
#=GS B7TVA5_HBV/2-183     AC B7TVA5.1
#=GS B4Z210_HBV/2-41      AC B4Z210.1
#=GS D3J5M6_HBV/31-70     AC D3J5M6.1
#=GS G1E8T3_HBV/2-183     AC G1E8T3.1
#=GS Q60GY0_HBV/31-71     AC Q60GY0.1
#=GS A9PLD0_HBV/1-39      AC A9PLD0.1
#=GS C3W4J9_HBV/2-183     AC C3W4J9.1
#=GS A9CM69_HBV/2-183     AC A9CM69.1
#=GS Q76B38_HBV/31-212    AC Q76B38.1
#=GS D5LDB3_HBV/2-183     AC D5LDB3.1
#=GS B4Z1H9_HBV/31-71     AC B4Z1H9.1
#=GS B4Z2B6_HBV/2-37      AC B4Z2B6.1
#=GS B5M5E3_HBV/31-212    AC B5M5E3.1
#=GS C4P1D0_HBV/31-76     AC C4P1D0.1
#=GS Q598S3_HBV/31-212    AC Q598S3.1
#=GS Q8V1I0_HBV/31-212    AC Q8V1I0.1
#=GS C0LKJ1_HBV/2-183     AC C0LKJ1.1
#=GS B5A2F6_HBV/2-183     AC B5A2F6.1
#=GS B4Z460_HBV/31-68     AC B4Z460.1
#=GS D3XGE6_HBV/2-183     AC D3XGE6.1
#=GS I0DG23_HBV/31-212    AC I0DG23.1
#=GS D2JN06_HBV/2-183     AC D2JN06.1
#=GS B5TXS9_HBV/31-212    AC B5TXS9.1
#=GS B0B2W4_HBV/31-212    AC B0B2W4.1
#=GS Q9WP85_HBV/31-106    AC Q9WP85.1
#=GS D8VCH1_HBV/2-51      AC D8VCH1.1
#=GS HBEAG_HBVA6/31-214   AC Q91C37.1
#=GS B6ULJ2_HBV/31-212    AC B6ULJ2.1
#=GS A9PLE8_HBV/1-39      AC A9PLE8.1
#=GS HBEAG_HBVD3/31-212   AC P0C573.1
#=GS B4Z2N4_HBV/31-70     AC B4Z2N4.1
#=GS C1K1T2_HBV/31-212    AC C1K1T2.1
#=GS E0ZNA2_HBV/31-167    AC E0ZNA2.1
#=GS E5RPN8_HBV/31-212    AC E5RPN8.1
#=GS C4P1Q2_HBV/31-76     AC C4P1Q2.1
#=GS C4P1B9_HBV/31-76     AC C4P1B9.1
#=GS Q917H5_HBV/2-183     AC Q917H5.1
#=GS Q3LTX5_HBV/31-212    AC Q3LTX5.1
#=GS E0ZNA7_HBV/31-182    AC E0ZNA7.1
#=GS B3VB05_HBV/2-183     AC B3VB05.1
#=GS Q8QSA9_HBV/31-212    AC Q8QSA9.1
#=GS G9G8Z7_HBV/2-183     AC G9G8Z7.1
#=GS C6F4Q1_HBV/31-214    AC C6F4Q1.1
#=GS B4Z1G5_HBV/31-69     AC B4Z1G5.1
#=GS G0Z303_HBV/2-121     AC G0Z303.1
#=GS E0ZR91_HBV/31-212    AC E0ZR91.1
#=GS A3F6I2_HBV/31-214    AC A3F6I2.1
#=GS E0ZRR6_HBV/2-183     AC E0ZRR6.1
#=GS C9WDH2_HBV/2-183     AC C9WDH2.1
#=GS B9VL71_HBV/2-183     AC B9VL71.1
#=GS D3J667_HBV/31-68     AC D3J667.1
#=GS B3VAR6_HBV/2-183     AC B3VAR6.1
#=GS E0ZP41_HBV/2-110     AC E0ZP41.1
#=GS H6UN59_HBV/2-183     AC H6UN59.1
#=GS Q14U90_HBV/31-78     AC Q14U90.1
#=GS G1ETU1_HBV/31-212    AC G1ETU1.1
#=GS Q3LTZ0_HBV/2-183     AC Q3LTZ0.1
#=GS CAPSD_HBVB7/2-183    AC Q9QBF2.1
#=GS D3TK74_HBV/82-135    AC D3TK74.1
#=GS B3GSW2_HBV/31-212    AC B3GSW2.1
#=GS Q9WMD2_HBV/31-212    AC Q9WMD2.1
#=GS Q9WP52_HBV/31-212    AC Q9WP52.1
#=GS B9VQB1_HBV/2-183     AC B9VQB1.1
#=GS F5C1P1_HBV/2-183     AC F5C1P1.1
#=GS Q6UE53_HBV/2-183     AC Q6UE53.1
#=GS C4P1E8_HBV/31-76     AC C4P1E8.1
#=GS Q06AN5_HBV/31-212    AC Q06AN5.1
#=GS F4MJC8_HBV/31-81     AC F4MJC8.1
#=GS C1K1T3_HBV/2-183     AC C1K1T3.1
#=GS B4Z323_HBV/31-66     AC B4Z323.1
#=GS H9BMW7_HBV/24-182    AC H9BMW7.1
#=GS B4Z672_HBV/31-70     AC B4Z672.1
#=GS D8VBV7_HBV/2-36      AC D8VBV7.1
#=GS B4Z5Y6_HBV/2-42      AC B4Z5Y6.1
#=GS Q77BF4_HBV/1-96      AC Q77BF4.1
#=GS Q9E0R5_HBV/2-123     AC Q9E0R5.1
#=GS G9I1Z9_HBV/2-183     AC G9I1Z9.1
#=GS C4P107_HBV/31-76     AC C4P107.1
#=GS D5LBR7_HBV/2-183     AC D5LBR7.1
#=GS C4P190_HBV/31-76     AC C4P190.1
#=GS D3J5W9_HBV/31-79     AC D3J5W9.1
#=GS Q6TYH0_HBV/31-182    AC Q6TYH0.1
#=GS Q91SZ9_HBV/31-212    AC Q91SZ9.1
#=GS Q5DVX9_HBV/31-212    AC Q5DVX9.1
#=GS B4Z3G7_HBV/2-42      AC B4Z3G7.1
#=GS B4Z470_HBV/2-39      AC B4Z470.1
#=GS C7DSN1_HBV/2-183     AC C7DSN1.1
#=GS Q80J67_HBV/80-163    AC Q80J67.1
#=GS Q6XGS1_HBV/31-214    AC Q6XGS1.1
#=GS G3XGT1_HBV/2-183     AC G3XGT1.1
#=GS D3YGD0_HBV/2-183     AC D3YGD0.1
#=GS Q2L5I0_HBV/2-24      AC Q2L5I0.1
#=GS B9VKK2_HBV/31-212    AC B9VKK2.1
#=GS D2U600_HBV/2-183     AC D2U600.1
#=GS F5C1L3_HBV/2-183     AC F5C1L3.1
#=GS Q4W6E9_HBV/31-212    AC Q4W6E9.1
#=GS B4Z271_HBV/2-37      AC B4Z271.1
#=GS Q1MSU9_HBV/2-144     AC Q1MSU9.1
#=GS B6ULK9_HBV/31-93     AC B6ULK9.1
#=GS B4Z5U0_HBV/31-71     AC B4Z5U0.1
#=GS Q89531_HBVE1/2-183   AC Q89531.1
#=GS B4Z643_HBV/31-70     AC B4Z643.1
#=GS C0IR96_HBV/31-212    AC C0IR96.1
#=GS B2Y6T4_HBV/31-214    AC B2Y6T4.1
#=GS Q2L571_HBV/2-23      AC Q2L571.1
#=GS B4Z1F5_HBV/2-40      AC B4Z1F5.1
#=GS C3W4G7_HBV/2-183     AC C3W4G7.1
#=GS G1EIH8_HBV/2-153     AC G1EIH8.1
#=GS Q19SY3_HBV/2-183     AC Q19SY3.1
#=GS CAPSD_WMHBV/2-182    AC O71303.1
#=GS D3J686_HBV/31-68     AC D3J686.1
#=GS Q6J322_HBV/31-212    AC Q6J322.1
#=GS C4P1T3_HBV/31-76     AC C4P1T3.1
#=GS Q80H21_HBV/31-212    AC Q80H21.1
#=GS C7DM63_HBV/31-212    AC C7DM63.1
#=GS B2Y6J4_HBV/2-183     AC B2Y6J4.1
#=GS H9BMR1_HBV/25-191    AC H9BMR1.1
#=GS Q68003_HBV/2-183     AC Q68003.1
#=GS Q6UBJ5_HBV/31-212    AC Q6UBJ5.1
#=GS E8Z615_HBV/31-212    AC E8Z615.1
#=GS Q765G6_HBV/31-214    AC Q765G6.1
#=GS B4Z612_HBV/31-70     AC B4Z612.1
#=GS D4I4S3_HBV/2-185     AC D4I4S3.1
#=GS B4Z324_HBV/2-37      AC B4Z324.1
#=GS C4P1A4_HBV/31-76     AC C4P1A4.1
#=GS B4Z233_HBV/2-41      AC B4Z233.1
#=GS A0A857_HBV/31-214    AC A0A857.1
#=GS D0EYW0_HBV/2-157     AC D0EYW0.1
#=GS D6QVY3_HBV/2-183     AC D6QVY3.1
#=GS G1E868_HBV/31-212    AC G1E868.1
#=GS D3YGR3_HBV/2-183     AC D3YGR3.1
#=GS G9G8M4_HBV/31-212    AC G9G8M4.1
#=GS I0DG27_HBV/31-212    AC I0DG27.1
#=GS B2Y6K1_HBV/2-183     AC B2Y6K1.1
#=GS CAPSD_WHV5/2-188     AC P69711.1
#=GS D0UDY5_HBV/31-212    AC D0UDY5.1
#=GS D3YG08_HBV/2-183     AC D3YG08.1
#=GS B4Z434_HBV/2-39      AC B4Z434.1
#=GS B4Z1W1_HBV/31-70     AC B4Z1W1.1
#=GS E0ZP04_HBV/2-110     AC E0ZP04.1
#=GS Q6J309_HBV/31-214    AC Q6J309.1
#=GS D4HMX6_HBV/1-78      AC D4HMX6.1
#=GS D3J674_HBV/31-67     AC D3J674.1
#=GS B4Z4M6_HBV/31-70     AC B4Z4M6.1
#=GS B3VB91_HBV/2-183     AC B3VB91.1
#=GS CAPSD_HBVD5/2-183    AC P0C680.1
#=GS C7DY87_HBV/2-183     AC C7DY87.1
#=GS D3J5U3_HBV/31-89     AC D3J5U3.1
#=GS O11884_HBV/31-212    AC O11884.1
#=GS B9VKV0_HBV/2-183     AC B9VKV0.1
#=GS B3VAW7_HBV/2-183     AC B3VAW7.1
#=GS D3J6D7_HBV/31-70     AC D3J6D7.1
#=GS D0UE42_HBV/31-212    AC D0UE42.1
#=GS E0ZRZ0_HBV/2-183     AC E0ZRZ0.1
#=GS G1ETT7_HBV/31-212    AC G1ETT7.1
#=GS H3K3F6_HBV/31-214    AC H3K3F6.1
#=GS A1KR46_HBV/2-25      AC A1KR46.1
#=GS A5GZI3_HBV/2-183     AC A5GZI3.1
#=GS C4P1T9_HBV/31-76     AC C4P1T9.1
#=GS D5LF37_HBV/31-212    AC D5LF37.1
#=GS Q3LTX2_HBV/31-212    AC Q3LTX2.1
#=GS Q7T7W1_HBV/31-214    AC Q7T7W1.1
#=GS B3IWV8_HBV/31-212    AC B3IWV8.1
#=GS C4P150_HBV/31-76     AC C4P150.1
#=GS D3TJC8_HBV/2-183     AC D3TJC8.1
#=GS Q00K65_HBV/2-183     AC Q00K65.1
#=GS C7AYP8_HBV/31-214    AC C7AYP8.1
#=GS B0FCB5_HBV/105-183   AC B0FCB5.1
#=GS D3J5Z8_HBV/31-79     AC D3J5Z8.1
#=GS B3VAM0_HBV/2-183     AC B3VAM0.1
#=GS Q2L5A3_HBV/2-20      AC Q2L5A3.1
#=GS C7DNB4_HBV/2-183     AC C7DNB4.1
#=GS B4X6I4_HBV/31-87     AC B4X6I4.1
#=GS B5M533_HBV/31-212    AC B5M533.1
#=GS H2ER89_HBV/2-183     AC H2ER89.1
#=GS C4P102_HBV/31-76     AC C4P102.1
#=GS Q2L4P5_HBV/2-183     AC Q2L4P5.1
#=GS B4Z3P2_HBV/2-39      AC B4Z3P2.1
#=GS Q8QSC4_HBV/31-212    AC Q8QSC4.1
#=GS B4Z248_HBV/31-67     AC B4Z248.1
#=GS Q2TJF2_HBV/31-212    AC Q2TJF2.1
#=GS B4Z3U3_HBV/2-39      AC B4Z3U3.1
#=GS H9BMQ4_HBV/2-121     AC H9BMQ4.1
#=GS G0Z2V7_HBV/2-121     AC G0Z2V7.1
#=GS G9G8L1_HBV/2-183     AC G9G8L1.1
#=GS D0U3Y9_HBV/31-214    AC D0U3Y9.1
#=GS Q762E8_HBV/31-212    AC Q762E8.1
#=GS Q5J2R4_HBV/2-183     AC Q5J2R4.1
#=GS Q6UE57_HBV/2-183     AC Q6UE57.1
#=GS D3TJZ5_HBV/31-212    AC D3TJZ5.1
#=GS G1E7Z3_HBV/2-183     AC G1E7Z3.1
#=GS C0LKA1_HBV/2-183     AC C0LKA1.1
#=GS Q1MSN1_HBV/31-173    AC Q1MSN1.1
#=GS B6CIV5_HBV/31-213    AC B6CIV5.1
#=GS B0FC58_HBV/2-183     AC B0FC58.1
#=GS B4Z1Z1_HBV/31-70     AC B4Z1Z1.1
#=GS Q9QAG1_HBV/2-183     AC Q9QAG1.1
#=GS G1E7G3_HBV/31-212    AC G1E7G3.1
#=GS C4P1Q0_HBV/31-76     AC C4P1Q0.1
#=GS A1KR37_HBV/2-25      AC A1KR37.1
#=GS D0EEE4_HBV/31-214    AC D0EEE4.1
#=GS C4P1B5_HBV/31-76     AC C4P1B5.1
#=GS Q68RR0_HBV/2-183     AC Q68RR0.1
#=GS B6D6F5_HBV/31-93     AC B6D6F5.1
#=GS Q80AH7_HBV/2-183     AC Q80AH7.1
#=GS Q80JA5_HBV/31-212    AC Q80JA5.1
#=GS Q6TYF2_HBV/31-182    AC Q6TYF2.1
#=GS Q6RSF3_9HEPA/2-262   AC Q6RSF3.1
#=GS D6QW04_HBV/2-183     AC D6QW04.1
#=GS A7M683_HBV/2-183     AC A7M683.1
#=GS B4Z3D0_HBV/2-37      AC B4Z3D0.1
#=GS A8J471_HBV/31-212    AC A8J471.1
#=GS B7TTP4_HBV/2-183     AC B7TTP4.1
#=GS G0Z2V4_HBV/2-121     AC G0Z2V4.1
#=GS I0DG77_HBV/31-212    AC I0DG77.1
#=GS Q60GX2_HBV/31-71     AC Q60GX2.1
#=GS Q7TEE2_HBV/31-163    AC Q7TEE2.1
#=GS D8VBM0_HBV/2-51      AC D8VBM0.1
#=GS C1KT86_HBV/31-210    AC C1KT86.1
#=GS Q6I6P8_HBV/31-74     AC Q6I6P8.1
#=GS C1KT97_HBV/31-210    AC C1KT97.1
#=GS G8H3F4_HBV/2-131     AC G8H3F4.1
#=GS D0UEB8_HBV/31-212    AC D0UEB8.1
#=GS D3J661_HBV/31-77     AC D3J661.1
#=GS D2U644_HBV/2-183     AC D2U644.1
#=GS G9G8S3_HBV/2-183     AC G9G8S3.1
#=GS B5B4D1_HBV/31-212    AC B5B4D1.1
#=GS Q2LCA9_HBV/2-183     AC Q2LCA9.1
#=GS A0FDK7_HBV/31-212    AC A0FDK7.1
#=GS B8PTE3_HBV/31-212    AC B8PTE3.1
#=GS A7L804_HBV/1-73      AC A7L804.1
#=GS D3J5V2_HBV/31-89     AC D3J5V2.1
#=GS Q68083_HBV/2-183     AC Q68083.1
#=GS E3Q0I0_HBV/31-212    AC E3Q0I0.1
#=GS B5U736_HBV/31-212    AC B5U736.1
#=GS B7TV98_HBV/31-212    AC B7TV98.1
#=GS Q60GZ4_HBV/31-71     AC Q60GZ4.1
#=GS B4Z2F3_HBV/2-37      AC B4Z2F3.1
#=GS G3XLB7_HBV/2-183     AC G3XLB7.1
#=GS B6D6B8_HBV/31-208    AC B6D6B8.1
#=GS B9VKJ8_HBV/31-212    AC B9VKJ8.1
#=GS D8VBA8_HBV/31-80     AC D8VBA8.1
#=GS Q76QX2_HBV/2-183     AC Q76QX2.1
#=GS H9BMR9_HBV/2-46      AC H9BMR9.1
#=GS Q69615_HBV/2-183     AC Q69615.1
#=GS Q9E0V3_HBV/2-123     AC Q9E0V3.1
#=GS B5BPH2_HBV/31-212    AC B5BPH2.1
#=GS C4P103_HBV/31-76     AC C4P103.1
#=GS C4P1K1_HBV/31-76     AC C4P1K1.1
#=GS B4Z472_HBV/31-68     AC B4Z472.1
#=GS D3YGE8_HBV/2-183     AC D3YGE8.1
#=GS D3J6G8_HBV/31-70     AC D3J6G8.1
#=GS A5GZP1_HBV/31-212    AC A5GZP1.1
#=GS Q9DWN8_HBV/2-183     AC Q9DWN8.1
#=GS B2LRT4_HBV/31-212    AC B2LRT4.1
#=GS D0EEQ7_HBV/2-185     AC D0EEQ7.1
#=GS Q8QP21_HBV/1-130     AC Q8QP21.1
#=GS D8VBH9_HBV/31-76     AC D8VBH9.1
#=GS Q89437_HBV/2-183     AC Q89437.1
#=GS D3J671_HBV/31-68     AC D3J671.1
#=GS G0Z2U9_HBV/2-121     AC G0Z2U9.1
#=GS G0Z2X7_HBV/2-121     AC G0Z2X7.1
#=GS Q91A78_HBV/31-66     AC Q91A78.1
#=GS O91571_HBV/31-73     AC O91571.1
#=GS Q7TEC6_HBV/31-163    AC Q7TEC6.1
#=GS Q4FDK7_HBV/31-212    AC Q4FDK7.1
#=GS B4Z2J9_HBV/31-70     AC B4Z2J9.1
#=GS B4Z384_HBV/2-37      AC B4Z384.1
#=GS D3TIK9_HBV/2-183     AC D3TIK9.1
#=GS B5BUS4_HBV/31-214    AC B5BUS4.1
#=GS C4P1L0_HBV/31-76     AC C4P1L0.1
#=GS B4X6K2_HBV/31-88     AC B4X6K2.1
#=GS B5M579_HBV/31-212    AC B5M579.1
#=GS B2CZH5_HBV/2-183     AC B2CZH5.1
#=GS C7DQQ5_HBV/2-183     AC C7DQQ5.1
#=GS D3TII7_HBV/2-183     AC D3TII7.1
#=GS Q8VBK4_HBV/2-183     AC Q8VBK4.1
#=GS B5LIK1_HBV/30-190    AC B5LIK1.1
#=GS H9BMU5_HBV/2-168     AC H9BMU5.1
#=GS D8VBV9_HBV/31-62     AC D8VBV9.1
#=GS B5TXP9_HBV/2-183     AC B5TXP9.1
#=GS B4Z2K6_HBV/2-41      AC B4Z2K6.1
#=GS B9W3Z0_HBV/2-185     AC B9W3Z0.1
#=GS Q6UE66_HBV/2-183     AC Q6UE66.1
#=GS C0LK99_HBV/2-183     AC C0LK99.1
#=GS C9W223_HBV/2-183     AC C9W223.1
#=GS B0FCQ6_HBV/31-212    AC B0FCQ6.1
#=GS B4Z1V8_HBV/31-70     AC B4Z1V8.1
#=GS C4P152_HBV/31-76     AC C4P152.1
#=GS B3VB54_HBV/2-183     AC B3VB54.1
#=GS E3Q0J4_HBV/2-183     AC E3Q0J4.1
#=GS Q8JMY8_HBV/31-212    AC Q8JMY8.1
#=GS B4Z2L9_HBV/31-70     AC B4Z2L9.1
#=GS C1KTC2_HBV/31-212    AC C1KTC2.1
#=GS D8VBY4_HBV/2-51      AC D8VBY4.1
#=GS B5B4K6_HBV/2-183     AC B5B4K6.1
#=GS A7L361_HBV/2-161     AC A7L361.1
#=GS C1K1Z9_HBV/2-183     AC C1K1Z9.1
#=GS D0EEB2_HBV/2-185     AC D0EEB2.1
#=GS A9PLD5_HBV/1-39      AC A9PLD5.1
#=GS D3J651_HBV/31-89     AC D3J651.1
#=GS B4Z3E5_HBV/2-42      AC B4Z3E5.1
#=GS B1ABQ6_HBV/31-212    AC B1ABQ6.1
#=GS H6V8B9_HBV/31-56     AC H6V8B9.1
#=GS D3J6F6_HBV/31-67     AC D3J6F6.1
#=GS D6P597_HBV/2-183     AC D6P597.1
#=GS C4P1P4_HBV/31-76     AC C4P1P4.1
#=GS D8VBT3_HBV/31-76     AC D8VBT3.1
#=GS H6UGR1_HBV/2-183     AC H6UGR1.1
#=GS D8VCI7_HBV/31-66     AC D8VCI7.1
#=GS B5M676_HBV/31-212    AC B5M676.1
#=GS Q4FD88_HBV/31-212    AC Q4FD88.1
#=GS B4Z1N2_HBV/31-71     AC B4Z1N2.1
#=GS D8VBQ2_HBV/2-179     AC D8VBQ2.1
#=GS Q5G3E8_HBV/2-25      AC Q5G3E8.1
#=GS B3VAY4_HBV/2-183     AC B3VAY4.1
#=GS E0ZN83_HBV/2-153     AC E0ZN83.1
#=GS C7AY82_HBV/31-214    AC C7AY82.1
#=GS Q7THT3_HBV/2-183     AC Q7THT3.1
#=GS Q2EGD2_HBV/31-99     AC Q2EGD2.1
#=GS H6V5K3_HBV/2-183     AC H6V5K3.1
#=GS D7R758_HBV/2-183     AC D7R758.1
#=GS H2ER76_HBV/2-183     AC H2ER76.1
#=GS B4Z206_HBV/31-70     AC B4Z206.1
#=GS B4Z4V3_HBV/2-41      AC B4Z4V3.1
#=GS Q1MSM5_HBV/31-173    AC Q1MSM5.1
#=GS D3YGH2_HBV/2-183     AC D3YGH2.1
#=GS B4Z488_HBV/2-39      AC B4Z488.1
#=GS Q89597_HBV/31-212    AC Q89597.1
#=GS B3VAU8_HBV/2-183     AC B3VAU8.1
#=GS H2ERA9_HBV/2-183     AC H2ERA9.1
#=GS Q9ELT5_HBV/31-152    AC Q9ELT5.1
#=GS Q60H04_HBV/31-71     AC Q60H04.1
#=GS B4Z338_HBV/31-66     AC B4Z338.1
#=GS Q91EI8_HBV/31-214    AC Q91EI8.1
#=GS Q09KT4_HBV/2-20      AC Q09KT4.1
#=GS C7DN54_HBV/2-183     AC C7DN54.1
#=GS B5TXY7_HBV/2-183     AC B5TXY7.1
#=GS Q68030_HBV/31-212    AC Q68030.1
#=GS D2JMS7_HBV/2-183     AC D2JMS7.1
#=GS H9BMT4_HBV/27-182    AC H9BMT4.1
#=GS D8VBR4_HBV/2-51      AC D8VBR4.1
#=GS Q68012_HBV/31-212    AC Q68012.1
#=GS G1E855_HBV/2-183     AC G1E855.1
#=GS CAPSD_HBVG3/14-195   AC P0C682.1
#=GS D3J6C1_HBV/28-69     AC D3J6C1.1
#=GS C4P1F6_HBV/31-76     AC C4P1F6.1
#=GS Q45F15_HBV/2-183     AC Q45F15.1
#=GS D3J600_HBV/31-76     AC D3J600.1
#=GS B0YGK5_HBV/31-212    AC B0YGK5.1
#=GS F5C1F7_HBV/43-224    AC F5C1F7.1
#=GS B7TTN9_HBV/2-183     AC B7TTN9.1
#=GS Q6UE55_HBV/31-212    AC Q6UE55.1
#=GS B4X6J4_HBV/31-87     AC B4X6J4.1
#=GS B4Z5V0_HBV/2-42      AC B4Z5V0.1
#=GS B7TUL5_HBV/31-212    AC B7TUL5.1
#=GS C0LKD7_HBV/2-183     AC C0LKD7.1
#=GS C4P1J4_HBV/31-76     AC C4P1J4.1
#=GS D0EE21_HBV/2-185     AC D0EE21.1
#=GS D3J616_HBV/31-88     AC D3J616.1
#=GS I0DG67_HBV/31-212    AC I0DG67.1
#=GS D3J6F7_HBV/31-68     AC D3J6F7.1
#=GS D8VCA5_HBV/31-65     AC D8VCA5.1
#=GS E0ZP37_HBV/2-110     AC E0ZP37.1
#=GS Q805N2_HBV/2-183     AC Q805N2.1
#=GS B6VA72_HBV/2-183     AC B6VA72.1
#=GS Q5G3G8_HBV/2-25      AC Q5G3G8.1
#=GS I0DG47_HBV/31-212    AC I0DG47.1
#=GS C4P141_HBV/31-76     AC C4P141.1
#=GS D2U624_HBV/2-183     AC D2U624.1
#=GS H1ACX9_HBV/2-183     AC H1ACX9.1
#=GS D3J654_HBV/31-84     AC D3J654.1
#=GS C1KT92_HBV/31-212    AC C1KT92.1
#=GS Q9E0T7_HBV/2-123     AC Q9E0T7.1
#=GS B2WSP3_HBV/31-212    AC B2WSP3.1
#=GS G9G8T5_HBV/2-183     AC G9G8T5.1
#=GS C4P1T8_HBV/31-76     AC C4P1T8.1
#=GS Q91S82_HBV/31-210    AC Q91S82.1
#=GS Q769K6_HBV/31-212    AC Q769K6.1
#=GS Q8QSB2_HBV/31-212    AC Q8QSB2.1
#=GS Q910K2_HBV/31-212    AC Q910K2.1
#=GS Q81152_HBV/31-111    AC Q81152.1
#=GS B4Z2R6_HBV/2-41      AC B4Z2R6.1
#=GS B4Z3Y1_HBV/2-39      AC B4Z3Y1.1
#=GS B4Z6B5_HBV/2-41      AC B4Z6B5.1
#=GS D3J5T9_HBV/31-88     AC D3J5T9.1
#=GS Q5DVZ9_HBV/31-212    AC Q5DVZ9.1
#=GS D0UEB9_HBV/2-183     AC D0UEB9.1
#=GS B5M5J3_HBV/31-212    AC B5M5J3.1
#=GS C9WDQ9_HBV/2-183     AC C9WDQ9.1
#=GS B4Z5Z8_HBV/2-42      AC B4Z5Z8.1
#=GS Q9QB12_HBV/2-183     AC Q9QB12.1
#=GS H9BMV2_HBV/25-191    AC H9BMV2.1
#=GS A9PLI3_HBV/1-44      AC A9PLI3.1
#=GS C1KTB3_HBV/31-210    AC C1KTB3.1
#=GS A9PLF4_HBV/1-39      AC A9PLF4.1
#=GS Q9W8R3_9HEPA/2-262   AC Q9W8R3.1
#=GS B5B4E8_HBV/31-114    AC B5B4E8.1
#=GS C4P1C0_HBV/31-76     AC C4P1C0.1
#=GS H6UGJ0_HBV/2-183     AC H6UGJ0.1
#=GS D6QVH5_HBV/2-183     AC D6QVH5.1
#=GS Q765D5_HBV/31-214    AC Q765D5.1
#=GS B4Z3U4_HBV/31-68     AC B4Z3U4.1
#=GS B4Z627_HBV/2-41      AC B4Z627.1
#=GS Q6UE54_HBV/2-183     AC Q6UE54.1
#=GS B3VB35_HBV/2-183     AC B3VB35.1
#=GS H6V8C5_HBV/31-56     AC H6V8C5.1
#=GS B0FCH8_HBV/2-183     AC B0FCH8.1
#=GS Q5G3A2_HBV/31-54     AC Q5G3A2.1
#=GS C3W4D5_HBV/31-214    AC C3W4D5.1
#=GS B5B4M8_HBV/31-212    AC B5B4M8.1
#=GS Q60H17_HBV/31-71     AC Q60H17.1
#=GS D3J6A3_HBV/31-70     AC D3J6A3.1
#=GS D8VBL2_HBV/31-80     AC D8VBL2.1
#=GS B0FD51_HBV/31-212    AC B0FD51.1
#=GS Q80H31_HBV/2-183     AC Q80H31.1
#=GS D8VBS2_HBV/2-36      AC D8VBS2.1
#=GS D3J6A2_HBV/31-70     AC D3J6A2.1
#=GS Q8BCB0_HBV/31-214    AC Q8BCB0.1
#=GS B4Z412_HBV/31-68     AC B4Z412.1
#=GS E0ZNF5_HBV/31-182    AC E0ZNF5.1
#=GS Q2EGH4_HBV/31-62     AC Q2EGH4.1
#=GS B4Z2Q0_HBV/31-70     AC B4Z2Q0.1
#=GS C4P186_HBV/31-76     AC C4P186.1
#=GS E5CZ05_HBV/31-212    AC E5CZ05.1
#=GS C3W3R1_HBV/2-183     AC C3W3R1.1
#=GS H6V8C3_HBV/31-56     AC H6V8C3.1
#=GS B4Z1W5_HBV/31-70     AC B4Z1W5.1
#=GS D8VBW0_HBV/2-33      AC D8VBW0.1
#=GS Q45F27_HBV/31-212    AC Q45F27.1
#=GS E0ZNU7_HBV/2-110     AC E0ZNU7.1
#=GS B0FCZ6_HBV/31-212    AC B0FCZ6.1
#=GS D3J682_HBV/31-68     AC D3J682.1
#=GS Q80H02_HBV/2-183     AC Q80H02.1
#=GS Q8VBK0_HBV/2-183     AC Q8VBK0.1
#=GS D3J699_HBV/31-70     AC D3J699.1
#=GS Q60GU7_HBV/31-71     AC Q60GU7.1
#=GS Q3LTZ4_HBV/31-212    AC Q3LTZ4.1
#=GS D6P5B8_HBV/2-183     AC D6P5B8.1
#=GS B5ASV1_HBV/31-212    AC B5ASV1.1
#=GS G0Z2X9_HBV/2-121     AC G0Z2X9.1
#=GS B4Z618_HBV/2-41      AC B4Z618.1
#=GS B4Z2P7_HBV/31-70     AC B4Z2P7.1
#=GS Q6XEB6_HBV/2-183     AC Q6XEB6.1
#=GS D0EDS8_HBV/2-183     AC D0EDS8.1
#=GS C7DMV1_HBV/31-212    AC C7DMV1.1
#=GS D3XGF2_HBV/2-183     AC D3XGF2.1
#=GS Q9E0S1_HBV/2-123     AC Q9E0S1.1
#=GS B4Z609_HBV/31-70     AC B4Z609.1
#=GS B0FD72_HBV/31-212    AC B0FD72.1
#=GS Q60GY8_HBV/31-71     AC Q60GY8.1
#=GS B0YK63_HBV/31-212    AC B0YK63.1
#=GS B4Z1Q1_HBV/2-42      AC B4Z1Q1.1
#=GS Q2L580_HBV/2-20      AC Q2L580.1
#=GS B3VB23_HBV/2-183     AC B3VB23.1
#=GS Q77BH1_HBV/1-96      AC Q77BH1.1
#=GS D3J5S0_HBV/31-57     AC D3J5S0.1
#=GS B4Z403_HBV/31-68     AC B4Z403.1
#=GS D8VBQ7_HBV/31-80     AC D8VBQ7.1
#=GS E3Q0N3_HBV/2-183     AC E3Q0N3.1
#=GS D8VBM3_HBV/2-183     AC D8VBM3.1
#=GS O12394_HBV/2-181     AC O12394.1
#=GS D8V9U0_HBV/31-70     AC D8V9U0.1
#=GS Q9WP78_HBV/31-107    AC Q9WP78.1
#=GS D2JMA9_HBV/31-212    AC D2JMA9.1
#=GS A6MGC7_HBV/2-183     AC A6MGC7.1
#=GS Q6TYH4_HBV/31-182    AC Q6TYH4.1
#=GS D5LDY4_HBV/31-212    AC D5LDY4.1
#=GS B4Z1X9_HBV/31-70     AC B4Z1X9.1
#=GS Q9QB21_HBV/2-183     AC Q9QB21.1
#=GS Q91SY0_HBV/31-212    AC Q91SY0.1
#=GS D3J5V8_HBV/31-73     AC D3J5V8.1
#=GS C9WDB8_HBV/2-183     AC C9WDB8.1
#=GS E5D5N3_HBV/1-174     AC E5D5N3.1
#=GS C3W414_HBV/2-183     AC C3W414.1
#=GS Q2L588_HBV/2-20      AC Q2L588.1
#=GS Q1MSM0_HBV/31-173    AC Q1MSM0.1
#=GS G1C944_HBV/2-183     AC G1C944.1
#=GS C7DMQ0_HBV/2-183     AC C7DMQ0.1
#=GS D3J5T7_HBV/31-89     AC D3J5T7.1
#=GS B4Z3Z6_HBV/2-39      AC B4Z3Z6.1
#=GS D8VC04_HBV/31-78     AC D8VC04.1
#=GS B5TY00_HBV/31-212    AC B5TY00.1
#=GS B6ULL2_HBV/31-202    AC B6ULL2.1
#=GS D3J5U9_HBV/31-88     AC D3J5U9.1
#=GS Q910F2_HBV/31-214    AC Q910F2.1
#=GS H6UNC7_HBV/2-183     AC H6UNC7.1
#=GS Q9E0T3_HBV/2-123     AC Q9E0T3.1
#=GS I0DG60_HBV/31-212    AC I0DG60.1
#=GS Q2L5A9_HBV/2-20      AC Q2L5A9.1
#=GS C4P1G4_HBV/31-76     AC C4P1G4.1
#=GS B4Z1R9_HBV/31-79     AC B4Z1R9.1
#=GS B4Z2U9_HBV/2-41      AC B4Z2U9.1
#=GS Q8AZ62_HBV/2-181     AC Q8AZ62.1
#=GS D0UDX1_HBV/31-108    AC D0UDX1.1
#=GS Q2L5B0_HBV/2-20      AC Q2L5B0.1
#=GS A7J8L1_HBV/2-185     AC A7J8L1.1
#=GS CAPSD_HBVB8/2-183    AC P0C677.1
#=GS Q1MSS0_HBV/31-173    AC Q1MSS0.1
#=GS G1EIG9_HBV/2-153     AC G1EIG9.1
#=GS F5C051_HBV/31-53     AC F5C051.1
#=GS C4P153_HBV/31-76     AC C4P153.1
#=GS H6V887_HBV/31-56     AC H6V887.1
#=GS Q80GU7_HBV/2-183     AC Q80GU7.1
#=GS D6QVM6_HBV/2-183     AC D6QVM6.1
#=GS C4P100_HBV/31-76     AC C4P100.1
#=GS D8VC90_HBV/2-37      AC D8VC90.1
#=GS Q2EGH8_HBV/31-99     AC Q2EGH8.1
#=GS I0DG70_HBV/28-209    AC I0DG70.1
#=GS E0ZP39_HBV/2-31      AC E0ZP39.1
#=GS H9BMQ5_HBV/31-150    AC H9BMQ5.1
#=GS D2JMK8_HBV/2-183     AC D2JMK8.1
#=GS B7TUZ5_HBV/2-183     AC B7TUZ5.1
#=GS Q2L5F0_HBV/2-24      AC Q2L5F0.1
#=GS D8VC35_HBV/2-48      AC D8VC35.1
#=GS F2X0J9_HBV/17-198    AC F2X0J9.1
#=GS C3W456_HBV/2-183     AC C3W456.1
#=GS Q60GZ8_HBV/2-42      AC Q60GZ8.1
#=GS D7NL53_HBV/31-212    AC D7NL53.1
#=GS B4Z1G2_HBV/31-69     AC B4Z1G2.1
#=GS Q2EGF0_HBV/31-99     AC Q2EGF0.1
#=GS G3E558_HBV/2-183     AC G3E558.1
#=GS B4Z613_HBV/2-41      AC B4Z613.1
#=GS Q6I6Q4_HBV/31-74     AC Q6I6Q4.1
#=GS F5C047_HBV/31-53     AC F5C047.1
#=GS Q2L5E7_HBV/2-24      AC Q2L5E7.1
#=GS B6D6C7_HBV/2-113     AC B6D6C7.1
#=GS D5LCH1_HBV/31-212    AC D5LCH1.1
#=GS Q9WMD3_HBV/31-212    AC Q9WMD3.1
#=GS D9U5C3_HBV/2-183     AC D9U5C3.1
#=GS B0B2P9_HBV/31-212    AC B0B2P9.1
#=GS D2JMG4_HBV/2-183     AC D2JMG4.1
#=GS F5C067_HBV/2-183     AC F5C067.1
#=GS C4P1F5_HBV/31-76     AC C4P1F5.1
#=GS G0Z2V5_HBV/2-121     AC G0Z2V5.1
#=GS C3V8M2_HBV/74-151    AC C3V8M2.1
#=GS D3J5L6_HBV/31-57     AC D3J5L6.1
#=GS D0EED1_HBV/2-185     AC D0EED1.1
#=GS B4Z3Q0_HBV/31-68     AC B4Z3Q0.1
#=GS Q81148_HBV/2-82      AC Q81148.1
#=GS C0LKH5_HBV/2-183     AC C0LKH5.1
#=GS G3XLC4_HBV/2-183     AC G3XLC4.1
#=GS Q8JMZ8_HBV/31-198    AC Q8JMZ8.1
#=GS D2JMQ5_HBV/2-183     AC D2JMQ5.1
#=GS D4I4T9_HBV/2-185     AC D4I4T9.1
#=GS E0ZRD9_HBV/31-212    AC E0ZRD9.1
#=GS Q8VBJ2_HBV/2-185     AC Q8VBJ2.1
#=GS Q9WJE8_HBV/31-212    AC Q9WJE8.1
#=GS E7CU92_HBV/31-212    AC E7CU92.1
#=GS B7TUI2_HBV/2-183     AC B7TUI2.1
#=GS Q2L5H6_HBV/2-24      AC Q2L5H6.1
#=GS D3J655_HBV/31-89     AC D3J655.1
#=GS B5M5D9_HBV/31-212    AC B5M5D9.1
#=GS D3J5R9_HBV/31-57     AC D3J5R9.1
#=GS B4Z4M5_HBV/2-41      AC B4Z4M5.1
#=GS D3YGJ7_HBV/2-183     AC D3YGJ7.1
#=GS G9G9B6_HBV/31-212    AC G9G9B6.1
#=GS A5LG77_HBV/2-183     AC A5LG77.1
#=GS E9L2M4_HBV/31-214    AC E9L2M4.1
#=GS G0Z2Y4_HBV/2-121     AC G0Z2Y4.1
#=GS B4Z392_HBV/31-66     AC B4Z392.1
#=GS D3G6Y0_HBV/2-183     AC D3G6Y0.1
#=GS C0LKI9_HBV/2-183     AC C0LKI9.1
#=GS D3TKC2_HBV/2-183     AC D3TKC2.1
#=GS G1E7V0_HBV/2-183     AC G1E7V0.1
#=GS Q8VBH4_HBV/2-185     AC Q8VBH4.1
#=GS D8VCD8_HBV/2-37      AC D8VCD8.1
#=GS Q1JUR1_HBV/31-212    AC Q1JUR1.1
#=GS Q60GX3_HBV/31-71     AC Q60GX3.1
#=GS Q67993_HBV/2-183     AC Q67993.1
#=GS CAPSD_HHBV/2-262     AC P0C6K0.1
#=GS B5M527_HBV/31-212    AC B5M527.1
#=GS B4Z348_HBV/2-37      AC B4Z348.1
#=GS B5BPY1_HBV/2-183     AC B5BPY1.1
#=GS D5LE25_HBV/31-212    AC D5LE25.1
#=GS G8H3F8_HBV/2-131     AC G8H3F8.1
#=GS Q5U7P9_HBV/31-212    AC Q5U7P9.1
#=GS Q7TED2_HBV/31-163    AC Q7TED2.1
#=GS H9BMT5_HBV/2-157     AC H9BMT5.1
#=GS B4Z4Q6_HBV/31-70     AC B4Z4Q6.1
#=GS Q77BG4_HBV/1-96      AC Q77BG4.1
#=GS B6D686_HBV/2-77      AC B6D686.1
#=GS Q6I6P6_HBV/31-74     AC Q6I6P6.1
#=GS C9W1Y0_HBV/31-212    AC C9W1Y0.1
#=GS Q6RSE3_9HEPA/2-262   AC Q6RSE3.1
#=GS D3J5Q1_HBV/31-57     AC D3J5Q1.1
#=GS Q77QZ2_HBVB5/2-183   AC Q77QZ2.1
#=GS Q1MSM3_HBV/31-173    AC Q1MSM3.1
#=GS HBEAG_HBVC2/31-212   AC Q9WMB7.1
#=GS B4Z4U0_HBV/31-70     AC B4Z4U0.1
#=GS D3J5S1_HBV/31-57     AC D3J5S1.1
#=GS C3W468_HBV/31-212    AC C3W468.1
#=GS C0LK97_HBV/2-183     AC C0LK97.1
#=GS B4Z1F8_HBV/2-40      AC B4Z1F8.1
#=GS Q9WP69_HBV/31-206    AC Q9WP69.1
#=GS B4Z209_HBV/31-70     AC B4Z209.1
#=GS B4Z4S2_HBV/31-70     AC B4Z4S2.1
#=GS D2JMZ3_HBV/2-183     AC D2JMZ3.1
#=GS G1E7P5_HBV/2-183     AC G1E7P5.1
#=GS H3K3F7_HBV/2-185     AC H3K3F7.1
#=GS D2JMG3_HBV/31-212    AC D2JMG3.1
#=GS I0DG66_HBV/31-212    AC I0DG66.1
#=GS B4Z4M2_HBV/2-41      AC B4Z4M2.1
#=GS B5M586_HBV/31-212    AC B5M586.1
#=GS G9G9A2_HBV/31-212    AC G9G9A2.1
#=GS G9MD67_HBV/2-183     AC G9MD67.1
#=GS D3J5P6_HBV/31-57     AC D3J5P6.1
#=GS Q67966_HBV/2-183     AC Q67966.1
#=GS D0UDY0_HBV/31-212    AC D0UDY0.1
#=GS Q9IF28_HBV/31-212    AC Q9IF28.1
#=GS H6V5J1_HBV/2-183     AC H6V5J1.1
#=GS Q9E0R9_HBV/2-123     AC Q9E0R9.1
#=GS C6L4A5_HBV/13-141    AC C6L4A5.1
#=GS B7TUH5_HBV/2-183     AC B7TUH5.1
#=GS C0LKJ6_HBV/2-183     AC C0LKJ6.1
#=GS D9U5L9_HBV/2-183     AC D9U5L9.1
#=GS Q2L5F9_HBV/2-24      AC Q2L5F9.1
#=GS E5D5N8_HBV/1-174     AC E5D5N8.1
#=GS Q60GV6_HBV/31-71     AC Q60GV6.1
#=GS H9BMW9_HBV/26-179    AC H9BMW9.1
#=GS H6UNB9_HBV/2-183     AC H6UNB9.1
#=GS Q1MSP6_HBV/31-173    AC Q1MSP6.1
#=GS B5TXS3_HBV/31-212    AC B5TXS3.1
#=GS D0EEB1_HBV/31-214    AC D0EEB1.1
#=GS Q8VBH3_HBV/2-183     AC Q8VBH3.1
#=GS C4P179_HBV/31-76     AC C4P179.1
#=GS D8VBN9_HBV/31-80     AC D8VBN9.1
#=GS B4Z3E2_HBV/2-42      AC B4Z3E2.1
#=GS Q1MSS4_HBV/31-123    AC Q1MSS4.1
#=GS CAPSD_HBVB4/2-183    AC P17392.1
#=GS Q7TDR9_HBV/2-183     AC Q7TDR9.1
#=GS B4Z3C4_HBV/2-37      AC B4Z3C4.1
#=GS C4P124_HBV/31-76     AC C4P124.1
#=GS B2LWB7_HBV/31-212    AC B2LWB7.1
#=GS D8VC58_HBV/31-80     AC D8VC58.1
#=GS A9PLE3_HBV/1-39      AC A9PLE3.1
#=GS E0ZN85_HBV/31-182    AC E0ZN85.1
#=GS B5ATE1_HBV/2-183     AC B5ATE1.1
#=GS B4Z2G9_HBV/2-37      AC B4Z2G9.1
#=GS D0U3Z0_HBV/2-185     AC D0U3Z0.1
#=GS D5LBL9_HBV/2-183     AC D5LBL9.1
#=GS D4I4U7_HBV/2-183     AC D4I4U7.1
#=GS D2U664_HBV/2-183     AC D2U664.1
#=GS Q80GY4_HBV/2-183     AC Q80GY4.1
#=GS Q91HP4_9HEPA/2-262   AC Q91HP4.1
#=GS Q1MST7_HBV/31-173    AC Q1MST7.1
#=GS D3J6E3_HBV/31-70     AC D3J6E3.1
#=GS B4Z2A6_HBV/2-37      AC B4Z2A6.1
#=GS C7DMI4_HBV/2-183     AC C7DMI4.1
#=GS Q2EGG3_HBV/31-99     AC Q2EGG3.1
#=GS C4P197_HBV/31-76     AC C4P197.1
#=GS D3J5N7_HBV/31-57     AC D3J5N7.1
#=GS B4Z2U6_HBV/2-41      AC B4Z2U6.1
#=GS Q9QB10_HBV/2-183     AC Q9QB10.1
#=GS B4Z3J9_HBV/31-68     AC B4Z3J9.1
#=GS Q9E0R1_HBV/31-152    AC Q9E0R1.1
#=GS Q1MSM2_HBV/31-173    AC Q1MSM2.1
#=GS B4Z2U5_HBV/31-70     AC B4Z2U5.1
#=GS B7TU13_HBV/2-183     AC B7TU13.1
#=GS D8VCA3_HBV/2-36      AC D8VCA3.1
#=GS E3Q0L9_HBV/31-212    AC E3Q0L9.1
#=GS B5M5H7_HBV/31-212    AC B5M5H7.1
#=GS E0D398_HBV/31-82     AC E0D398.1
#=GS D3J670_HBV/31-68     AC D3J670.1
#=GS D6P5B2_HBV/31-212    AC D6P5B2.1
#=GS D2JMB9_HBV/31-212    AC D2JMB9.1
#=GS Q8VBF9_HBV/2-183     AC Q8VBF9.1
#=GS B7TV13_HBV/2-183     AC B7TV13.1
#=GS Q8QSC0_HBV/31-212    AC Q8QSC0.1
#=GS D3YFY4_HBV/2-183     AC D3YFY4.1
#=GS Q9QBF8_HBV/31-212    AC Q9QBF8.1
#=GS D5LCB5_HBV/31-212    AC D5LCB5.1
#=GS B4Z5T6_HBV/2-42      AC B4Z5T6.1
#=GS B7TUS9_HBV/31-212    AC B7TUS9.1
#=GS B6ULI0_HBV/31-93     AC B6ULI0.1
#=GS B2CZG9_HBV/2-183     AC B2CZG9.1
#=GS Q9QMM7_HBV/2-183     AC Q9QMM7.1
#=GS B3VAT2_HBV/2-183     AC B3VAT2.1
#=GS B4Z2T4_HBV/2-41      AC B4Z2T4.1
#=GS H6UG69_HBV/2-183     AC H6UG69.1
#=GS H6V5I7_HBV/2-183     AC H6V5I7.1
#=GS Q09KU9_HBV/2-20      AC Q09KU9.1
#=GS Q30BH0_HBV/31-113    AC Q30BH0.1
#=GS B4Z5Y8_HBV/31-71     AC B4Z5Y8.1
#=GS A2A150_HBV/2-183     AC A2A150.1
#=GS D8VBI2_HBV/31-51     AC D8VBI2.1
#=GS E0ZNX7_HBV/2-110     AC E0ZNX7.1
#=GS B6ULL0_HBV/31-212    AC B6ULL0.1
#=GS Q6I6S8_HBV/31-71     AC Q6I6S8.1
#=GS B5AST0_HBV/2-183     AC B5AST0.1
#=GS A9PLE4_HBV/1-39      AC A9PLE4.1
#=GS H6UNE3_HBV/2-183     AC H6UNE3.1
#=GS D8VC69_HBV/31-65     AC D8VC69.1
#=GS H2ER88_HBV/31-212    AC H2ER88.1
#=GS B4Z2N5_HBV/2-41      AC B4Z2N5.1
#=GS Q69376_HBV/1-65      AC Q69376.1
#=GS B5AT84_HBV/2-183     AC B5AT84.1
#=GS B5BPN6_HBV/31-212    AC B5BPN6.1
#=GS D8VBK7_HBV/2-51      AC D8VBK7.1
#=GS B4YLC3_HBV/2-183     AC B4YLC3.1
#=GS Q56J19_HBV/31-212    AC Q56J19.1
#=GS Q8JSX3_HBV/1-130     AC Q8JSX3.1
#=GS B7TV58_HBV/2-183     AC B7TV58.1
#=GS F1AEP3_HBV/2-185     AC F1AEP3.1
#=GS Q1HHA8_HBV/2-183     AC Q1HHA8.1
#=GS C7AY94_HBV/31-214    AC C7AY94.1
#=GS B4Z203_HBV/31-70     AC B4Z203.1
#=GS Q7THR8_HBV/2-183     AC Q7THR8.1
#=GS Q68064_HBV/2-183     AC Q68064.1
#=GS D8VC05_HBV/2-49      AC D8VC05.1
#=GS E0ZP31_HBV/2-110     AC E0ZP31.1
#=GS B3VAM5_HBV/31-212    AC B3VAM5.1
#=GS D7R732_HBV/2-183     AC D7R732.1
#=GS D3J5V9_HBV/31-73     AC D3J5V9.1
#=GS B0FCZ7_HBV/2-183     AC B0FCZ7.1
#=GS Q80AH6_HBV/2-183     AC Q80AH6.1
#=GS B4Z242_HBV/31-70     AC B4Z242.1
#=GS Q91SY8_HBV/31-212    AC Q91SY8.1
#=GS E0ZNG1_HBV/31-171    AC E0ZNG1.1
#=GS B5AT49_HBV/2-183     AC B5AT49.1
#=GS D0PWB1_HBV/1-109     AC D0PWB1.1
#=GS HBEAG_HBVB1/31-212   AC P0C699.1
#=GS E0ZP67_HBV/2-110     AC E0ZP67.1
#=GS C0LKC4_HBV/2-183     AC C0LKC4.1
#=GS D9U552_HBV/2-183     AC D9U552.1
#=GS B1NYA7_HBV/2-150     AC B1NYA7.1
#=GS Q9WP90_HBV/104-180   AC Q9WP90.1
#=GS C4P156_HBV/31-76     AC C4P156.1
#=GS D3J5P8_HBV/31-57     AC D3J5P8.1
#=GS D2U614_HBV/2-183     AC D2U614.1
#=GS B3VB62_HBV/2-183     AC B3VB62.1
#=GS D5LDZ1_HBV/31-212    AC D5LDZ1.1
#=GS H6UGL4_HBV/2-183     AC H6UGL4.1
#=GS C4P192_HBV/31-76     AC C4P192.1
#=GS D0EEC5_HBV/2-185     AC D0EEC5.1
#=GS D7R7X3_9HEPA/2-262   AC D7R7X3.1
#=GS H6V5N5_HBV/2-183     AC H6V5N5.1
#=GS Q7TDQ2_HBV/2-183     AC Q7TDQ2.1
#=GS H6V8B7_HBV/31-56     AC H6V8B7.1
#=GS D3J607_HBV/31-88     AC D3J607.1
#=GS H6V5S9_HBV/2-183     AC H6V5S9.1
#=GS I0DG54_HBV/31-212    AC I0DG54.1
#=GS C4P1S3_HBV/31-71     AC C4P1S3.1
#=GS D3J629_HBV/31-86     AC D3J629.1
#=GS Q507F7_HBV/31-163    AC Q507F7.1
#=GS D3XGD1_HBV/2-183     AC D3XGD1.1
#=GS C7DQQ4_HBV/31-212    AC C7DQQ4.1
#=GS D2JMJ9_HBV/31-212    AC D2JMJ9.1
#=GS B6ULI1_HBV/92-162    AC B6ULI1.1
#=GS D2JN02_HBV/2-183     AC D2JN02.1
#=GS Q67905_HBV/31-193    AC Q67905.1
#=GS C9WDN3_HBV/2-183     AC C9WDN3.1
#=GS C3W444_HBV/2-183     AC C3W444.1
#=GS C4P1K4_HBV/31-76     AC C4P1K4.1
#=GS B4Z3R5_HBV/31-68     AC B4Z3R5.1
#=GS D5LEY8_HBV/31-212    AC D5LEY8.1
#=GS Q8QSB8_HBV/31-212    AC Q8QSB8.1
#=GS E5RN27_HBV/1-162     AC E5RN27.1
#=GS Q80AH1_HBV/2-183     AC Q80AH1.1
#=GS E0ZNZ6_HBV/2-110     AC E0ZNZ6.1
#=GS H1ACV9_HBV/2-183     AC H1ACV9.1
#=GS D6P5B6_HBV/2-79      AC D6P5B6.1
#=GS Q9QB22_HBV/2-183     AC Q9QB22.1
#=GS B4Z1Y9_HBV/2-41      AC B4Z1Y9.1
#=GS H6V5M3_HBV/2-183     AC H6V5M3.1
#=GS B4Z3J6_HBV/31-68     AC B4Z3J6.1
#=GS Q9YJM3_HBV/1-96      AC Q9YJM3.1
#=GS Q7TF63_HBV/31-86     AC Q7TF63.1
#=GS D8VBL9_HBV/31-80     AC D8VBL9.1
#=GS Q6TYI0_HBV/31-182    AC Q6TYI0.1
#=GS D3J5Y3_HBV/31-88     AC D3J5Y3.1
#=GS B5TY10_HBV/2-183     AC B5TY10.1
#=GS Q6I6R0_HBV/31-74     AC Q6I6R0.1
#=GS Q3LTZ3_HBV/2-183     AC Q3LTZ3.1
#=GS D3J637_HBV/31-87     AC D3J637.1
#=GS G1E8I4_HBV/2-183     AC G1E8I4.1
#=GS B4Z4U4_HBV/2-41      AC B4Z4U4.1
#=GS H9BMS4_HBV/1-133     AC H9BMS4.1
#=GS Q77NU2_HBVOR/31-212  AC Q77NU2.1
#=GS Q2L5D0_HBV/2-20      AC Q2L5D0.1
#=GS E0AD07_9HEPA/45-305  AC E0AD07.1
#=GS D8VBE7_HBV/2-25      AC D8VBE7.1
#=GS Q507G4_HBV/31-163    AC Q507G4.1
#=GS G1EIJ6_HBV/2-153     AC G1EIJ6.1
#=GS Q9WP90_HBV/31-106    AC Q9WP90.1
#=GS E0ZP43_HBV/2-25      AC E0ZP43.1
#=GS D3YG02_HBV/2-183     AC D3YG02.1
#=GS Q8QP32_HBV/1-130     AC Q8QP32.1
#=GS Q60GW8_HBV/31-71     AC Q60GW8.1
#=GS D8VC53_HBV/2-49      AC D8VC53.1
#=GS Q9QMN4_HBV/2-183     AC Q9QMN4.1
#=GS Q5Q0S4_HBV/2-183     AC Q5Q0S4.1
#=GS I0DG86_HBV/31-212    AC I0DG86.1
#=GS G1EIF5_HBV/2-183     AC G1EIF5.1
#=GS B4Z3L8_HBV/2-39      AC B4Z3L8.1
#=GS D3J684_HBV/31-69     AC D3J684.1
#=GS Q2LCG1_HBV/2-183     AC Q2LCG1.1
#=GS B4Z6B2_HBV/2-41      AC B4Z6B2.1
#=GS Q6I6T8_HBV/31-71     AC Q6I6T8.1
#=GS H2ER56_HBV/2-183     AC H2ER56.1
#=GS D3J695_HBV/31-70     AC D3J695.1
#=GS Q67973_HBV/2-183     AC Q67973.1
#=GS G4XMC2_HBV/31-212    AC G4XMC2.1
#=GS B3VB58_HBV/2-183     AC B3VB58.1
#=GS D8VB82_HBV/31-80     AC D8VB82.1
#=GS B9VL08_HBV/31-212    AC B9VL08.1
#=GS Q3ZKQ8_HBV/31-214    AC Q3ZKQ8.1
#=GS C4P191_HBV/31-76     AC C4P191.1
#=GS D4HMY5_HBV/1-76      AC D4HMY5.1
#=GS Q2TJF0_HBV/31-212    AC Q2TJF0.1
#=GS C0LKD1_HBV/2-183     AC C0LKD1.1
#=GS B4Z3U5_HBV/2-39      AC B4Z3U5.1
#=GS B4Z1G9_HBV/2-42      AC B4Z1G9.1
#=GS C7DN03_HBV/2-183     AC C7DN03.1
#=GS D8VBD4_HBV/2-51      AC D8VBD4.1
#=GS H6UGK8_HBV/2-183     AC H6UGK8.1
#=GS D6QVT5_HBV/2-183     AC D6QVT5.1
#=GS C4P0Z2_HBV/31-76     AC C4P0Z2.1
#=GS B4Z1E8_HBV/31-69     AC B4Z1E8.1
#=GS Q598Q9_HBV/31-214    AC Q598Q9.1
#=GS E0ZP29_HBV/2-110     AC E0ZP29.1
#=GS B0B351_HBV/2-183     AC B0B351.1
#=GS D9U5N5_HBV/2-181     AC D9U5N5.1
#=GS D8VBT4_HBV/2-47      AC D8VBT4.1
#=GS B4Z4L4_HBV/31-70     AC B4Z4L4.1
#=GS Q8UYA0_HBV/2-183     AC Q8UYA0.1
#=GS C4P1N0_HBV/31-76     AC C4P1N0.1
#=GS Q7TED5_HBV/31-163    AC Q7TED5.1
#=GS Q1MSW1_HBV/31-173    AC Q1MSW1.1
#=GS Q9E9B6_HBV/31-212    AC Q9E9B6.1
#=GS Q67902_HBV/31-195    AC Q67902.1
#=GS F5C043_HBV/31-53     AC F5C043.1
#=GS Q5Q0T4_HBV/2-183     AC Q5Q0T4.1
#=GS B0YK31_HBV/2-185     AC B0YK31.1
#=GS B6CIV0_HBV/31-200    AC B6CIV0.1
#=GS C5WJX7_HBV/2-183     AC C5WJX7.1
#=GS Q9QB08_HBV/2-183     AC Q9QB08.1
#=GS B4ZYX1_HBV/2-183     AC B4ZYX1.1
#=GS D8V9U9_HBV/58-145    AC D8V9U9.1
#=GS B4Z4T2_HBV/2-41      AC B4Z4T2.1
#=GS Q68053_HBV/31-212    AC Q68053.1
#=GS C9W1X3_HBV/31-212    AC C9W1X3.1
#=GS B0B2W5_HBV/2-183     AC B0B2W5.1
#=GS Q8QP35_HBV/1-31      AC Q8QP35.1
#=GS B5B4L9_HBV/2-183     AC B5B4L9.1
#=GS Q80GW0_HBV/2-183     AC Q80GW0.1
#=GS B2WSS8_HBV/31-212    AC B2WSS8.1
#=GS I0DG49_HBV/31-212    AC I0DG49.1
#=GS Q81106_HBV/31-214    AC Q81106.1
#=GS E0ZNF3_HBV/2-153     AC E0ZNF3.1
#=GS F2WSA7_HBV/31-212    AC F2WSA7.1
#=GS D0EE20_HBV/31-214    AC D0EE20.1
#=GS D8VCF7_HBV/31-66     AC D8VCF7.1
#=GS E0ZNS9_HBV/2-110     AC E0ZNS9.1
#=GS Q60GY3_HBV/31-71     AC Q60GY3.1
#=GS D3J619_HBV/31-88     AC D3J619.1
#=GS A9PLH8_HBV/1-39      AC A9PLH8.1
#=GS Q402B5_HBV/31-212    AC Q402B5.1
#=GS Q91SZ8_HBV/31-212    AC Q91SZ8.1
#=GS C4P199_HBV/31-76     AC C4P199.1
#=GS Q8VBI4_HBV/2-183     AC Q8VBI4.1
#=GS B3VB68_HBV/2-183     AC B3VB68.1
#=GS B9VKR2_HBV/31-212    AC B9VKR2.1
#=GS D3J696_HBV/31-70     AC D3J696.1
#=GS D0EYW7_HBV/2-157     AC D0EYW7.1
#=GS E0ZP33_HBV/2-110     AC E0ZP33.1
#=GS D8VCB6_HBV/2-51      AC D8VCB6.1
#=GS CAPSD_HBVA9/2-185    AC P0C698.1
#=GS Q9WIK4_HBV/31-212    AC Q9WIK4.1
#=GS Q60GZ5_HBV/31-71     AC Q60GZ5.1
#=GS E0ZNV3_HBV/2-21      AC E0ZNV3.1
#=GS G1C8K2_HBV/31-212    AC G1C8K2.1
#=GS G9G8V5_HBV/2-183     AC G9G8V5.1
#=GS B3VAR5_HBV/31-212    AC B3VAR5.1
#=GS B5M5I6_HBV/31-212    AC B5M5I6.1
#=GS B4Z238_HBV/2-41      AC B4Z238.1
#=GS A9PLF1_HBV/1-39      AC A9PLF1.1
#=GS D8VC08_HBV/2-51      AC D8VC08.1
#=GS C7DNB3_HBV/31-212    AC C7DNB3.1
#=GS Q60H19_HBV/31-71     AC Q60H19.1
#=GS G3XGT5_HBV/2-183     AC G3XGT5.1
#=GS Q91T02_HBV/31-212    AC Q91T02.1
#=GS G9I200_HBV/31-212    AC G9I200.1
#=GS D8VBY2_HBV/2-51      AC D8VBY2.1
#=GS A7L357_HBV/31-190    AC A7L357.1
#=GS Q60GX9_HBV/31-71     AC Q60GX9.1
#=GS CAPSD_DHBV1/2-262    AC P0C6J7.1
#=GS E0ZNX1_HBV/2-110     AC E0ZNX1.1
#=GS Q76B14_HBV/31-212    AC Q76B14.1
#=GS B4Z2Q4_HBV/2-41      AC B4Z2Q4.1
#=GS B3VAM3_HBV/2-183     AC B3VAM3.1
#=GS Q14U86_HBV/31-78     AC Q14U86.1
#=GS Q68035_HBV/31-212    AC Q68035.1
#=GS D8VCE1_HBV/2-37      AC D8VCE1.1
#=GS Q8QP23_HBV/1-130     AC Q8QP23.1
#=GS Q9E6S0_HBV/31-212    AC Q9E6S0.1
#=GS Q8V1H5_HBV/31-210    AC Q8V1H5.1
#=GS C0LKN9_HBV/2-183     AC C0LKN9.1
#=GS E0ZP22_HBV/2-110     AC E0ZP22.1
#=GS B4Z1E6_HBV/2-40      AC B4Z1E6.1
#=GS B4Z4R1_HBV/2-41      AC B4Z4R1.1
#=GS B3VBD8_HBV/2-183     AC B3VBD8.1
#=GS Q5G3F2_HBV/2-25      AC Q5G3F2.1
#=GS B4Z5Y5_HBV/31-71     AC B4Z5Y5.1
#=GS E5D5N0_HBV/31-214    AC E5D5N0.1
#=GS B4Z381_HBV/2-37      AC B4Z381.1
#=GS B4Z4W7_HBV/31-70     AC B4Z4W7.1
#=GS Q68001_HBV/2-183     AC Q68001.1
#=GS B5B4I7_HBV/31-212    AC B5B4I7.1
#=GS B6VA78_HBV/2-183     AC B6VA78.1
#=GS E0ZR73_HBV/2-183     AC E0ZR73.1
#=GS G1EII4_HBV/2-153     AC G1EII4.1
#=GS C3W462_HBV/2-183     AC C3W462.1
#=GS Q91A74_HBV/31-66     AC Q91A74.1
#=GS B4Z684_HBV/31-70     AC B4Z684.1
#=GS Q2L581_HBV/2-20      AC Q2L581.1
#=GS B4Z2K3_HBV/2-41      AC B4Z2K3.1
#=GS C3W493_HBV/2-183     AC C3W493.1
#=GS B4Z2W4_HBV/2-41      AC B4Z2W4.1
#=GS D8VBG4_HBV/31-152    AC D8VBG4.1
#=GS Q1MST5_HBV/31-173    AC Q1MST5.1
#=GS H3K3T8_HBV/2-183     AC H3K3T8.1
#=GS Q80J81_HBV/2-183     AC Q80J81.1
#=GS Q2L596_HBV/2-20      AC Q2L596.1
#=GS B1ABK3_HBV/31-205    AC B1ABK3.1
#=GS Q8QP20_HBV/1-130     AC Q8QP20.1
#=GS E7FK64_HBV/31-212    AC E7FK64.1
#=GS D0EE13_HBV/31-214    AC D0EE13.1
#=GS C7DSJ7_HBV/31-212    AC C7DSJ7.1
#=GS Q917J6_HBV/2-183     AC Q917J6.1
#=GS D6QVI9_HBV/2-181     AC D6QVI9.1
#=GS Q6TYG8_HBV/31-182    AC Q6TYG8.1
#=GS B5M5H0_HBV/31-212    AC B5M5H0.1
#=GS A0A871_HBV/31-212    AC A0A871.1
#=GS Q7T7W0_HBV/2-185     AC Q7T7W0.1
#=GS Q9E0N2_HBV/31-152    AC Q9E0N2.1
#=GS B7TUJ9_HBV/2-183     AC B7TUJ9.1
#=GS Q76EB8_HBV/2-183     AC Q76EB8.1
#=GS Q8VBJ5_HBV/2-183     AC Q8VBJ5.1
#=GS D3J6B6_HBV/31-70     AC D3J6B6.1
#=GS B7TUM8_HBV/31-212    AC B7TUM8.1
#=GS G1E7J6_HBV/2-183     AC G1E7J6.1
#=GS D6QVG1_HBV/2-183     AC D6QVG1.1
#=GS G9MD79_HBV/2-183     AC G9MD79.1
#=GS Q2L574_HBV/2-20      AC Q2L574.1
#=GS Q8JSX2_HBV/1-130     AC Q8JSX2.1
#=GS I0DG84_HBV/31-212    AC I0DG84.1
#=GS B5BPV3_HBV/2-183     AC B5BPV3.1
#=GS Q60H12_HBV/31-71     AC Q60H12.1
#=GS D3J5P0_HBV/31-57     AC D3J5P0.1
#=GS B2CZW7_HBV/31-212    AC B2CZW7.1
#=GS Q8JSV9_HBV/1-130     AC Q8JSV9.1
#=GS D3J5M0_HBV/31-57     AC D3J5M0.1
#=GS Q2PJN2_HBV/33-95     AC Q2PJN2.1
#=GS B4Z2A1_HBV/2-37      AC B4Z2A1.1
#=GS Q45F59_HBV/2-183     AC Q45F59.1
#=GS B4Z4N6_HBV/31-70     AC B4Z4N6.1
#=GS G9G9Q6_HBV/2-183     AC G9G9Q6.1
#=GS B9VJY4_HBV/2-183     AC B9VJY4.1
#=GS Q6XGU9_HBV/31-214    AC Q6XGU9.1
#=GS D8VBU0_HBV/2-51      AC D8VBU0.1
#=GS C7DN66_HBV/31-214    AC C7DN66.1
#=GS C1KT83_HBV/31-212    AC C1KT83.1
#=GS E0ZN91_HBV/2-153     AC E0ZN91.1
#=GS Q6YLL7_HBV/31-212    AC Q6YLL7.1
#=GS G0Z2W7_HBV/2-121     AC G0Z2W7.1
#=GS B7TUA1_HBV/2-183     AC B7TUA1.1
#=GS B0FCB1_HBV/76-154    AC B0FCB1.1
#=GS Q6I6Q8_HBV/31-74     AC Q6I6Q8.1
#=GS E0ZRS2_HBV/2-183     AC E0ZRS2.1
#=GS B7TTQ5_HBV/31-212    AC B7TTQ5.1
#=GS Q765E1_HBV/31-214    AC Q765E1.1
#=GS D8VBW5_HBV/31-54     AC D8VBW5.1
#=GS D3YG70_HBV/2-183     AC D3YG70.1
#=GS B4Z240_HBV/31-70     AC B4Z240.1
#=GS Q91SY7_HBV/31-212    AC Q91SY7.1
#=GS Q1MSN8_HBV/31-173    AC Q1MSN8.1
#=GS C1KT82_HBV/31-212    AC C1KT82.1
#=GS B9VJW9_HBV/2-183     AC B9VJW9.1
#=GS G1C8A6_HBV/2-35      AC G1C8A6.1
#=GS Q9WMD0_HBV/31-212    AC Q9WMD0.1
#=GS D0EEH0_HBV/2-185     AC D0EEH0.1
#=GS B2CY01_HBV/2-183     AC B2CY01.1
#=GS Q8QP29_HBV/1-130     AC Q8QP29.1
#=GS Q9QRR1_HBV/31-58     AC Q9QRR1.1
#=GS Q8JWQ3_HBV/31-214    AC Q8JWQ3.1
#=GS Q9DGW7_HBV/2-183     AC Q9DGW7.1
#=GS B4Z1P4_HBV/31-71     AC B4Z1P4.1
#=GS B7TV33_HBV/2-183     AC B7TV33.1
#=GS B0B365_HBV/2-183     AC B0B365.1
#=GS D3TK23_HBV/2-183     AC D3TK23.1
#=GS B6D6B9_HBV/2-179     AC B6D6B9.1
#=GS B4Z3K8_HBV/31-68     AC B4Z3K8.1
#=GS D9U5B0_HBV/31-113    AC D9U5B0.1
#=GS B4Z436_HBV/31-68     AC B4Z436.1
#=GS B4Z2X8_HBV/31-66     AC B4Z2X8.1
#=GS B4Z3Z2_HBV/31-68     AC B4Z3Z2.1
#=GS Q67984_HBV/31-212    AC Q67984.1
#=GS B3VAL2_HBV/31-212    AC B3VAL2.1
#=GS B0YK64_HBV/2-183     AC B0YK64.1
#=GS D5LBS9_HBV/2-183     AC D5LBS9.1
#=GS E3WCQ2_HBV/31-212    AC E3WCQ2.1
#=GS B7TV45_HBV/31-212    AC B7TV45.1
#=GS D5LF16_HBV/31-212    AC D5LF16.1
#=GS C4P1T2_HBV/31-76     AC C4P1T2.1
#=GS B4Z687_HBV/31-70     AC B4Z687.1
#=GS Q6TYF4_HBV/31-182    AC Q6TYF4.1
#=GS G1ETU2_HBV/2-183     AC G1ETU2.1
#=GS Q2EGC2_HBV/31-99     AC Q2EGC2.1
#=GS D6QVS7_HBV/31-212    AC D6QVS7.1
#=GS B4Z3C1_HBV/2-37      AC B4Z3C1.1
#=GS Q89612_HBV/2-183     AC Q89612.1
#=GS B6CIX0_HBV/31-212    AC B6CIX0.1
#=GS B4Z3B7_HBV/31-66     AC B4Z3B7.1
#=GS Q45F84_HBV/31-212    AC Q45F84.1
#=GS Q2L5F3_HBV/2-24      AC Q2L5F3.1
#=GS Q91SX5_HBV/31-212    AC Q91SX5.1
#=GS A3RF46_HBV/31-212    AC A3RF46.1
#=GS C0LKL4_HBV/2-183     AC C0LKL4.1
#=GS E5CZ20_HBV/2-183     AC E5CZ20.1
#=GS B3VAJ0_HBV/2-183     AC B3VAJ0.1
#=GS B9VKM6_HBV/31-212    AC B9VKM6.1
#=GS G9G9D8_HBV/2-183     AC G9G9D8.1
#=GS Q1MSQ2_HBV/31-173    AC Q1MSQ2.1
#=GS B4Z2P4_HBV/2-41      AC B4Z2P4.1
#=GS D0EEJ5_HBV/31-214    AC D0EEJ5.1
#=GS D5LFI4_HBV/2-183     AC D5LFI4.1
#=GS D8VC94_HBV/31-66     AC D8VC94.1
#=GS B4Z386_HBV/31-66     AC B4Z386.1
#=GS D8VC87_HBV/2-51      AC D8VC87.1
#=GS D0UDY6_HBV/2-183     AC D0UDY6.1
#=GS D3J5Z0_HBV/31-69     AC D3J5Z0.1
#=GS B7TUU3_HBV/2-183     AC B7TUU3.1
#=GS Q6UE62_HBV/2-183     AC Q6UE62.1
#=GS D3J685_HBV/31-68     AC D3J685.1
#=GS Q917I0_HBV/2-183     AC Q917I0.1
#=GS C1K1S0_HBV/2-183     AC C1K1S0.1
#=GS Q19SW5_HBV/2-183     AC Q19SW5.1
#=GS G3E5D5_HBV/2-183     AC G3E5D5.1
#=GS G3E5J0_HBV/31-212    AC G3E5J0.1
#=GS A9QPZ3_HBV/2-183     AC A9QPZ3.1
#=GS B4Z440_HBV/2-39      AC B4Z440.1
#=GS C1KT90_HBV/31-210    AC C1KT90.1
#=GS D8VB95_HBV/2-174     AC D8VB95.1
#=GS C7DN73_HBV/31-212    AC C7DN73.1
#=GS G0Z2Y6_HBV/2-121     AC G0Z2Y6.1
#=GS B7SXU1_HBV/14-195    AC B7SXU1.1
#=GS C9WDG6_HBV/2-183     AC C9WDG6.1
#=GS G9G9K0_HBV/2-183     AC G9G9K0.1
#=GS Q9WNA3_HBV/31-212    AC Q9WNA3.1
#=GS Q7T7U0_HBV/2-183     AC Q7T7U0.1
#=GS Q09L06_HBV/2-20      AC Q09L06.1
#=GS Q8B4C8_HBV/31-212    AC Q8B4C8.1
#=GS C0LKF5_HBV/2-183     AC C0LKF5.1
#=GS G1EIH6_HBV/2-153     AC G1EIH6.1
#=GS G3XGV1_HBV/31-212    AC G3XGV1.1
#=GS D8VBH0_HBV/31-144    AC D8VBH0.1
#=GS G1C8E0_HBV/2-183     AC G1C8E0.1
#=GS A3F6J4_HBV/101-197   AC A3F6J4.1
#=GS B4Z685_HBV/2-41      AC B4Z685.1
#=GS D0E5M7_HBV/31-212    AC D0E5M7.1
#=GS B6CIV1_HBV/31-214    AC B6CIV1.1
#=GS C3W3Y4_HBV/2-183     AC C3W3Y4.1
#=GS C7DSQ8_HBV/31-212    AC C7DSQ8.1
#=GS E0ZNX5_HBV/2-110     AC E0ZNX5.1
#=GS Q6XGQ6_HBV/2-185     AC Q6XGQ6.1
#=GS D0EYZ6_HBV/31-212    AC D0EYZ6.1
#=GS Q1MSL5_HBV/31-170    AC Q1MSL5.1
#=GS D9U5E0_HBV/31-212    AC D9U5E0.1
#=GS E0ZP19_HBV/2-110     AC E0ZP19.1
#=GS Q91A58_HBV/31-66     AC Q91A58.1
#=GS F5C045_HBV/31-53     AC F5C045.1
#=GS B4Z5Z1_HBV/31-71     AC B4Z5Z1.1
#=GS E0ZND3_HBV/2-153     AC E0ZND3.1
#=GS Q8JSW1_HBV/1-130     AC Q8JSW1.1
#=GS B4Z5V6_HBV/2-42      AC B4Z5V6.1
#=GS G1E8T9_HBV/2-183     AC G1E8T9.1
#=GS Q2L5G9_HBV/2-24      AC Q2L5G9.1
#=GS H2ERJ6_HBV/31-212    AC H2ERJ6.1
#=GS Q09KW7_HBV/2-20      AC Q09KW7.1
#=GS Q507F4_HBV/31-163    AC Q507F4.1
#=GS Q1T7D2_HBV/2-183     AC Q1T7D2.1
#=GS D3J5Z2_HBV/31-78     AC D3J5Z2.1
#=GS C7DSP4_HBV/31-212    AC C7DSP4.1
#=GS B4Z3I2_HBV/2-42      AC B4Z3I2.1
#=GS C4P0Z1_HBV/31-76     AC C4P0Z1.1
#=GS Q80GW7_HBV/82-144    AC Q80GW7.1
#=GS D3J618_HBV/31-88     AC D3J618.1
#=GS G0Z314_HBV/2-121     AC G0Z314.1
#=GS C4P134_HBV/31-76     AC C4P134.1
#=GS Q60H10_HBV/31-71     AC Q60H10.1
#=GS H9N858_HBV/2-183     AC H9N858.1
#=GS Q45F46_HBV/2-183     AC Q45F46.1
#=GS Q6XGH2_HBV/2-183     AC Q6XGH2.1
#=GS G9G8W2_HBV/2-183     AC G9G8W2.1
#=GS B4Z3X5_HBV/2-39      AC B4Z3X5.1
#=GS B4Z3J7_HBV/2-39      AC B4Z3J7.1
#=GS C1K196_HBV/31-212    AC C1K196.1
#=GS Q80B45_HBV/2-183     AC Q80B45.1
#=GS B4X6N3_HBV/31-86     AC B4X6N3.1
#=GS C4P116_HBV/31-76     AC C4P116.1
#=GS Q9E0Q3_HBV/2-123     AC Q9E0Q3.1
#=GS B7TUK4_HBV/31-212    AC B7TUK4.1
#=GS Q2L5G4_HBV/2-24      AC Q2L5G4.1
#=GS Q9E0R3_HBV/2-123     AC Q9E0R3.1
#=GS B4Z3C0_HBV/31-66     AC B4Z3C0.1
#=GS B4Z1Y2_HBV/31-70     AC B4Z1Y2.1
#=GS E0ZP49_HBV/31-139    AC E0ZP49.1
#=GS G3E586_HBV/2-183     AC G3E586.1
#=GS B4Z3X4_HBV/31-68     AC B4Z3X4.1
#=GS F5C092_HBV/31-212    AC F5C092.1
#=GS B4Z351_HBV/2-37      AC B4Z351.1
#=GS B4Z2K9_HBV/2-41      AC B4Z2K9.1
#=GS B6ULP6_HBV/2-183     AC B6ULP6.1
#=GS B4Z3J4_HBV/2-39      AC B4Z3J4.1
#=GS E0ZP72_HBV/2-110     AC E0ZP72.1
#=GS D3TII0_HBV/2-183     AC D3TII0.1
#=GS B7TV08_HBV/2-183     AC B7TV08.1
#=GS O71307_9HEPA/2-262   AC O71307.1
#=GS E0ZNT7_HBV/31-139    AC E0ZNT7.1
#=GS Q5U7V2_HBV/31-212    AC Q5U7V2.1
#=GS B3VAY0_HBV/2-183     AC B3VAY0.1
#=GS B7TTT5_HBV/31-212    AC B7TTT5.1
#=GS B0YGK1_HBV/31-212    AC B0YGK1.1
#=GS B4Z2X3_HBV/2-41      AC B4Z2X3.1
#=GS Q765E7_HBV/31-214    AC Q765E7.1
#=GS Q918J9_HBV/31-212    AC Q918J9.1
#=GS C4P196_HBV/31-76     AC C4P196.1
#=GS E0ZNA8_HBV/2-153     AC E0ZNA8.1
#=GS B7TTY1_HBV/2-183     AC B7TTY1.1
#=GS C4P155_HBV/31-76     AC C4P155.1
#=GS A9PLC8_HBV/1-39      AC A9PLC8.1
#=GS B4Z2Z6_HBV/2-37      AC B4Z2Z6.1
#=GS Q7THR2_HBV/73-151    AC Q7THR2.1
#=GS B5TXV9_HBV/2-183     AC B5TXV9.1
#=GS D2JMC0_HBV/2-183     AC D2JMC0.1
#=GS G0Z305_HBV/2-121     AC G0Z305.1
#=GS D3J678_HBV/31-68     AC D3J678.1
#=GS B4Z1L0_HBV/2-42      AC B4Z1L0.1
#=GS B7TTY0_HBV/31-212    AC B7TTY0.1
#=GS Q81140_HBV/2-183     AC Q81140.1
#=GS Q7TDS5_HBV/2-183     AC Q7TDS5.1
#=GS C7AYV7_HBV/31-214    AC C7AYV7.1
#=GS B4Z2A9_HBV/2-37      AC B4Z2A9.1
#=GS C7DMV9_HBV/2-183     AC C7DMV9.1
#=GS Q8QP12_HBV/1-130     AC Q8QP12.1
#=GS E0ZNE9_HBV/31-182    AC E0ZNE9.1
#=GS B6ULI2_HBV/88-164    AC B6ULI2.1
#=GS D3J602_HBV/31-79     AC D3J602.1
#=GS D3J5Z5_HBV/31-80     AC D3J5Z5.1
#=GS Q68060_HBV/2-183     AC Q68060.1
#=GS C7DMR6_HBV/31-212    AC C7DMR6.1
#=GS D3J5N6_HBV/31-57     AC D3J5N6.1
#=GS CAPSD_HBVD4/2-183    AC Q9QMI2.1
#=GS B3VAL0_HBV/2-183     AC B3VAL0.1
#=GS D8VBJ4_HBV/2-51      AC D8VBJ4.1
#=GS F5C053_HBV/31-53     AC F5C053.1
#=GS G1C8K9_HBV/2-183     AC G1C8K9.1
#=GS B4Z5W7_HBV/31-71     AC B4Z5W7.1
#=GS B4Z1X6_HBV/31-70     AC B4Z1X6.1
#=GS C4P185_HBV/31-76     AC C4P185.1
#=GS G9MD70_HBV/2-183     AC G9MD70.1
#=GS Q5U7S8_HBV/31-212    AC Q5U7S8.1
#=GS B6CJ09_HBV/31-214    AC B6CJ09.1
#=GS H6UN91_HBV/2-182     AC H6UN91.1
#=GS D3J620_HBV/31-89     AC D3J620.1
#=GS G9G916_HBV/2-183     AC G9G916.1
#=GS C1KTC1_HBV/31-210    AC C1KTC1.1
#=GS G3XLB6_HBV/31-212    AC G3XLB6.1
#=GS E5D5N1_HBV/2-185     AC E5D5N1.1
#=GS C4P170_HBV/31-76     AC C4P170.1
#=GS Q67951_HBV/2-183     AC Q67951.1
#=GS D8VBS1_HBV/31-65     AC D8VBS1.1
#=GS B5AT89_HBV/2-183     AC B5AT89.1
#=GS Q2EGF1_HBV/31-84     AC Q2EGF1.1
#=GS B6CIV4_HBV/31-214    AC B6CIV4.1
#=GS B4Z2I3_HBV/31-66     AC B4Z2I3.1
#=GS B9VL32_HBV/2-183     AC B9VL32.1
#=GS G1E7E6_HBV/2-183     AC G1E7E6.1
#=GS B4Z5T7_HBV/31-71     AC B4Z5T7.1
#=GS A8J4G7_HBV/31-212    AC A8J4G7.1
#=GS Q1MSR9_HBV/31-173    AC Q1MSR9.1
#=GS C7DNM8_HBV/2-183     AC C7DNM8.1
#=GS B4Z333_HBV/2-37      AC B4Z333.1
#=GS Q68055_HBV/31-212    AC Q68055.1
#=GS B4Z2N2_HBV/2-41      AC B4Z2N2.1
#=GS C4P1S0_HBV/31-71     AC C4P1S0.1
#=GS Q7T456_HBV/2-183     AC Q7T456.1
#=GS B4Z318_HBV/2-37      AC B4Z318.1
#=GS D3YGI4_HBV/2-183     AC D3YGI4.1
#=GS D8VBD1_HBV/2-129     AC D8VBD1.1
#=GS C4P1V0_HBV/31-76     AC C4P1V0.1
#=GS B4Z4U7_HBV/2-41      AC B4Z4U7.1
#=GS B4Z1Y3_HBV/2-41      AC B4Z1Y3.1
#=GS H6UGC2_HBV/31-212    AC H6UGC2.1
#=GS C3W438_HBV/2-183     AC C3W438.1
#=GS B5M556_HBV/31-212    AC B5M556.1
#=GS I0DG21_HBV/31-212    AC I0DG21.1
#=GS H3K3C8_HBV/31-214    AC H3K3C8.1
#=GS G0Z2X4_HBV/2-121     AC G0Z2X4.1
#=GS D9U585_HBV/2-183     AC D9U585.1
#=GS H6UG58_HBV/2-183     AC H6UG58.1
#=GS Q2L5E3_HBV/2-20      AC Q2L5E3.1
#=GS Q60GY1_HBV/31-71     AC Q60GY1.1
#=GS Q91SX6_HBV/31-212    AC Q91SX6.1
#=GS Q5SDL3_HBV/31-212    AC Q5SDL3.1
#=GS B5M5H3_HBV/31-212    AC B5M5H3.1
#=GS B4Z2W6_HBV/31-70     AC B4Z2W6.1
#=GS Q6TYE9_HBV/31-182    AC Q6TYE9.1
#=GS B7TU68_HBV/2-183     AC B7TU68.1
#=GS B3VAP2_HBV/2-183     AC B3VAP2.1
#=GS D3YGM1_HBV/2-183     AC D3YGM1.1
#=GS B7TUR1_HBV/2-183     AC B7TUR1.1
#=GS D2U620_HBV/2-183     AC D2U620.1
#=GS B1PI63_9HEPA/35-295  AC B1PI63.1
#=GS C4P1E7_HBV/31-76     AC C4P1E7.1
#=GS C4P1C9_HBV/31-76     AC C4P1C9.1
#=GS C7DMZ0_HBV/31-212    AC C7DMZ0.1
#=GS B4Z1N8_HBV/31-71     AC B4Z1N8.1
#=GS B5M4Y4_HBV/2-183     AC B5M4Y4.1
#=GS B3VAM6_HBV/2-183     AC B3VAM6.1
#=GS Q80J85_HBV/2-183     AC Q80J85.1
#=GS F4MJI1_HBV/31-81     AC F4MJI1.1
#=GS B2LWE1_HBV/31-210    AC B2LWE1.1
#=GS D2JMH7_HBV/2-183     AC D2JMH7.1
#=GS B4Z458_HBV/2-39      AC B4Z458.1
#=GS C7AYT9_HBV/31-214    AC C7AYT9.1
#=GS CAPSD_HBVGO/2-183    AC P0C6I9.1
#=GS D3J6A5_HBV/31-70     AC D3J6A5.1
#=GS Q68RN2_HBV/2-183     AC Q68RN2.1
#=GS H6UGK2_HBV/2-183     AC H6UGK2.1
#=GS Q9WMW8_HBV/31-187    AC Q9WMW8.1
#=GS C1K226_HBV/2-183     AC C1K226.1
#=GS C7AYK4_HBV/2-185     AC C7AYK4.1
#=GS C4P1D6_HBV/31-76     AC C4P1D6.1
#=GS B4Z3N3_HBV/2-39      AC B4Z3N3.1
#=GS Q3LTY5_HBV/2-183     AC Q3LTY5.1
#=GS C4P1R7_HBV/31-76     AC C4P1R7.1
#=GS B2Y6J9_HBV/2-183     AC B2Y6J9.1
#=GS B4Z2J4_HBV/31-66     AC B4Z2J4.1
#=GS D3TJ97_HBV/2-83      AC D3TJ97.1
#=GS B5U716_HBV/2-183     AC B5U716.1
#=GS E0ZP61_HBV/2-110     AC E0ZP61.1
#=GS B6ULH1_HBV/31-212    AC B6ULH1.1
#=GS C4P0X8_HBV/31-76     AC C4P0X8.1
#=GS B4Z2L7_HBV/2-41      AC B4Z2L7.1
#=GS D6R3X1_HBV/2-183     AC D6R3X1.1
#=GS D0EEA5_HBV/2-185     AC D0EEA5.1
#=GS B4Z2I0_HBV/31-66     AC B4Z2I0.1
#=GS F5C041_HBV/31-53     AC F5C041.1
#=GS B4Z1Q7_HBV/2-42      AC B4Z1Q7.1
#=GS D3GIL6_HBV/2-183     AC D3GIL6.1
#=GS D2U636_HBV/2-183     AC D2U636.1
#=GS Q8QP31_HBV/1-130     AC Q8QP31.1
#=GS Q2L5H2_HBV/2-24      AC Q2L5H2.1
#=GS C9W1Y3_HBV/2-183     AC C9W1Y3.1
#=GS E8Z630_HBV/31-212    AC E8Z630.1
#=GS A5LGA9_HBV/2-183     AC A5LGA9.1
#=GS Q9E0N5_HBV/2-123     AC Q9E0N5.1
#=GS Q2L5B5_HBV/2-20      AC Q2L5B5.1
#=GS Q80H38_HBV/31-212    AC Q80H38.1
#=GS B3VB93_HBV/31-212    AC B3VB93.1
#=GS Q5Q0Y2_HBV/2-183     AC Q5Q0Y2.1
#=GS D8VC64_HBV/2-25      AC D8VC64.1
#=GS Q8JN12_HBV/2-183     AC Q8JN12.1
#=GS B4Z4T7_HBV/31-70     AC B4Z4T7.1
#=GS B6ULK6_HBV/31-212    AC B6ULK6.1
#=GS A6MG25_HBV/2-183     AC A6MG25.1
#=GS C4P1P6_HBV/31-76     AC C4P1P6.1
#=GS B4Z3Q1_HBV/2-39      AC B4Z3Q1.1
#=GS B4Z347_HBV/31-66     AC B4Z347.1
#=GS B4Z305_HBV/31-66     AC B4Z305.1
#=GS E3Q0H4_HBV/2-183     AC E3Q0H4.1
#=GS A6MG08_HBV/2-183     AC A6MG08.1
#=GS C7AYN4_HBV/2-183     AC C7AYN4.1
#=GS C7AYE1_HBV/31-214    AC C7AYE1.1
#=GS Q4FD70_HBV/31-212    AC Q4FD70.1
#=GS F1CFC1_HBV/31-212    AC F1CFC1.1
#=GS Q9E0N9_HBV/2-123     AC Q9E0N9.1
#=GS G8H3G3_HBV/2-131     AC G8H3G3.1
#=GS D2JMB4_HBV/31-212    AC D2JMB4.1
#=GS B3VAQ7_HBV/2-183     AC B3VAQ7.1
#=GS Q5G3I2_HBV/2-25      AC Q5G3I2.1
#=GS D3YG88_HBV/2-183     AC D3YG88.1
#=GS Q91EH5_HBV/31-214    AC Q91EH5.1
#=GS Q9ELT6_HBV/31-152    AC Q9ELT6.1
#=GS Q917J1_HBV/2-183     AC Q917J1.1
#=GS Q67855_HBV/2-185     AC Q67855.1
#=GS Q67855_HBV/2-185     DR PDB; 1QGT B; 2-143;
#=GS Q67855_HBV/2-185     DR PDB; 1QGT A; 2-142;
#=GS Q67855_HBV/2-185     DR PDB; 1QGT C; 2-142;
#=GS Q67855_HBV/2-185     DR PDB; 1QGT D; 2-143;
#=GS Q45F32_HBV/2-183     AC Q45F32.1
#=GS B9VKJ1_HBV/2-183     AC B9VKJ1.1
#=GS B4Z1P5_HBV/2-42      AC B4Z1P5.1
#=GS E0ZP47_HBV/2-110     AC E0ZP47.1
#=GS C7DM50_HBV/2-183     AC C7DM50.1
#=GS Q6UE47_HBV/2-183     AC Q6UE47.1
#=GS C4P1K0_HBV/31-76     AC C4P1K0.1
#=GS A1KR36_HBV/2-25      AC A1KR36.1
#=GS F5C1J1_HBV/43-224    AC F5C1J1.1
#=GS Q2EGG7_HBV/31-99     AC Q2EGG7.1
#=GS Q5G3J3_HBV/2-25      AC Q5G3J3.1
#=GS D0EEL0_HBV/2-185     AC D0EEL0.1
#=GS Q8VBF8_HBV/2-183     AC Q8VBF8.1
#=GS B4Z467_HBV/2-39      AC B4Z467.1
#=GS B3VAN8_HBV/2-183     AC B3VAN8.1
#=GS E0ZNB8_HBV/2-153     AC E0ZNB8.1
#=GS B4Z3I1_HBV/31-71     AC B4Z3I1.1
#=GS Q7T7Y0_HBV/31-212    AC Q7T7Y0.1
#=GS D8VBX6_HBV/31-80     AC D8VBX6.1
#=GS B4Z1V9_HBV/2-41      AC B4Z1V9.1
#=GS G1EII3_HBV/2-153     AC G1EII3.1
#=GS G9HVG0_HBV/2-183     AC G9HVG0.1
#=GS C7DNM0_HBV/31-212    AC C7DNM0.1
#=GS B3VB60_HBV/2-183     AC B3VB60.1
#=GS B4Z1S9_HBV/2-51      AC B4Z1S9.1
#=GS B2CSB2_HBV/2-183     AC B2CSB2.1
#=GS C9WDB3_HBV/2-183     AC C9WDB3.1
#=GS Q6I6U4_HBV/31-71     AC Q6I6U4.1
#=GS C4P1F4_HBV/31-76     AC C4P1F4.1
#=GS C4P1Q4_HBV/31-76     AC C4P1Q4.1
#=GS C4P187_HBV/31-76     AC C4P187.1
#=GS Q9WMC6_HBV/31-212    AC Q9WMC6.1
#=GS D8VB67_HBV/31-80     AC D8VB67.1
#=GS G0Z2V2_HBV/2-121     AC G0Z2V2.1
#=GS A7L347_HBV/31-190    AC A7L347.1
#=GS D3J5T2_HBV/31-87     AC D3J5T2.1
#=GS E0ZNG6_HBV/31-173    AC E0ZNG6.1
#=GS Q91A54_HBV/31-66     AC Q91A54.1
#=GS Q9WMC3_HBV/31-212    AC Q9WMC3.1
#=GS C9WDQ3_HBV/2-183     AC C9WDQ3.1
#=GS G1EII9_HBV/2-153     AC G1EII9.1
#=GS C6F575_HBV/2-185     AC C6F575.1
#=GS G1E869_HBV/2-183     AC G1E869.1
#=GS Q2LCC1_HBV/2-183     AC Q2LCC1.1
#=GS HBEAG_HBVA9/31-214   AC Q4R1S0.1
#=GS Q60H37_HBV/2-42      AC Q60H37.1
#=GS Q69379_HBV/1-65      AC Q69379.1
#=GS B4Z3H3_HBV/2-42      AC B4Z3H3.1
#=GS Q7TEE0_HBV/31-163    AC Q7TEE0.1
#=GS Q9WNS3_HBV/31-212    AC Q9WNS3.1
#=GS B4Z3C7_HBV/2-37      AC B4Z3C7.1
#=GS D3J692_HBV/31-70     AC D3J692.1
#=GS Q9QB00_HBV/2-183     AC Q9QB00.1
#=GS Q9J3T4_HBV/1-65      AC Q9J3T4.1
#=GS Q9QRQ8_HBV/31-160    AC Q9QRQ8.1
#=GS A9PLG8_HBV/1-39      AC A9PLG8.1
#=GS Q68RR4_HBV/2-183     AC Q68RR4.1
#=GS Q003Z4_HBV/31-212    AC Q003Z4.1
#=GS D3J5X9_HBV/31-88     AC D3J5X9.1
#=GS D8VBB8_HBV/2-183     AC D8VBB8.1
#=GS D5LBQ7_HBV/2-183     AC D5LBQ7.1
#=GS Q1MSQ3_HBV/31-172    AC Q1MSQ3.1
#=GS B2CS98_HBV/2-183     AC B2CS98.1
#=GS Q6I6W4_HBV/31-74     AC Q6I6W4.1
#=GS CAPSD_DHBVQ/2-262    AC Q66406.1
#=GS Q7T7U1_HBV/31-212    AC Q7T7U1.1
#=GS D3YGK3_HBV/2-183     AC D3YGK3.1
#=GS D3J6G4_HBV/31-70     AC D3J6G4.1
#=GS F4MJH5_HBV/31-81     AC F4MJH5.1
#=GS G1E876_HBV/2-183     AC G1E876.1
#=GS E7CU93_HBV/2-183     AC E7CU93.1
#=GS E0D3A6_HBV/31-82     AC E0D3A6.1
#=GS Q91SY3_HBV/31-212    AC Q91SY3.1
#=GS B4Z267_HBV/31-66     AC B4Z267.1
#=GS B4Z2H5_HBV/2-37      AC B4Z2H5.1
#=GS B6CIV2_HBV/31-169    AC B6CIV2.1
#=GS D5LE98_HBV/31-212    AC D5LE98.1
#=GS A1KR34_HBV/2-25      AC A1KR34.1
#=GS Q2L592_HBV/2-20      AC Q2L592.1
#=GS Q81115_HBV/31-212    AC Q81115.1
#=GS B0YK44_HBV/31-212    AC B0YK44.1
#=GS Q1MSN3_HBV/31-173    AC Q1MSN3.1
#=GS Q7T447_9HEPA/39-225  AC Q7T447.1
#=GS B4YTC7_HBV/31-202    AC B4YTC7.1
#=GS B5ASS9_HBV/31-212    AC B5ASS9.1
#=GS D3J6G2_HBV/31-70     AC D3J6G2.1
#=GS G1ETU0_HBV/2-183     AC G1ETU0.1
#=GS F5C079_HBV/31-212    AC F5C079.1
#=GS D5MRS7_HBV/2-56      AC D5MRS7.1
#=GS B4Z2M3_HBV/2-41      AC B4Z2M3.1
#=GS Q9WNA4_HBV/31-212    AC Q9WNA4.1
#=GS B7TV46_HBV/2-183     AC B7TV46.1
#=GS D6QW50_HBV/31-212    AC D6QW50.1
#=GS B7TUF3_HBV/31-212    AC B7TUF3.1
#=GS D2JMU4_HBV/2-183     AC D2JMU4.1
#=GS Q507F9_HBV/31-163    AC Q507F9.1
#=GS D0EYW3_HBV/2-157     AC D0EYW3.1
#=GS Q2F506_HBV/31-212    AC Q2F506.1
#=GS C7DM15_HBV/31-212    AC C7DM15.1
#=GS F4MJD2_HBV/31-81     AC F4MJD2.1
#=GS A9PLG1_HBV/1-39      AC A9PLG1.1
#=GS B3VAN5_HBV/31-212    AC B3VAN5.1
#=GS D8VBY1_HBV/31-80     AC D8VBY1.1
#=GS D0UE52_HBV/31-212    AC D0UE52.1
#=GS B2CY21_HBV/31-212    AC B2CY21.1
#=GS Q91EI1_HBV/2-185     AC Q91EI1.1
#=GS C4P133_HBV/31-76     AC C4P133.1
#=GS C4P1D1_HBV/31-76     AC C4P1D1.1
#=GS Q91A56_HBV/31-66     AC Q91A56.1
#=GS D3K2D8_HBV/2-183     AC D3K2D8.1
#=GS I0DG52_HBV/31-212    AC I0DG52.1
#=GS A9CM77_HBV/2-183     AC A9CM77.1
#=GS D3J6A0_HBV/31-70     AC D3J6A0.1
#=GS Q2TJD4_HBV/31-212    AC Q2TJD4.1
#=GS B4Z232_HBV/31-70     AC B4Z232.1
#=GS A3RF43_HBV/31-212    AC A3RF43.1
#=GS G1C8P9_HBV/31-212    AC G1C8P9.1
#=GS Q14U97_HBV/31-78     AC Q14U97.1
#=GS B9VK00_HBV/2-183     AC B9VK00.1
#=GS Q2HXJ1_HBV/2-183     AC Q2HXJ1.1
#=GS G9G8R5_HBV/31-81     AC G9G8R5.1
#=GS D3J681_HBV/31-68     AC D3J681.1
#=GS G1C8N0_HBV/2-183     AC G1C8N0.1
#=GS B2WSN7_HBV/2-183     AC B2WSN7.1
#=GS Q68023_HBV/2-183     AC Q68023.1
#=GS D3J680_HBV/31-68     AC D3J680.1
#=GS Q19K64_HBV/31-62     AC Q19K64.1
#=GS G0Z2Z3_HBV/2-121     AC G0Z2Z3.1
#=GS D3J6E0_HBV/31-70     AC D3J6E0.1
#=GS G1EIH0_HBV/2-153     AC G1EIH0.1
#=GS B9W3Y8_HBV/2-185     AC B9W3Y8.1
#=GS Q6TYH6_HBV/31-182    AC Q6TYH6.1
#=GS D0ESR4_HBV/2-183     AC D0ESR4.1
#=GS D3TKC1_HBV/31-212    AC D3TKC1.1
#=GS Q9PWW7_HBV/31-212    AC Q9PWW7.1
#=GS Q9QRQ6_HBV/31-205    AC Q9QRQ6.1
#=GS D8VCJ1_HBV/2-34      AC D8VCJ1.1
#=GS D8VBC1_HBV/2-51      AC D8VBC1.1
#=GS B4Z5W8_HBV/2-42      AC B4Z5W8.1
#=GS B4X6I8_HBV/31-87     AC B4X6I8.1
#=GS Q2L5C5_HBV/2-20      AC Q2L5C5.1
#=GS B4YLK1_HBV/2-183     AC B4YLK1.1
#=GS D8KY12_HBV/2-183     AC D8KY12.1
#=GS C7DMS3_HBV/31-212    AC C7DMS3.1
#=GS B4Z1T5_HBV/2-51      AC B4Z1T5.1
#=GS B4Z443_HBV/2-39      AC B4Z443.1
#=GS D2JMX4_HBV/2-183     AC D2JMX4.1
#=GS B4Z5Z4_HBV/31-71     AC B4Z5Z4.1
#=GS D3J664_HBV/31-76     AC D3J664.1
#=GS B5MEW8_HBV/2-183     AC B5MEW8.1
#=GS Q2ABZ3_HBV/1-165     AC Q2ABZ3.1
#=GS B4Z2Q6_HBV/31-70     AC B4Z2Q6.1
#=GS B7TU09_HBV/2-183     AC B7TU09.1
#=GS G1EIJ1_HBV/2-153     AC G1EIJ1.1
#=GS Q917J5_HBV/31-212    AC Q917J5.1
#=GS D2U640_HBV/2-183     AC D2U640.1
#=GS D2JN01_HBV/31-212    AC D2JN01.1
#=GS Q2L4K7_HBV/2-183     AC Q2L4K7.1
#=GS Q6TYG2_HBV/31-182    AC Q6TYG2.1
#=GS E0ZRK0_HBV/31-212    AC E0ZRK0.1
#=GS Q1MST2_HBV/31-75     AC Q1MST2.1
#=GS E0ZRZ6_HBV/2-183     AC E0ZRZ6.1
#=GS C3W3U7_HBV/2-183     AC C3W3U7.1
#=GS D0E6C1_HBV/31-212    AC D0E6C1.1
#=GS G9G8U8_HBV/2-183     AC G9G8U8.1
#=GS Q6J310_HBV/31-212    AC Q6J310.1
#=GS Q45F55_HBV/2-183     AC Q45F55.1
#=GS Q2L5F4_HBV/2-23      AC Q2L5F4.1
#=GS Q8VBJ7_HBV/2-183     AC Q8VBJ7.1
#=GS B4Z2S2_HBV/31-70     AC B4Z2S2.1
#=GS C6L4B2_HBV/13-141    AC C6L4B2.1
#=GS Q7TF66_HBV/31-212    AC Q7TF66.1
#=GS C4P1B6_HBV/31-76     AC C4P1B6.1
#=GS B4Z1M1_HBV/2-42      AC B4Z1M1.1
#=GS B4Z1E5_HBV/31-69     AC B4Z1E5.1
#=GS Q67961_HBV/2-183     AC Q67961.1
#=GS D3YG26_HBV/2-183     AC D3YG26.1
#=GS B4Z2M0_HBV/2-41      AC B4Z2M0.1
#=GS B3VB42_HBV/2-183     AC B3VB42.1
#=GS D8VBB4_HBV/31-203    AC D8VBB4.1
#=GS A8R7F9_HBV/112-178   AC A8R7F9.1
#=GS C0LKJ3_HBV/2-183     AC C0LKJ3.1
#=GS D5LF83_HBV/31-212    AC D5LF83.1
#=GS B3VB15_HBV/2-183     AC B3VB15.1
#=GS D3J5T0_HBV/31-57     AC D3J5T0.1
#=GS H6V885_HBV/31-56     AC H6V885.1
#=GS D8VBD3_HBV/31-80     AC D8VBD3.1
#=GS C1K1L3_HBV/31-210    AC C1K1L3.1
#=GS B4X6I6_HBV/31-87     AC B4X6I6.1
#=GS Q8B4N3_HBV/2-185     AC Q8B4N3.1
#=GS H6V889_HBV/31-56     AC H6V889.1
#=GS B5ATF8_HBV/31-109    AC B5ATF8.1
#=GS C7DYA3_HBV/2-183     AC C7DYA3.1
#=GS B5M4Y0_HBV/31-212    AC B5M4Y0.1
#=GS H6UN79_HBV/2-183     AC H6UN79.1
#=GS B0FCB6_HBV/76-154    AC B0FCB6.1
#=GS G1EIJ2_HBV/2-153     AC G1EIJ2.1
#=GS C4P1M5_HBV/31-76     AC C4P1M5.1
#=GS Q60GL0_HBV/2-183     AC Q60GL0.1
#=GS D0UE70_HBV/31-212    AC D0UE70.1
#=GS Q69378_HBV/1-65      AC Q69378.1
#=GS C1KTA4_HBV/31-210    AC C1KTA4.1
#=GS B7SXV1_HBV/2-183     AC B7SXV1.1
#=GS C4P1F8_HBV/31-76     AC C4P1F8.1
#=GS C7AYC4_HBV/2-185     AC C7AYC4.1
#=GS Q8JNW2_HBV/2-185     AC Q8JNW2.1
#=GS B7TU67_HBV/31-212    AC B7TU67.1
#=GS D3YGM7_HBV/2-183     AC D3YGM7.1
#=GS Q6RSG3_9HEPA/2-262   AC Q6RSG3.1
#=GS C4P1F1_HBV/31-76     AC C4P1F1.1
#=GS B3VAK2_HBV/2-183     AC B3VAK2.1
#=GS B4Z1F9_HBV/31-69     AC B4Z1F9.1
#=GS G9BNJ2_HBV/2-185     AC G9BNJ2.1
#=GS B3VAN0_HBV/2-183     AC B3VAN0.1
#=GS B6ULJ9_HBV/31-212    AC B6ULJ9.1
#=GS B6D6F2_HBV/31-154    AC B6D6F2.1
#=GS B4Z658_HBV/2-41      AC B4Z658.1
#=GS B6D6G1_HBV/31-81     AC B6D6G1.1
#=GS C1KTB1_HBV/31-210    AC C1KTB1.1
#=GS D3K2F2_HBV/2-181     AC D3K2F2.1
#=GS E0ZNE1_HBV/31-168    AC E0ZNE1.1
#=GS B4Z1H4_HBV/2-42      AC B4Z1H4.1
#=GS B4Z2H4_HBV/31-66     AC B4Z2H4.1
#=GS E0ZNZ1_HBV/2-110     AC E0ZNZ1.1
#=GS B6ULH6_HBV/31-212    AC B6ULH6.1
#=GS Q3LTZ9_HBV/2-183     AC Q3LTZ9.1
#=GS Q2L5B4_HBV/2-20      AC Q2L5B4.1
#=GS Q14U84_HBV/31-78     AC Q14U84.1
#=GS G9G9D7_HBV/31-212    AC G9G9D7.1
#=GS D3TK01_HBV/31-118    AC D3TK01.1
#=GS G3XGU3_HBV/2-183     AC G3XGU3.1
#=GS Q67978_HBV/31-212    AC Q67978.1
#=GS Q8QP40_HBV/1-132     AC Q8QP40.1
#=GS H9BE09_HBV/31-212    AC H9BE09.1
#=GS B4Z252_HBV/2-41      AC B4Z252.1
#=GS C4P1A9_HBV/31-76     AC C4P1A9.1
#=GS D3J5N9_HBV/31-57     AC D3J5N9.1
#=GS CAPSD_HBVC4/2-183    AC P0C6H6.1
#=GS B4Z1U9_HBV/31-84     AC B4Z1U9.1
#=GS C7AYU5_HBV/31-214    AC C7AYU5.1
#=GS C4P101_HBV/31-76     AC C4P101.1
#=GS Q2L5H0_HBV/2-24      AC Q2L5H0.1
#=GS Q45F33_HBV/31-212    AC Q45F33.1
#=GS Q5DWM8_HBV/31-212    AC Q5DWM8.1
#=GS G1E833_HBV/31-212    AC G1E833.1
#=GS G0Z304_HBV/2-121     AC G0Z304.1
#=GS Q6TMG9_9HEPA/2-262   AC Q6TMG9.1
#=GS D8VBJ6_HBV/2-51      AC D8VBJ6.1
#=GS G9I203_HBV/2-183     AC G9I203.1
#=GS Q91A50_HBV/31-66     AC Q91A50.1
#=GS D2JMD0_HBV/2-183     AC D2JMD0.1
#=GS B6DQE4_HBV/31-213    AC B6DQE4.1
#=GS D8VB85_HBV/31-78     AC D8VB85.1
#=GS G1E8E5_HBV/31-212    AC G1E8E5.1
#=GS C4P122_HBV/31-76     AC C4P122.1
#=GS G1C8Z8_HBV/2-183     AC G1C8Z8.1
#=GS D8VC37_HBV/2-50      AC D8VC37.1
#=GS Q6I6P0_HBV/31-74     AC Q6I6P0.1
#=GS D8V9U3_HBV/1-96      AC D8V9U3.1
#=GS Q2L5B3_HBV/2-20      AC Q2L5B3.1
#=GS Q81149_HBV/2-82      AC Q81149.1
#=GS B5LIK5_HBV/2-159     AC B5LIK5.1
#=GS HBEAG_WHV4/32-218    AC P0C6J5.1
#=GS D3YG94_HBV/2-183     AC D3YG94.1
#=GS Q2EGD1_HBV/31-86     AC Q2EGD1.1
#=GS C4P119_HBV/31-76     AC C4P119.1
#=GS H6UGS7_HBV/2-183     AC H6UGS7.1
#=GS D6QW37_HBV/2-183     AC D6QW37.1
#=GS H1ACX1_HBV/2-183     AC H1ACX1.1
#=GS B0B2J4_HBV/31-212    AC B0B2J4.1
#=GS D3J6B3_HBV/31-70     AC D3J6B3.1
#=GS D0E5C4_HBV/31-212    AC D0E5C4.1
#=GS D3J6A4_HBV/31-70     AC D3J6A4.1
#=GS Q91A48_HBV/31-66     AC Q91A48.1
#=GS C7DM43_HBV/2-183     AC C7DM43.1
#=GS Q3LTZ1_HBV/31-212    AC Q3LTZ1.1
#=GS Q89446_HBV/31-212    AC Q89446.1
#=GS D6P5B3_HBV/2-183     AC D6P5B3.1
#=GS D0EEG3_HBV/31-214    AC D0EEG3.1
#=GS G0Z2Z6_HBV/2-121     AC G0Z2Z6.1
#=GS B4Z1Q0_HBV/31-71     AC B4Z1Q0.1
#=GS B7SXU6_HBV/14-195    AC B7SXU6.1
#=GS B3VAW0_HBV/2-183     AC B3VAW0.1
#=GS D8VBE1_HBV/2-51      AC D8VBE1.1
#=GS Q8JSV3_HBV/1-130     AC Q8JSV3.1
#=GS Q77DJ1_9HEPA/45-305  AC Q77DJ1.1
#=GS E0D396_HBV/31-82     AC E0D396.1
#=GS C9WDP6_HBV/2-183     AC C9WDP6.1
#=GS Q2TJG1_HBV/1-122     AC Q2TJG1.1
#=GS B4Z4V5_HBV/31-70     AC B4Z4V5.1
#=GS B4Z3B0_HBV/31-66     AC B4Z3B0.1
#=GS Q00KA1_HBV/2-183     AC Q00KA1.1
#=GS B3VAV9_HBV/31-212    AC B3VAV9.1
#=GS B4Z1U0_HBV/31-80     AC B4Z1U0.1
#=GS H2ERK3_HBV/2-183     AC H2ERK3.1
#=GS Q5SDK6_HBVC1/31-212  AC Q5SDK6.1
#=GS D3J5L2_HBV/31-57     AC D3J5L2.1
#=GS B4Z312_HBV/2-37      AC B4Z312.1
#=GS B4Z2F2_HBV/31-66     AC B4Z2F2.1
#=GS C9WDQ2_HBV/31-212    AC C9WDQ2.1
#=GS D3J5X6_HBV/31-88     AC D3J5X6.1
#=GS Q4FD50_HBV/31-212    AC Q4FD50.1
#=GS Q8QSB9_HBV/31-212    AC Q8QSB9.1
#=GS B4Z294_HBV/31-66     AC B4Z294.1
#=GS D3J5U0_HBV/31-88     AC D3J5U0.1
#=GS Q60GZ3_HBV/31-71     AC Q60GZ3.1
#=GS B4Z2A3_HBV/2-37      AC B4Z2A3.1
#=GS H6UGP3_HBV/2-183     AC H6UGP3.1
#=GS C7DNK7_HBV/2-183     AC C7DNK7.1
#=GS C4P175_HBV/31-76     AC C4P175.1
#=GS D0EEM4_HBV/2-185     AC D0EEM4.1
#=GS E0D3A8_HBV/31-212    AC E0D3A8.1
#=GS B4Z678_HBV/31-70     AC B4Z678.1
#=GS B4Z484_HBV/31-68     AC B4Z484.1
#=GS D8VBU9_HBV/2-39      AC D8VBU9.1
#=GS C9W221_HBV/2-183     AC C9W221.1
#=GS C3W402_HBV/2-183     AC C3W402.1
#=GS C4P1R6_HBV/31-76     AC C4P1R6.1
#=GS B4YL09_HBV/2-183     AC B4YL09.1
#=GS B3VB51_HBV/2-183     AC B3VB51.1
#=GS H3K3N3_HBV/2-183     AC H3K3N3.1
#=GS C7DQR8_HBV/2-185     AC C7DQR8.1
#=GS C4P189_HBV/31-76     AC C4P189.1
#=GS Q91T05_HBV/31-212    AC Q91T05.1
#=GS B2LRT5_HBV/2-183     AC B2LRT5.1
#=GS C7DMK4_HBV/31-212    AC C7DMK4.1
#=GS G0Z2X5_HBV/2-121     AC G0Z2X5.1
#=GS C1K183_HBV/31-210    AC C1K183.1
#=GS D6QVW9_HBV/2-183     AC D6QVW9.1
#=GS B4Z3A5_HBV/2-37      AC B4Z3A5.1
#=GS D8VBI9_HBV/2-115     AC D8VBI9.1
#=GS B4Z626_HBV/31-70     AC B4Z626.1
#=GS C4P1K8_HBV/31-76     AC C4P1K8.1
#=GS B5BUT5_HBV/31-214    AC B5BUT5.1
#=GS Q7TF63_HBV/82-135    AC Q7TF63.1
#=GS D8VBG7_HBV/31-54     AC D8VBG7.1
#=GS H6V881_HBV/31-56     AC H6V881.1
#=GS C1K1L8_HBV/2-183     AC C1K1L8.1
#=GS Q9ELT4_HBV/31-152    AC Q9ELT4.1
#=GS CAPSD_HBVC0/2-183    AC Q9E6S6.1
#=GS B3VAI4_HBV/2-183     AC B3VAI4.1
#=GS B4Z2M6_HBV/2-41      AC B4Z2M6.1
#=GS Q7TDP9_HBV/2-183     AC Q7TDP9.1
#=GS G1EIH3_HBV/2-153     AC G1EIH3.1
#=GS B4Z5S2_HBV/2-42      AC B4Z5S2.1
#=GS B4Z425_HBV/2-39      AC B4Z425.1
#=GS Q8VBG9_HBV/2-183     AC Q8VBG9.1
#=GS A9PLE7_HBV/1-39      AC A9PLE7.1
#=GS D3J640_HBV/31-88     AC D3J640.1
#=GS Q8QSC8_HBV/31-212    AC Q8QSC8.1
#=GS C4P1F7_HBV/31-76     AC C4P1F7.1
#=GS D5LE12_HBV/2-183     AC D5LE12.1
#=GS H6UND1_HBV/2-183     AC H6UND1.1
#=GS I0DG72_HBV/31-212    AC I0DG72.1
#=GS A4UIM2_HBV/2-182     AC A4UIM2.1
#=GS B5TXS4_HBV/2-183     AC B5TXS4.1
#=GS B4Z2Y7_HBV/2-37      AC B4Z2Y7.1
#=GS D9U5E7_HBV/2-183     AC D9U5E7.1
#=GS Q1RN57_HBV/2-183     AC Q1RN57.1
#=GS D8VBB5_HBV/2-174     AC D8VBB5.1
#=GS D9U5H5_HBV/2-183     AC D9U5H5.1
#=GS B4Z1L5_HBV/31-71     AC B4Z1L5.1
#=GS D4I4S7_HBV/2-185     AC D4I4S7.1
#=GS E5CYX6_HBV/2-183     AC E5CYX6.1
#=GS HBEAG_HBVA8/31-214   AC Q4R1S8.1
#=GS H6UWI0_HBV/19-200    AC H6UWI0.1
#=GS B9VK30_HBV/2-183     AC B9VK30.1
#=GS C1K1Z3_HBV/2-183     AC C1K1Z3.1
#=GS G9G9R9_HBV/2-183     AC G9G9R9.1
#=GS B4Z663_HBV/31-70     AC B4Z663.1
#=GS E3Q0M0_HBV/2-183     AC E3Q0M0.1
#=GS A9CM40_HBV/2-183     AC A9CM40.1
#=GS Q19SV9_HBV/2-183     AC Q19SV9.1
#=GS G1EIJ7_HBV/2-153     AC G1EIJ7.1
#=GS Q68RN3_HBV/31-212    AC Q68RN3.1
#=GS E0ZNW1_HBV/2-110     AC E0ZNW1.1
#=GS Q76MY4_HBV/2-183     AC Q76MY4.1
#=GS D0EE07_HBV/2-185     AC D0EE07.1
#=GS E5D5N5_HBV/1-176     AC E5D5N5.1
#=GS CAPSD_HBVD2/2-183    AC P24023.2
#=GS D0EED8_HBV/2-185     AC D0EED8.1
#=GS C7DN22_HBV/2-183     AC C7DN22.1
#=GS B0FD73_HBV/2-183     AC B0FD73.1
#=GS D8VBN5_HBV/2-51      AC D8VBN5.1
#=GS D3J6H2_HBV/31-70     AC D3J6H2.1
#=GS C4P1M9_HBV/31-76     AC C4P1M9.1
#=GS B4Z2U0_HBV/2-41      AC B4Z2U0.1
#=GS G8Z912_HBV/2-139     AC G8Z912.1
#=GS B7TUT0_HBV/2-183     AC B7TUT0.1
#=GS B4Z4W1_HBV/31-70     AC B4Z4W1.1
#=GS B7TUS3_HBV/2-183     AC B7TUS3.1
#=GS Q1MSU7_HBV/2-144     AC Q1MSU7.1
#=GS C0LKI3_HBV/2-183     AC C0LKI3.1
#=GS C7AY37_HBV/31-214    AC C7AY37.1
#=GS Q8AYZ4_HBV/2-88      AC Q8AYZ4.1
#=GS D3TIQ5_HBV/2-183     AC D3TIQ5.1
#=GS Q1MSR7_HBV/31-173    AC Q1MSR7.1
#=GS C4P1J7_HBV/31-76     AC C4P1J7.1
#=GS E5RN29_HBV/1-162     AC E5RN29.1
#=GS D8VBJ8_HBV/31-80     AC D8VBJ8.1
#=GS G0Z2X3_HBV/2-121     AC G0Z2X3.1
#=GS B4Z309_HBV/2-37      AC B4Z309.1
#=GS B4Z3Q3_HBV/31-68     AC B4Z3Q3.1
#=GS CAPSD_HBVC7/2-183    AC P0C6H7.1
#=GS B4YLK0_HBV/31-212    AC B4YLK0.1
#=GS B4Z1J4_HBV/31-71     AC B4Z1J4.1
#=GS Q8BCB6_HBV/31-214    AC Q8BCB6.1
#=GS B4Z1H1_HBV/2-40      AC B4Z1H1.1
#=GS H6V8A1_HBV/31-56     AC H6V8A1.1
#=GS B1ABM1_HBV/31-210    AC B1ABM1.1
#=GS B2Y700_HBV/31-212    AC B2Y700.1
#=GS B4Y4H6_HBV/2-183     AC B4Y4H6.1
#=GS Q7TED9_HBV/31-163    AC Q7TED9.1
#=GS B7TTC7_HBV/2-183     AC B7TTC7.1
#=GS G9G9T5_HBV/2-53      AC G9G9T5.1
#=GS D3J5U1_HBV/31-88     AC D3J5U1.1
#=GS B4Z2U8_HBV/31-70     AC B4Z2U8.1
#=GS C4P1L5_HBV/31-76     AC C4P1L5.1
#=GS A8R7F5_HBV/31-212    AC A8R7F5.1
#=GS C4P1U9_HBV/31-76     AC C4P1U9.1
#=GS H6UGU6_HBV/2-183     AC H6UGU6.1
#=GS C4P1L3_HBV/31-76     AC C4P1L3.1
#=GS C9WDH8_HBV/2-183     AC C9WDH8.1
#=GS B4Z2V1_HBV/31-70     AC B4Z2V1.1
#=GS D3TKA9_HBV/2-183     AC D3TKA9.1
#=GS HBEAG_GSHV/32-217    AC P03153.1
#=GS D3J5T1_HBV/31-57     AC D3J5T1.1
#=GS A9PLE5_HBV/1-39      AC A9PLE5.1
#=GS B6CIU7_HBV/31-173    AC B6CIU7.1
#=GS D8VBF2_HBV/2-36      AC D8VBF2.1
#=GS B5TXT0_HBV/2-183     AC B5TXT0.1
#=GS B9VJX3_HBV/2-183     AC B9VJX3.1
#=GS C4P1J6_HBV/31-76     AC C4P1J6.1
#=GS E0ZP01_HBV/31-139    AC E0ZP01.1
#=GS D3J6F9_HBV/31-70     AC D3J6F9.1
#=GS C4RU88_HBV/2-183     AC C4RU88.1
#=GS Q1JUR5_HBV/31-212    AC Q1JUR5.1
#=GS G9G9V6_HBV/2-183     AC G9G9V6.1
#=GS Q765D2_HBV/31-214    AC Q765D2.1
#=GS Q6TYG6_HBV/31-182    AC Q6TYG6.1
#=GS B3VB02_HBV/31-212    AC B3VB02.1
#=GS B4Y4L2_HBV/31-212    AC B4Y4L2.1
#=GS D0EE06_HBV/31-214    AC D0EE06.1
#=GS H6UG88_HBV/2-183     AC H6UG88.1
#=GS C4P1V1_HBV/31-76     AC C4P1V1.1
#=GS Q60H14_HBV/31-71     AC Q60H14.1
#=GS F4MJD8_HBV/31-81     AC F4MJD8.1
#=GS E5CZ24_HBV/31-212    AC E5CZ24.1
#=GS Q1MSN9_HBV/31-173    AC Q1MSN9.1
#=GS B3VAP0_HBV/2-183     AC B3VAP0.1
#=GS D8VBX7_HBV/2-51      AC D8VBX7.1
#=GS C0LKQ6_HBV/2-183     AC C0LKQ6.1
#=GS B4Z427_HBV/31-68     AC B4Z427.1
#=GS D0E624_HBV/31-212    AC D0E624.1
#=GS A4ZRG0_HBV/31-163    AC A4ZRG0.1
#=GS C4P0Z6_HBV/31-76     AC C4P0Z6.1
#=GS C4P1I4_HBV/31-76     AC C4P1I4.1
#=GS B4X6J7_HBV/31-88     AC B4X6J7.1
#=GS D0EEF7_HBV/2-185     AC D0EEF7.1
#=GS Q9QRQ7_HBV/2-131     AC Q9QRQ7.1
#=GS D3YG32_HBV/2-183     AC D3YG32.1
#=GS Q91S90_HBV/31-212    AC Q91S90.1
#=GS Q60H06_HBV/31-71     AC Q60H06.1
#=GS Q68077_HBV/31-212    AC Q68077.1
#=GS Q9E8K7_HBV/2-183     AC Q9E8K7.1
#=GS Q8JSV0_HBV/1-130     AC Q8JSV0.1
#=GS Q6RSE4_9HEPA/45-305  AC Q6RSE4.1
#=GS D2JMT2_HBV/2-183     AC D2JMT2.1
#=GS C4P1K5_HBV/31-76     AC C4P1K5.1
#=GS D8VC79_HBV/2-51      AC D8VC79.1
#=GS D8VCH5_HBV/31-65     AC D8VCH5.1
#=GS B7TUP1_HBV/31-212    AC B7TUP1.1
#=GS Q1MST8_HBV/31-173    AC Q1MST8.1
#=GS B4Z3Z8_HBV/2-39      AC B4Z3Z8.1
#=GS D0UDV7_HBV/31-212    AC D0UDV7.1
#=GS B4Z1N6_HBV/2-42      AC B4Z1N6.1
#=GS D0EEN0_HBV/2-185     AC D0EEN0.1
#=GS G0Z2V8_HBV/2-121     AC G0Z2V8.1
#=GS E0ZNT8_HBV/2-110     AC E0ZNT8.1
#=GS B6D6I3_HBV/31-98     AC B6D6I3.1
#=GS Q6TYH1_HBV/31-182    AC Q6TYH1.1
#=GS D8VBF5_HBV/2-130     AC D8VBF5.1
#=GS Q7TEE4_HBV/31-163    AC Q7TEE4.1
#=GS Q806D1_HBV/31-212    AC Q806D1.1
#=GS D3YG69_HBV/31-212    AC D3YG69.1
#=GS D3J5N4_HBV/31-57     AC D3J5N4.1
#=GS A4ZRG1_HBV/2-134     AC A4ZRG1.1
#=GS H6V5S1_HBV/2-183     AC H6V5S1.1
#=GS B7TUM1_HBV/31-212    AC B7TUM1.1
#=GS C4P1A3_HBV/31-76     AC C4P1A3.1
#=GS B5M5C9_HBV/31-212    AC B5M5C9.1
#=GS B4Z375_HBV/2-37      AC B4Z375.1
#=GS B4Z6B7_HBV/31-70     AC B4Z6B7.1
#=GS D5LDF4_HBV/31-212    AC D5LDF4.1
#=GS B8PTH8_HBV/31-212    AC B8PTH8.1
#=GS G1E7U4_HBV/2-183     AC G1E7U4.1
#=GS D3J6D8_HBV/31-70     AC D3J6D8.1
#=GS C7DM29_HBV/31-212    AC C7DM29.1
#=GS Q8VBJ6_HBV/2-183     AC Q8VBJ6.1
#=GS E0ZS13_HBV/2-183     AC E0ZS13.1
#=GS Q2EGC4_HBV/31-97     AC Q2EGC4.1
#=GS E0ZNF8_HBV/31-176    AC E0ZNF8.1
#=GS A5GZP7_HBV/31-212    AC A5GZP7.1
#=GS B4Z5Y9_HBV/2-42      AC B4Z5Y9.1
#=GS Q80AH4_HBV/2-182     AC Q80AH4.1
#=GS A9QPY6_HBV/2-183     AC A9QPY6.1
#=GS Q91SZ6_HBV/31-212    AC Q91SZ6.1
#=GS C3W4L7_HBV/2-183     AC C3W4L7.1
#=GS G1E7J0_HBV/2-55      AC G1E7J0.1
#=GS D9ZK44_HBV/31-214    AC D9ZK44.1
#=GS G0Z310_HBV/2-64      AC G0Z310.1
#=GS C4P1A5_HBV/31-76     AC C4P1A5.1
#=GS B5L581_HBV/2-185     AC B5L581.1
#=GS D3J649_HBV/31-88     AC D3J649.1
#=GS B5B4B3_HBV/2-183     AC B5B4B3.1
#=GS Q6TYH9_HBV/31-182    AC Q6TYH9.1
#=GS B9VKN9_HBV/31-212    AC B9VKN9.1
#=GS I0DG36_HBV/31-212    AC I0DG36.1
#=GS D0E5Z7_HBV/31-212    AC D0E5Z7.1
#=GS B3VBA6_HBV/2-183     AC B3VBA6.1
#=GS B4Z5T2_HBV/31-71     AC B4Z5T2.1
#=GS Q60GW5_HBV/31-71     AC Q60GW5.1
#=GS Q5G3E9_HBV/33-56     AC Q5G3E9.1
#=GS H9BMX0_HBV/2-155     AC H9BMX0.1
#=GS B6ULI0_HBV/88-164    AC B6ULI0.1
#=GS Q6XGM8_HBV/2-185     AC Q6XGM8.1
#=GS A9PLE6_HBV/1-39      AC A9PLE6.1
#=GS A6YK00_HBV/2-124     AC A6YK00.1
#=GS Q404F5_HBV/2-183     AC Q404F5.1
#=GS D6QVV5_HBV/2-183     AC D6QVV5.1
#=GS Q19K69_HBV/31-62     AC Q19K69.1
#=GS E0ZNF6_HBV/2-153     AC E0ZNF6.1
#=GS D3J6D3_HBV/31-70     AC D3J6D3.1
#=GS I0DG48_HBV/31-212    AC I0DG48.1
#=GS E0ZP16_HBV/2-28      AC E0ZP16.1
#=GS Q1MSS2_HBV/31-173    AC Q1MSS2.1
#=GS E0ZND9_HBV/2-153     AC E0ZND9.1
#=GS Q60GX5_HBV/31-71     AC Q60GX5.1
#=GS C1KT99_HBV/31-210    AC C1KT99.1
#=GS Q7TED1_HBV/31-163    AC Q7TED1.1
#=GS D3TKB5_HBV/2-183     AC D3TKB5.1
#=GS Q8QSC2_HBV/31-212    AC Q8QSC2.1
#=GS D8VBG5_HBV/2-123     AC D8VBG5.1
#=GS C3W4E3_HBV/2-183     AC C3W4E3.1
#=GS B4Z4V9_HBV/2-41      AC B4Z4V9.1
#=GS G8Z914_HBV/2-139     AC G8Z914.1
#=GS Q5G3I9_HBV/2-25      AC Q5G3I9.1
#=GS Q6X5F8_HBV/1-130     AC Q6X5F8.1
#=GS B9VK38_HBV/2-183     AC B9VK38.1
#=GS E5RN25_HBV/1-162     AC E5RN25.1
#=GS C4P144_HBV/31-76     AC C4P144.1
#=GS D8VCM3_HBV/1-148     AC D8VCM3.1
#=GS B4Z455_HBV/2-39      AC B4Z455.1
#=GS B4Z4P2_HBV/31-70     AC B4Z4P2.1
#=GS B5ATF9_HBV/77-154    AC B5ATF9.1
#=GS Q09L20_HBV/2-20      AC Q09L20.1
#=GS Q4FDB6_HBV/31-212    AC Q4FDB6.1
#=GS D8VCE0_HBV/31-66     AC D8VCE0.1
#=GS I0DG61_HBV/31-212    AC I0DG61.1
#=GS G1EIG7_HBV/2-153     AC G1EIG7.1
#=GS C1KTB0_HBV/31-210    AC C1KTB0.1
#=GS E0ZNB6_HBV/2-143     AC E0ZNB6.1
#=GS B4Z3D6_HBV/2-42      AC B4Z3D6.1
#=GS Q80AG9_HBV/2-183     AC Q80AG9.1
#=GS Q8B112_HBV/31-212    AC Q8B112.1
#=GS G1E882_HBV/2-183     AC G1E882.1
#=GS B4Z696_HBV/31-70     AC B4Z696.1
#=GS A9CM36_HBV/2-183     AC A9CM36.1
#=GS B5BUU3_HBV/31-214    AC B5BUU3.1
#=GS Q9DTD0_HBV/2-183     AC Q9DTD0.1
#=GS Q8QSC5_HBV/31-212    AC Q8QSC5.1
#=GS C4P0X6_HBV/31-76     AC C4P0X6.1
#=GS D3J5Y6_HBV/31-89     AC D3J5Y6.1
#=GS Q918I8_HBV/2-183     AC Q918I8.1
#=GS Q991J6_HBV/31-212    AC Q991J6.1
#=GS G0Z300_HBV/2-121     AC G0Z300.1
#=GS Q1MSR6_HBV/31-173    AC Q1MSR6.1
#=GS B5ATD6_HBV/2-86      AC B5ATD6.1
#=GS Q19K68_HBV/31-62     AC Q19K68.1
#=GS I0DG41_HBV/31-212    AC I0DG41.1
#=GS Q9E0U3_HBV/2-123     AC Q9E0U3.1
#=GS I0DG20_HBV/31-212    AC I0DG20.1
#=GS D8VCC9_HBV/2-36      AC D8VCC9.1
#=GS D3YG76_HBV/2-183     AC D3YG76.1
#=GS Q1MSW2_HBV/31-173    AC Q1MSW2.1
#=GS C4P1R9_HBV/31-71     AC C4P1R9.1
#=GS Q2L5B6_HBV/2-20      AC Q2L5B6.1
#=GS D5LDK7_HBV/2-183     AC D5LDK7.1
#=GS B4Z4H8_HBV/31-70     AC B4Z4H8.1
#=GS D3J639_HBV/31-88     AC D3J639.1
#=GS D3J6D6_HBV/31-70     AC D3J6D6.1
#=GS B0YGL9_HBV/31-212    AC B0YGL9.1
#=GS I0DG45_HBV/31-212    AC I0DG45.1
#=GS F5C050_HBV/31-53     AC F5C050.1
#=GS B6CIU9_HBV/31-212    AC B6CIU9.1
#=GS D6QVU2_HBV/2-183     AC D6QVU2.1
#=GS B4Y4L9_HBV/31-212    AC B4Y4L9.1
#=GS Q6R7M8_HBV/14-151    AC Q6R7M8.1
#=GS B2CZW8_HBV/2-183     AC B2CZW8.1
#=GS Q6X5G5_HBV/13-186    AC Q6X5G5.1
#=GS Q00K57_HBV/2-183     AC Q00K57.1
#=GS D0UDX2_HBV/74-151    AC D0UDX2.1
#=GS Q2L5D3_HBV/2-20      AC Q2L5D3.1
#=GS C1KTB6_HBV/31-210    AC C1KTB6.1
#=GS D4HMY2_HBV/1-78      AC D4HMY2.1
#=GS Q991J5_HBV/31-212    AC Q991J5.1
#=GS Q60GV4_HBV/31-71     AC Q60GV4.1
#=GS B5TXW6_HBV/2-183     AC B5TXW6.1
#=GS B7TUJ8_HBV/31-212    AC B7TUJ8.1
#=GS Q9E0P5_HBV/31-152    AC Q9E0P5.1
#=GS B5B4A0_HBV/2-183     AC B5B4A0.1
#=GS E0ZP06_HBV/2-110     AC E0ZP06.1
#=GS D8VBJ1_HBV/2-109     AC D8VBJ1.1
#=GS A5GZI7_HBV/31-212    AC A5GZI7.1
#=GS A0A873_HBV/31-212    AC A0A873.1
#=GS G0Z312_HBV/2-121     AC G0Z312.1
#=GS D3YGN3_HBV/2-183     AC D3YGN3.1
#=GS H6V8C7_HBV/31-56     AC H6V8C7.1
#=GS D3J617_HBV/31-88     AC D3J617.1
#=GS B3VB44_HBV/2-183     AC B3VB44.1
#=GS Q9IHC8_HBV/108-163   AC Q9IHC8.1
#=GS B4Z3G4_HBV/2-42      AC B4Z3G4.1
#=GS Q7TF72_HBV/31-212    AC Q7TF72.1
#=GS G1E8Q0_HBV/31-212    AC G1E8Q0.1
#=GS E5RPN0_HBV/31-212    AC E5RPN0.1
#=GS C4P1E3_HBV/31-76     AC C4P1E3.1
#=GS C1KTC4_HBV/31-210    AC C1KTC4.1
#=GS G1E8I3_HBV/31-212    AC G1E8I3.1
#=GS E0ZRW8_HBV/2-183     AC E0ZRW8.1
#=GS D3YGH8_HBV/2-183     AC D3YGH8.1
#=GS Q2L5I2_HBV/2-24      AC Q2L5I2.1
#=GS C3W3T5_HBV/2-183     AC C3W3T5.1
#=GS B3VAT8_HBV/2-183     AC B3VAT8.1
#=GS G1E8N8_HBV/2-183     AC G1E8N8.1
#=GS D8VCB9_HBV/2-51      AC D8VCB9.1
#=GS D0E5I5_HBV/31-212    AC D0E5I5.1
#=GS Q60H02_HBV/31-71     AC Q60H02.1
#=GS B2MUD9_HBV/2-157     AC B2MUD9.1
#=GS E0ZR84_HBV/31-212    AC E0ZR84.1
#=GS D5LDM1_HBV/2-183     AC D5LDM1.1
#=GS I0DG37_HBV/31-212    AC I0DG37.1
#=GS B0B372_HBV/2-183     AC B0B372.1
#=GS G1EIJ4_HBV/2-153     AC G1EIJ4.1
#=GS B3VAU0_HBV/31-212    AC B3VAU0.1
#=GS G9G948_HBV/2-183     AC G9G948.1
#=GS D2JMU0_HBV/2-183     AC D2JMU0.1
#=GS D9U5B7_HBV/117-164   AC D9U5B7.1
#=GS C7AYK3_HBV/31-214    AC C7AYK3.1
#=GS B4Z377_HBV/31-66     AC B4Z377.1
#=GS B5M567_HBV/31-212    AC B5M567.1
#=GS O72886_9HEPA/45-305  AC O72886.1
#=GS Q2EGC3_HBV/31-99     AC Q2EGC3.1
#=GS B4Z1R3_HBV/2-42      AC B4Z1R3.1
#=GS D3J5L0_HBV/31-57     AC D3J5L0.1
#=GS B4Z469_HBV/31-68     AC B4Z469.1
#=GS E0ZNF2_HBV/31-182    AC E0ZNF2.1
#=GS B4Z3B3_HBV/31-66     AC B4Z3B3.1
#=GS B4Z1I2_HBV/31-71     AC B4Z1I2.1
#=GS B4Z679_HBV/2-41      AC B4Z679.1
#=GS D3TK49_HBV/2-183     AC D3TK49.1
#=GS Q1MSU4_HBV/2-144     AC Q1MSU4.1
#=GS D8VBI3_HBV/2-22      AC D8VBI3.1
#=GS Q6TYF9_HBV/31-182    AC Q6TYF9.1
#=GS Q2EGC7_HBV/31-84     AC Q2EGC7.1
#=GS Q784L0_HBVF5/31-212  AC Q784L0.1
#=GS Q5G3J1_HBV/2-25      AC Q5G3J1.1
#=GS Q7TDS8_HBV/2-183     AC Q7TDS8.1
#=GS Q60H03_HBV/31-71     AC Q60H03.1
#=GS A6MG39_HBV/2-183     AC A6MG39.1
#=GS D3TIP8_HBV/2-183     AC D3TIP8.1
#=GS B0B363_HBV/2-183     AC B0B363.1
#=GS Q91A70_HBV/31-66     AC Q91A70.1
#=GS Q60H42_HBV/31-71     AC Q60H42.1
#=GS A4ZRF7_HBV/2-134     AC A4ZRF7.1
#=GS C4P1C2_HBV/31-76     AC C4P1C2.1
#=GS C4P1G0_HBV/31-76     AC C4P1G0.1
#=GS B4Z3U7_HBV/31-68     AC B4Z3U7.1
#=GS B4Z1K4_HBV/2-42      AC B4Z1K4.1
#=GS C7DQS0_HBV/31-212    AC C7DQS0.1
#=GS Q2L5E4_HBV/2-20      AC Q2L5E4.1
#=GS B5BPM1_HBV/2-183     AC B5BPM1.1
#=GS D3J6C7_HBV/31-70     AC D3J6C7.1
#=GS Q1MSW4_HBV/31-173    AC Q1MSW4.1
#=GS Q6UE56_HBV/2-183     AC Q6UE56.1
#=GS D8V9U1_HBV/2-41      AC D8V9U1.1
#=GS Q6I6S0_HBV/31-71     AC Q6I6S0.1
#=GS F5C054_HBV/31-53     AC F5C054.1
#=GS B4Z2G4_HBV/2-37      AC B4Z2G4.1
#=GS Q66401_9HEPA/45-302  AC Q66401.1
#=GS D3J688_HBV/31-69     AC D3J688.1
#=GS D2U680_HBV/2-183     AC D2U680.1
#=GS Q9QAE2_HBV/31-212    AC Q9QAE2.1
#=GS C7DSI3_HBV/31-212    AC C7DSI3.1
#=GS B5TXK4_HBV/2-183     AC B5TXK4.1
#=GS B2Y6J7_HBV/2-183     AC B2Y6J7.1
#=GS G1EIJ5_HBV/2-153     AC G1EIJ5.1
#=GS Q9YL95_HBV/2-183     AC Q9YL95.1
#=GS Q00K85_HBV/2-183     AC Q00K85.1
#=GS Q9QB03_HBV/2-183     AC Q9QB03.1
#=GS D0EE45_HBV/31-214    AC D0EE45.1
#=GS G1E8D2_HBV/2-183     AC G1E8D2.1
#=GS Q60H15_HBV/31-71     AC Q60H15.1
#=GS C3W4L1_HBV/2-183     AC C3W4L1.1
#=GS B4X6J6_HBV/31-87     AC B4X6J6.1
#=GS Q1MST4_HBV/31-173    AC Q1MST4.1
#=GS B4Z482_HBV/2-39      AC B4Z482.1
#=GS Q14U81_HBV/31-214    AC Q14U81.1
#=GS Q9WMC5_HBV/31-212    AC Q9WMC5.1
#=GS H9BMU1_HBV/2-121     AC H9BMU1.1
#=GS B2Y6X2_HBV/31-212    AC B2Y6X2.1
#=GS Q917J8_HBV/2-183     AC Q917J8.1
#=GS Q45F47_HBV/2-183     AC Q45F47.1
#=GS B4Z1J8_HBV/2-42      AC B4Z1J8.1
#=GS Q2TJE0_HBV/31-212    AC Q2TJE0.1
#=GS C4P1A1_HBV/31-76     AC C4P1A1.1
#=GS D3J6B9_HBV/31-70     AC D3J6B9.1
#=GS C7DNE8_HBV/2-183     AC C7DNE8.1
#=GS H9BMV4_HBV/2-46      AC H9BMV4.1
#=GS B6ULK5_HBV/31-83     AC B6ULK5.1
#=GS Q2EGF6_HBV/31-99     AC Q2EGF6.1
#=GS Q68025_HBV/31-212    AC Q68025.1
#=GS B2CZU8_HBV/2-183     AC B2CZU8.1
#=GS B4Z5S6_HBV/31-71     AC B4Z5S6.1
#=GS A1KR42_HBV/2-25      AC A1KR42.1
#=GS B5M5V7_HBV/31-212    AC B5M5V7.1
#=GS Q68RQ3_HBV/2-183     AC Q68RQ3.1
#=GS Q9E0P3_HBV/2-123     AC Q9E0P3.1
#=GS Q2L5G6_HBV/2-24      AC Q2L5G6.1
#=GS D3YG50_HBV/2-183     AC D3YG50.1
#=GS E0ZRP5_HBV/31-212    AC E0ZRP5.1
#=GS Q5G3H4_HBV/2-25      AC Q5G3H4.1
#=GS B9VK07_HBV/31-212    AC B9VK07.1
#=GS E5CZ25_HBV/2-183     AC E5CZ25.1
#=GS HBEAG_WHV2/32-217    AC P0C6J3.1
#=GS D3J5S5_HBV/31-57     AC D3J5S5.1
#=GS Q8VBF7_HBV/2-183     AC Q8VBF7.1
#=GS C4P177_HBV/31-76     AC C4P177.1
#=GS D8V9U4_HBV/1-96      AC D8V9U4.1
#=GS B7TTT6_HBV/2-183     AC B7TTT6.1
#=GS D2JMF0_HBV/2-183     AC D2JMF0.1
#=GS Q7TDZ1_HBV/31-212    AC Q7TDZ1.1
#=GS Q5Q0T3_HBV/31-212    AC Q5Q0T3.1
#=GS Q67946_HBV/2-183     AC Q67946.1
#=GS Q917H7_HBV/31-214    AC Q917H7.1
#=GS C6L4A7_HBV/13-141    AC C6L4A7.1
#=GS A9PLG3_HBV/1-39      AC A9PLG3.1
#=GS Q2L5E2_HBV/2-20      AC Q2L5E2.1
#=GS D3J657_HBV/31-88     AC D3J657.1
#=GS Q6X5H6_HBV/2-183     AC Q6X5H6.1
#=GS B4Z2L3_HBV/31-70     AC B4Z2L3.1
#=GS E0ZNV9_HBV/2-20      AC E0ZNV9.1
#=GS Q6R2W5_HBV/2-183     AC Q6R2W5.1
#=GS C4P1F2_HBV/31-76     AC C4P1F2.1
#=GS CAPSD_HBVD6/2-183    AC P0C6I2.1
#=GS A9PLE1_HBV/1-39      AC A9PLE1.1
#=GS B4Z3I7_HBV/31-68     AC B4Z3I7.1
#=GS A7M687_HBV/2-183     AC A7M687.1
#=GS B9VKE3_HBV/31-212    AC B9VKE3.1
#=GS D3J622_HBV/31-88     AC D3J622.1
C7DMT1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTFGREPVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q8QXQ4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLDDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2D9_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6V8B5_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G4XMN0_HBV/31-212               .............DIDPYKEFGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B2CZU7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIQDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D4I4R5_HBV/2-185                .............DIDPYKEFGATVELISF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGNNLEDPASRDLVVNY.........................................VNNTTGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B4Z664_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4X6M3_HBV/31-86                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q80GY3_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C3W3U1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPS.........RRRCQSPRRR.................RSQSRESQC.....................
Q09L00_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8QSD2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASVL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3T4_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q80GX6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLDDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2L5C6_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3E7_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C1K1K7_HBV/31-210               .............DIDPYKEFGASVESLSF.LPSDFFPAIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
B4Z2S5_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1C958_HBV/2-183                .............DIDPYKEFGATVELLSF.LPTDFYPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.ICWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSRESQC.....................
D8VBQ5_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHY..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
I0DG74_HBV/31-212               .............DIDPYKEXGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q6TYH7_HBV/31-182               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISWLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
Q7T4V4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPAVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPTSRDLVVTY.........................................VNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q9WJE5_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMSLASWVGNNLEDPASRELVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....FSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B4Z2Y1_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDLFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
A1YTM1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B6D6C3_HBV/31-68                .............DIDPYKEFGASVELXSF.LPSDFFPSIRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C1K178_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RRAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBU4_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPNDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8V9T5_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDQASRDLVVSY.........................................VNVNMGLKLRQILWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B2CZI2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60GX8_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z3F7_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
E0ZRU6_HBV/2-183                .............DIDPYKEFGATVELLSF.LPTDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDPASRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLIFGRDVVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q2EGG9_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNXA-------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------t....................
D0UE71_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVRY.........................................VNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3TJB6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRPQSPRRR.................RSQSRESQC.....................
B4X6K6_HBV/31-87                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RP--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------a....................
D3YFZ0_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DAASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHTSCLTFGRDTVLEFLVSFGVWIRTPPAYRPTNAPI....LSTLPETCVVRR..RR-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q778I9_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2MLQ1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
D8VB94_HBV/31-203               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................---------.....................
D3J5R6_HBV/31-57                .............DIDPYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B3VAW9_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLSFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A9CM65_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSARDLL.DTASAL..FREALESPEHC..SSHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCISFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RC-----RSTG.RRTPSPR.........RPRSKSPRRR.................RSQSRESQC.....................
C4P1J9_HBV/31-76                .............DIDPYKEFEASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B0FCS6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDFL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGVLMNLATWVGSNLENPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G1EII6_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLAXWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
Q8QP34_HBV/1-130                .............-----------------.-------------.------..-----------..-----AL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q77BF8_HBV/1-96                 .............-----------------.-------------.------..-----------..-------....----.----------------------------Y.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTIPETCVIRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
B4Z610_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1N5_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D8VB73_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................KSQSPESQC.....................
D0EYW5_HBV/2-157                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YREALESPEHC..SPHHTAL....RQDI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSP-.-------.........----------.................---------r....................
Q09KV9_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G3E5C0_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMSLASWVGNNLEDPASKELVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B4Z301_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D5LFH7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLVDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J612_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....SQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q09L37_HBV/2-20                 .............DIDPYKEFGATVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B2Y6J0_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGDVTNLATWVGTNLNDPASRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2EX83_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAV.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETGVVRQ..RG-----RSSR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2V7_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B3VAT4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESTEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLDDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPEITVVRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSPSRGSQC.....................
H6V899_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TV83_HBV/2-183                .............DIDXYKEFGASXELLSF.LPSDFFPSIRDLX.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D0EE65_HBV/31-214               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAI....RQVV.LCWGELMTLATWVGNNLQDQASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1G3_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0ESR3_HBV/31-212               .............DIDPYKKFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2L5A2_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P1D8_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B9VL59_HBV/2-183                .............DIDPYKEFGASLQLLSF.LPADFFPSVRDLL.DTAIAL..FREALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGSNLEDPVSRELVVNY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPIAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z213_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C1K210_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTVSAL..YREALEAPEHC..SPHHTAI....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RPPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
C4P1T4_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8JSV1_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLGTWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
B9VL47_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..HREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J2Y8_HBV/31-212               .............DIDSYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z635_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q89656_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZP79_HBV/2-110                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTF-----------------------------....------------..-----------.-------.........----------.................---------.....................
Q00K93_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTATAL..YREALESSEHC..SYHHTAL....RQAI.LCWGELMTLASWVGNNLDDPASRDLVVNY.........................................VNTNMGLKIRQLLWYHLSCLTFGRDTVHEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----GSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q09KY5_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q68006_HBV/2-183                .............DIDPYKEFGATVEVPSF.LPSHFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGKLMTLATWVGVNSEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIATPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4X6J8_HBV/31-88                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------gn...................
A9QPV3_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNVGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
A1KR50_HBV/2-25                 .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C1K1P9_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVSY.........................................VNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D2U672_HBV/2-183                .............DIDPYKEFGAXVXLLSF.LPSDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMALATWVGVNLEDPASRDLVVSY.........................................VNSHMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPG.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3S1_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.GTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q80J67_HBV/2-81                 .............DIDAYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....GQAI.LCWGELMNLATWVGSNLEDPA--------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C5WJY1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHLSCLMFGRXTVLEYLVSFGVWIRTPAAYRPSNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
G1E8M3_HBV/31-212               .............DIDPYKEFGAAVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVTY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1G8_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8V9U6_HBV/58-159               ........xxxxx-----------------.-------------.--XSAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPP---------....------------..-----------.-------.........----------.................---------.....................
E0D3A4_HBV/31-82                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHT--....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q60H07_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q4W6F7_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMNLGTWVGGNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPI....VSTLPENTVVRR..RS-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
G1EIK1_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
C4P1F3_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
A9PLF3_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
Q03731_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPGRR.................RSQSRESQC.....................
Q8B8Q4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGSNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................KSQSPASQC.....................
B4Z3K5_HBV/31-68                ............h-IDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6UGN7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLIVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPLAYRPTNAPI....LSTLPETTVVRG..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSPSRGSQC.....................
B4ZYV5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGSNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3TK42_HBV/110-160              ...........sr-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................----------------------------------------------ENAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D5LDB2_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSRSPRRR.................RSQSRESQC.....................
Q99HT2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVXH.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPI....LSTLPETAVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q1MSM6_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
B6D6C6_HBV/31-142               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRE--------------------------....------------..-----------.-------.........----------.................---------.....................
G1E7C8_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
D0UE66_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPPVRDLL.DTASAL..YREALESSEHC..SPHHTAL....RQAI.LCWGELMDLATWVGGNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTPYRPPNAPI....LSTLPETTVVRG..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
H9BMW3_HBV/24-182               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRT----.........----------.................---------.....................
Q80AH5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SSHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G1E7K2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTASAL..YRGALESSEHC..SPHHTAL....RQAV.LCWGDLINLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B4Z422_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7AY50_HBV/2-185                .............DIDPYKEFGATVELLSF.LPYDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDAASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D8VBF0_HBV/2-130                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPP---------....------------..-----------.-------.........----------.................---------.....................
Q2L568_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
A1KR40_HBV/2-25                 .............DIDPYKRIGATVELLSF.KPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z251_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8VBI8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQEI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2L4M5_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8VBK3_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZNT2_HBV/2-89                 .............DIDPYKEFGATVELLSF.LPHDFYPSVRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.LCWGELTSLGTWVNNNLQYQASRDLVVNY.........................................V--------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z222_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D9U5F4_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDQASRDLVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B5MEX2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGANLDDPASRESVVSY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
B4Z666_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1C8C6_HBV/2-183                .............DIDPYKEFGASVDLLSF.LPSDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDSTSRDLVVGY.........................................VNSNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
A9PLG4_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
A8KQC0_HBV/31-212               .............DIDPYKEFGPSVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q68070_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LLTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q45F91_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H9N874_HBV/2-183                .............DIDPYKEFGATVELLAF.LPADFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q68075_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQRI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRT.................RSQSRESQC.....................
Q77BF6_HBV/1-96                 .............-----------------.-------------.------..-----------..-------....----.----------------------------Y.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTIPETCVIRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
B4YKM2_HBV/2-185                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q1MSK0_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRNLL.DTASAL..YRDALKSPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKXRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
D0EDU6_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2Q3_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z326_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D4HMX8_HBV/1-77                 .............---PYKEFGATVELLSF.LPHDFYPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPAS-------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6X5H1_HBV/1-54                 .............DIDPYKEFGATVELLSS.LPSDFFPSVRDLL.DTASSP..YCTQA------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------snsllgrtndssh........
B3IVL9_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQ-r....................
G9G9B7_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3F9_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z633_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B9VKU6_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDQASRDLVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C1K173_HBV/2-181                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQVC.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
Q80H14_HBV/31-169               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHLSCLTFGREVVLEYLVSFGVWIRTPPAYRPQNALI....L-----------..-----------.-------.........----------.................---------.....................
Q2EGE9_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLA-------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------t....................
D0EE34_HBV/2-185                .............DIDPYKEFGASVELLSF.LPFDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELTNLGTWVGNNLEDQASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1G6_HBV/31-76                .............DIDPYKEFGATVELLSF.SPPDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8B4H0_HBV/31-214               .............DIDPHKEFGATVELLSF.LPSDFFPSARDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RD---RGRFPR.RRTPSPR.........RRRSQSPLRR.................RSQSRESQC.....................
C7AYR7_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAI....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
G1E7N3_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRASQC.....................
C7AYN3_HBV/31-212               .............DIDLYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLDDPVSRDLVVNY.........................................VNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYXPQNAPI....LSTLPETXVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B4Z4U3_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C0LKF3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQPRESQC.....................
Q91A84_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8B4C7_HBV/2-183                .............DTDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8JSW5_HBV/1-130                ............v-----------------.LPSDFFPSVRDLL.DTASAL..DREALKFPEPC..SPHHTAL....RPAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
B4Z2N8_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6I6T2_HBV/31-71                .............DIDPYKEFGATVELISF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D3TJA3_HBV/74-118               ...........sn-----------------.-------------.-----L..EREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEE----------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------y....................
D8VCG6_HBV/2-51                 .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P1U2_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J6C3_HBV/31-70                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E5CZ15_HBV/2-183                .............DIDPYKEFGASVEVLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWLGSNLKDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7AYK0_HBV/2-185                .............DIDPYKEFGATVELLSF.LPADFFPSARDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLTTLGSWVGNNLEDQASRALVVNY.........................................VDTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RN---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2Z3_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
HBEAG_HBVA2/31-214              .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBP3_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5TXU0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3GIM8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPGSRDLVVTY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRS..RG-----RSLR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H6UN87_HBV/2-185                .............DIDPYKEFGATVELLSF.LPPDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAV.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPI....LSTLPETTVVRC..RG---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E9L5E8_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q45F31_HBV/2-183                .............DIDTYKEFEASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2EX71_HBV/2-183                .............DIDHYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
E0ZNB1_HBV/2-147                .............DIDPYKEFGATGELLSF.LPFDFFPSVKDFL.DPASAL..YREPLEFPDHC..SPPHTAL....RQAI.FCWGELMTLAPWGGNNLEDPASRDLVVNY.........................................VNTNLGLKIRQLLGFHISSLTFGRETVLEYLVSFGGGIRTPPPYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
A3RF49_HBV/31-205               .............DIDPYKEFGASVELLSF.LPSDFFPTIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPSYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RS-------.....................
D8VBN7_HBV/2-48                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2L5E6_HBV/2-24                 .............DIDPYKEFGASVELLSF.LPSDFF-------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z5X1_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
F5C1D9_HBV/43-224               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B5B4D8_HBV/94-173               ............f-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................----------------ISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P158_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z369_HBV/2-37                 .............DIDPYKEFGATVELLSS.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1Z2_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z249_HBV/2-38                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASSX..Y----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H9BMT2_HBV/28-192               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........----------.................---------.....................
C4P136_HBV/31-76                .............DIDPYKEFGATVESLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z2D0_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H9BMW0_HBV/2-160                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRT----.........----------.................---------.....................
Q6I6U8_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B5M5A4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z5V4_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.GTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q9IHD2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTAAAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNENMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRQSQC.....................
H9BMT7_HBV/2-160                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRT----.........----------.................---------.....................
Q91C44_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLDDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G0Z2Y5_HBV/2-121                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
Q2L5C0_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7AYE2_HBV/2-185                .............DIDPYKEFGATVELLSF.LPTDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRG..RP---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZNC4_HBV/31-171               .............DIDPFKKFGATGELLSF.LPFDFFPSVRDFL.DTPSAL..YREALEFPEHC..SPPHTAL....RQAI.FCWGEIMTLATWGGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLGFPISCLTFGKETVIEYLVSFGGGIPPPPAYRPPNAPI....LST---------..-----------.-------.........----------.................---------.....................
C7DML1_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q60GU9_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASDL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C4P1N3_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VC41_HBV/31-80                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G8Z909_HBV/2-139                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....------------..-----------.-------.........----------.................---------.....................
E0ZNH7_HBV/31-182               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
B4Z371_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
A0MML2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBR0_HBV/31-80                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5B4Q7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFERETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2LCA5_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFYPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCPTFGREVVVEYLVSFGVWIRTPPAYKPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B4Z6A6_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q30BH1_HBV/31-113               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEDC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASREL----.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B6ULI2_HBV/31-93                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWG-------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------r....................
D8VBC8_HBV/31-144               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETV------------------------....------------..-----------.-------.........----------.................---------.....................
Q09L40_HBV/2-20                 .............DIDPYKEFGATVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7DN80_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGXLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSCGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q9IGW2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGSNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
G1EIH5_HBV/2-153                .............DIDPYKEFGASXELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
C4P0Z8_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z621_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1ETT9_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................KSQSRESQC.....................
B4Z6B8_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7DNK0_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHG..SPHHTAL....RQAI.LCWGDLMTLATWVGENLEDPASRDLVVSY.........................................VNTNAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B4Z660_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1L9_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q75TM1_HBV/31-214               .............DIDPHKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z1G6_HBV/2-40                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------cigk.................
D3TJB0_HBV/2-183                .............DIDPYKEFGASAPLLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G9G8U1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLZDXTSRDLVVXY.........................................VNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C3W4B7_HBV/2-182                .............DIDPYKEFGATVQLLSF.LPADFFPSVRDLL.DTASAL..YREALESXEHC..SPHHTAL....RQAI.LCWGDLMSLATWVGGNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWMRTPPAYRPTNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQ-.....................
C3W3P4_HBV/2-183                .............DIDPYKEFGATVQLLSF.LPVDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMSLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPANAPI....LSTLPEXTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B3VB90_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7DNJ4_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTTPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
D7NKV2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2EGD4_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLA-------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------t....................
G1E7Q8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAV.LCWGELMSLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVLEYLISFGVWMRTPPAYRPPNAPI....LSTLPETSVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D0E6L5_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQCI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRG..RR-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G0Z2W5_HBV/2-121                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
B2CZW1_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5T3_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALKSPEHC..SPHHTAL....RQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2EGG6_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLA-------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------t....................
D3K2D7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGNNLEDPASRELVVSY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H6UGC3_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SYHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A1KR47_HBV/2-25                 .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q68016_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRALL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
C7DSJ8_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q4FDB2_HBV/31-212               .............DIDPYKEFGASQELISF.LPSDFFPTIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMSLATWVGGNLDDPASRDAVVSY.........................................VNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSRESQC.....................
Q98VI7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B7TUP2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q9WMC1_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H9BMW8_HBV/2-160                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRT----.........----------.................---------.....................
B4Z693_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q7THR9_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAT.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETMLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
Q991K4_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..HREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q67933_HBV/2-183                .............DIDPYKEFGASVELLSF.LPTDFFPSVRDLL.DTATAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETCVIRQ..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
I0DG24_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQXRESQC.....................
B3VBA8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPHDFFPSVRDLL.DTASAL..YRDALESPEHV..SPHHTAL....RQAI.LCWGDLMNLATWVGGNLQDPTSRDQVVSY.........................................VNTNVGLKFRQLLWFHVSCLMFGRETVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RPRSQSPRRR.................RSQSRGSQC.....................
B5MEV6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.LCWGELMNLATWVGSNLDDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9QRQ5_HBV/2-176                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RS-------.....................
Q67883_HBV/2-183                .............DIDPYKEFGASMELLSF.LPSDFYPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3W0_HBV/2-39                 .............DIDPYKEFGATVELLLF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TTX4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLI.DTASAL..HREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G1C8B8_HBV/31-84                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAH..LT---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------ilhsgkqffaggtnds.....
E0ZNI0_HBV/31-182               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
B5ATD0_HBV/31-212               .............DIDTYKEFGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVNY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPC.........RRRSQSPRRR.................RSKSRESQC.....................
I0DG29_HBV/31-212               .............DIDXYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.XCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VC47_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0E6H1_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9WMB6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z1Q3_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B6ULL4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
I0DG34_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALXSPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2L582_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z4Q1_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VC46_HBV/31-80                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6X5G2_HBV/1-119                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRD--------..---HTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVNY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
Q2EIE8_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRKSQC.....................
H3K3C9_HBV/2-185                .............DIDPYKEFGAXVELLSF.LPSDFFPSXRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMXLATWVGXNLEDPASRXLVVXY.........................................VNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZNG2_HBV/2-142                .............DIDPYKKFGATGELLSF.LPFDFFPSVRDFL.DTPSAL..YREALEFPEHC..SPHHTAL....RQAI.FCWGEIMTLATWGGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCFTFGRETVIEYLVSFGVWIPPPPAYRPPNAPI....LST---------..-----------.-------.........----------.................---------.....................
D3YG38_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..FRESLESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESHC.....................
Q9WMC8_HBV/31-212               .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5X4_HBV/31-87                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....SQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
E5RD36_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALKSPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGKKTVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRK.................RSQSRESQC.....................
B0FCJ7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALEPPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q80GV3_HBV/2-181                .............DIDTYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDQASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
B5A2F5_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
A9PLC5_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPESTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
B4Z4I3_HBV/2-41                 .............DIDPYKEFGATVELHSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q7TF62_HBV/31-75                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESP---..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------a....................
Q8VBH2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LWWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPGRR.................RSQSRASQC.....................
H6UN71_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGANLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z4S6_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E6T3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9E0V7_HBV/2-123                .............DIDPYKEFGATVELISF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGANLDDPASRDLVVTY.........................................VNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
Q7TED0_HBV/31-163               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
B4YKX5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLGFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBH4_HBV/2-24                 .............DIDPYKEFGASVELLSF.LPSDFF-------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EYV7_HBV/2-158                .............DIDPYKEFGASGELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELTTLGTWVGNNLQDPASRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RDRG-------.-------.........----------.................---------rsp..................
D8VC66_HBV/31-65                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5M521_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H9BMQ6_HBV/2-121                .............DIDPYKEFGATVELLSF.LPHDFYPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
Q81130_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5W1_HBV/31-73                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALES----..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6TYF0_HBV/31-182               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALKSPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISWLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
D8VCG9_HBV/2-48                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9QB17_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J634_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_HBVB1/2-183               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTVSAL..YREALKSPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B7TUL6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELLNLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q81146_HBV/2-82                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASR------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5N8_HBV/31-57                .............DIDPYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8JSW0_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMSLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
D3TKD5_HBV/2-183                .............DIDPYKEFGASMELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8V9V2_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.HTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_HBVCP/2-183               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
#=GR CAPSD_HBVCP/2-183    SS    .............XXXXXXXXXXXXXXXX-.---S-----XXXX.XXXXXX..XXXXXXXXXXX..XXXXXXX....XXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXX.........................................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XXXXXXXXXXXX..XX-----XXXX.XXXXXXX.........XXXXXXXXXX.................XXXXXXXXX.....................
D5LFJ5_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVGY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B3V3R4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELVTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q784R8_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
E0ZN78_HBV/2-153                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---------.-------.........----------.................---------.....................
B4X6M9_HBV/31-86                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q45F24_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A9PLD1_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPESTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
D3J615_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------k....................
Q8QP16_HBV/1-130                .............-----------------.-------------.------..-----------..-----AL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z651_HBV/31-70                .............DIDPYKEFGATMELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1G8_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPPVRDLL.DSASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q60GY2_HBV/2-42                 .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTASAL..FLEA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z641_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3E4_HBV/31-71                .............DIDPYKEFGATVXLLSF.LPSDFFPSVRDLL.DTASAL..YXEA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D8VCG8_HBV/31-77                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1G3_HBV/2-40                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------cigk.................
B3VAK6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPTDFFPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPTNAPI....LSTLPETCVVRQ..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3TK67_HBV/31-86                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....R---.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------p....................
B0YK30_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHR..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPPNAPI....LSTLLETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2D4_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P131_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G9G9S9_HBV/31-80                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREAT------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------ilhsgkqff............
D5LEG7_HBV/2-183                ............g-IDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D5LDZ2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHPTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1N2_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G9G8M5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGXLXTLXTWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J665_HBV/31-68                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5B4E9_HBV/2-85                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLAAWVGSNLEDPASREF----.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------e....................
Q09KV1_HBV/2-20                 .............DIDPYKEFGATVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5B4Q0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P138_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2EGD3_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNL--------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------gh...................
Q09KU0_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9DUH6_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLI.DTASAL..YREALESPEHC..SPSHTAL....RQAI.VCWGEVMSLASWVGNNLEDPASRERVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVSVYLVFFGVRIRTPLAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RGTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C4P109_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3TJC2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREPLESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q6J328_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
F4MJH0_HBV/31-81                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YRQALESPEHC..SPHH---....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3YGD6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPAVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1I9_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C1KT91_HBV/31-212               .............DIDRYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
Q91T00_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVCIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G9G8Y3_HBV/2-40                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DT----..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------vlhsgkq..............
D3J5L1_HBV/31-57                .............DIDTYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H2ER95_HBV/2-183                .............DIDPYKEFGASMELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGXNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z4V2_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q19SZ9_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSARDLL.DTASAL..YRESLESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDQASRDLIVSF.........................................VTAHMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWLRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D3YGJ0_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLDDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDVVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
C9WDI3_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J624_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------n....................
B5B4H5_HBV/2-183                .............DIDIYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQVI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B5B499_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGGETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D0U3X6_HBV/31-214               .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3K2_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VBK4_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5S7_HBV/31-57                .............DIDPYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P1S1_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
H2E6Z2_HBV/31-193               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........----------.................---------.....................
B4Z3V3_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D6P594_HBV/31-212               .............DLDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESRC.....................
D0EEJ6_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q68020_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E5D5P1_HBV/1-174                .............--------GATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C4P171_HBV/31-76                .............DIDLYKEFGATVELLSF.LPSNFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EEP3_HBV/31-214               .............DIDPYKEFGATVELLSF.LPADFFPNVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGGNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRP..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
B4Z1G0_HBV/2-40                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------cigk.................
D6P5A2_HBV/2-183                .............DIDPYKEFGASGELLSF.LPSDFFPNIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
B4YL35_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
B4Z2G8_HBV/31-66                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.HTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z5T1_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C4P1T0_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H9BMV0_HBV/25-191               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRS------.................---------.....................
B4Z4S5_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TUG1_HBV/2-183                .............DIDPYKEFGASXELLSF.LPSDFFPSXRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGGNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60GZ2_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D3J642_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQS-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------y....................
G9G962_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPISRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5W7_HBV/31-77                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALDL----..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------rynt.................
B5BPM4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGGNLEDPASRELVVGY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D3J6B0_HBV/31-70                .............DIDPYKEFGASMELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0D3A0_HBV/31-82                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHT--....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P1E5_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z2Y4_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B9W3Z4_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..QREALESHEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
I0DG53_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPNIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASREAVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
F4MJH9_HBV/31-81                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHH---....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EE66_HBV/2-185                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAI....RQVV.LCWGELMTLATWVGNNLQDQASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B9VKU2_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQEI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z4R0_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5M5_HBV/31-70                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G0XT53_HBV/31-193               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGXKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........----------.................---------.....................
C4P1Q5_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0S9_HBV/2-123                .............DIDPYKEFGASVQLLSF.LPSDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGVNLQDPASRDQVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRPTVVEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
B7TUE0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDXL.DTASAL..HREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G4XMF8_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESLEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZP70_HBV/2-29                 .............DIDPYKEFGASVELLSF.LPSBFFPXXRD--.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6V5R3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALXSPXHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................DSTYKGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C4P193_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G9G8Q8_HBV/31-93                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWG-------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------n....................
B4Z476_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q1MSV2_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
B3VBA1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSHVSQC.....................
Q2F513_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q1MSK9_HBV/31-173               .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
B6D6F0_HBV/2-113                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAX..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDQASRDLVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRE--------------------------....------------..-----------.-------.........----------.................---------.....................
H9BMV9_HBV/23-181               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRT----.........----------.................---------.....................
G1EIH2_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
Q60GU8_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
E0ZNE7_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
Q507F5_HBV/31-163               .............DIDPYKEFGASVELLSF.LPSDFFPSXGDLL.DTASAL..YREALESPKHC..TPHHTAL....RQAI.LCWGEXMNLATXVGSNLEDPASRELVVSY.........................................VNVNMGLKIXQLLWFHISCLTFGKXXVLEYLVSFGVWIRTPTAYRP-----....------------..-----------.-------.........----------.................---------.....................
B5LIK0_HBV/2-162                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRESVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPNAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPS--.........----------.................---------.....................
D2JMV2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPAIRDLL.DTASAL..YREALESPEHC..SHHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASREAIVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRG..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D6QVZ7_HBV/2-183                .............DIDTYKEFGASAELLSF.LPSDFFPNIRDLL.DTANAL..YREALESPEHC..TPHHTAL....RQAI.VCWGELMNLATWVGSNLEDQSSRDLVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRDSQC.....................
A8R7F9_HBV/31-117               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..HREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSF.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3YGE2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SHHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q1MSP5_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
B4Z2E5_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J6G3_HBV/31-70                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_HBVD3/2-183               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8V9T8_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4X6L8_HBV/31-86                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z2C1_HBV/31-66                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2L5E0_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7DMW5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAI....RQAI.ICWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPEITVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B4Z3Z7_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E5RPM2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8UYJ2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9WIK6_HBV/31-212               .............DIDPYKEIGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLAFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2V2_HBV/2-41                 .............DIDPYKEFGXTVELLSF.XPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z268_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D6P598_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGGNLDDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3XGI0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................GSQSRESQC.....................
B4Z5U5_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C6F5D1_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRK.................RSQSRESQC.....................
Q5G3A1_HBV/2-25                 .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z4U6_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q45F83_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFSPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RRAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPH.........RRRSQSPRRR.................RSQSRESQC.....................
Q68051_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLTTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7AYZ2_HBV/2-185                .............DIDXYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREXQC.....................
B4Z2I4_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E3Q0P7_HBV/2-183                .............DIDPYKEFGASEELLSF.LPSDFFQSIRDLL.DTASDR..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTRATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D5LDL4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQVI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P142_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0U3X7_HBV/2-185                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H6V879_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1EIG8_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
Q6UE45_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q7T445_HBV/31-212               .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q765D8_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VCD2_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z2F6_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSARDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q76B06_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVLSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.KRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VCA8_HBV/31-80                .............DIDPYKEFGASVELLSF.LPSDFFPSIPDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q5G3F7_HBV/2-25                 .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
I0DG51_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSXRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.XCWXELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXXYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G3XGU7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B3VBC6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTGSAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D9U5B0_HBV/111-175              ............r-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................-------------------------------VSFGVWIRTPPAYRPPNAPI....LSRPPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q0PMK8_HBV/31-107               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPGHC..SPHHTAL....RQAT.LCWGELMTLATWVGNNL------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------gl...................
B2CZG8_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWVRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
D3J5V7_HBV/31-89                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------k....................
D3TK08_HBV/2-89                 .............DIDPYKEFGASMELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------a....................
Q7TEE5_HBV/31-163               .............DIDPYKEFGASVELLSF.LPSDFLPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
Q19SX7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFYPSVRDLL.DTALAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRQ..RG-----RSPT.RRTPSPR.........RRRSQSPRRR.................RSKSQESHC.....................
Q45F23_HBV/2-183                .............DIGTYKEFGASVELLSF.LPSDFFPSIRDLL.DTAAAL..YREALESPEHC..SPHHTAL....RQAI.VCWGESMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B0FCB1_HBV/2-80                 .............DIGPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLED----------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------lt...................
Q9WIK3_HBV/31-212               .............DIDPYKEFGASVELLGF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8VBG0_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQCRESQC.....................
G1E8K4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D8VBQ8_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q45F18_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D7R740_HBV/2-76                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTF--------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------splpnhhl.............
Q2L5F7_HBV/2-24                 .............DIDPYKEFGASVELLSF.LPSDFF-------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B2Y6J3_HBV/2-185                .............DIDTYKEXGXTVELLSF.XPXDFFPSVRDXL.DTASAL..YXEXLEXXEHC..SPXHTAX....RQXF.VCWGELMXLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHIXXLTFGREXVLEYLVSFGVWIRTPPPXRPXXXPI....LSTLPETTVIRR..RD---RGRSPR.RRXPSPR.........RRRSQSXRRR.................RSQSRXSQC.....................
B2WSQ7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.HTASAL..NREALESPEHC..SPHHTAL....RQAI.LGWGELMNLATWVGRNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSSGRR.................RSQSRESQC.....................
H9BMV7_HBV/1-133                .............-----------------.-------------.----AL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRS------.................---------.....................
D8VBJ5_HBV/89-138               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E5D5P0_HBV/1-174                .............--------GATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALKSPEHC..SPHHTAL....KQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
D3TKC9_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3M7_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
I0DG50_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWXELMNLATWVGXNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVXIRTPPAYRPXXAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VC50_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1C899_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z339_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q7TEE1_HBV/31-163               .............DIDPYKEFGATVELLSV.LPSDFFPSIRDLL.DPASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
Q89719_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C0IMV4_HBV/2-185                .............DIDPYKEFGATVELLSF.LPXDFFPSVRDLL.DTASAL..YREALESPEHC..SSHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRDXVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRQ..RH---RGRSPR.GRTPSPR.........RXRSKSPRRR.................RSQSRESQC.....................
C4P1V4_HBV/31-76                .............DIDPYKEYGASVELLSF.LPSEFFPSIRDLL.DTASAL..YRDALKSPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P1H0_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8JSW3_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
D8VC55_HBV/31-80                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..HREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6I6W2_HBV/31-74                .............DIDPYKEFGATVELLSF.LPNDFFPTVRDLL.DTASAL..FREALES----..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------p....................
C1JZ00_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAIVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q80J84_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPHRR.................RSQSRESQC.....................
H6UGC9_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLIFGRQTVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RV-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q00K81_HBV/2-181                .............DIDPYKEFGASAQLLSF.LPSDFFPSVRDLL.DTATAL..YREALESPEHV..SPHHTAL....RQAI.LCWGDLMTLATWVGNNLEDPASRDLVVNY.........................................VNNTTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
Q9E0R7_HBV/2-123                .............DIDPYKEFGATVELLSF.LPNDFFPSVRDLL.DTAAAL..FRDALKSPDHC..TPHHTAL....RQAI.LCWGDLMTLATWVGVNLQDPASRDLVVNY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTDLEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
D8VCM4_HBV/1-148                .............-----------------.-------------.----AL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q6TYE8_HBV/31-182               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPDHTAL....RQAI.LCWRELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISWLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
B3VAR1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPTDFFPSVRDLL.DTASAL..FREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60GU5_HBV/31-71                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z2Q9_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8VBJ9_HBV/2-183                .............DIDPYKEFGASEELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D0EYW1_HBV/2-157                .............DIDPYKEFGASVELLSF.LPTDFFPSVRDLL.DTAAAL..YREALESPEHC..SAHHTAL....RQAI.LCWGELTTLGTWVGNNLQDPASRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSMLPETAVVRR..RG-----RSP-.-------.........----------.................---------r....................
Q6X5G4_HBV/1-130                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
D8VBZ0_HBV/2-50                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRYLL.HPPSSL..YREVLDSPEHC..TP-----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5ATB3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPAIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P0Y5_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q09KX0_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B2LRX4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSRDSQC.....................
Q60GV5_HBV/2-42                 .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTAAAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q991J7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B4Z2L6_HBV/31-70                .............DTDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EE91_HBV/31-214               .............DIDPYKEFGATVELLSF.LPADYYPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBZ3_HBV/2-51                 .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_HBVB2/2-183               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A0A877_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q910W2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSIRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H6UGN1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFYPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSRESQC.....................
C0LKE1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSSR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9WP95_HBV/101-193              ............v-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................-----GLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTIPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8QSC9_HBV/31-212               .............DIDPYKEFGASGELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAS.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5U6_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q60H31_HBV/31-71                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTSSAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z204_HBV/2-41                 .............DIDHYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G9I483_9HEPA/45-293             .............DANVSRALSNIYDL---.-PDDFFPKIDDLVrDAKDALepFWKTDSIKKHViiATHFVDLiedfWQTT.QGMNHVAEALVSLIPPTTVAVPQGYLTTHeeaeeipldglfnyqeeriasyqpdypvparihthlkvytkINEQALDRARRLLWWHYNCLVWGEANVTNYISRLRTWLSTPEKYRGKDAPT....IEAITRPIQVASgsRTKTQGTRKPR.GLEPRRRkvkttvvygRRRSKSRERS.................SS-------spqragspiprt.........
B4Z2T6_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z6A3_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EED7_HBV/31-214               .............DIDPYKEFGATVELLSF.LPHDFFPSVRDLL.DTAAAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7G2Z6_HBV/2-183                .............DIDPYKEFGASSELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
C4P1K9_HBV/31-76                .............DINPYKEFGASVELLSF.LPSDFFPSVRDLL.DTALTL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q45F66_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z5R7_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B0B367_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPL.........RRRSQSPRRR.................RSQSPASQC.....................
C4P161_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1ETU3_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAT.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................KSQSRESQC.....................
C4P1D4_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D7R741_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLVTWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7DY75_HBV/2-183                .............DIDHYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDQASRDLVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D4I4R3_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RXQSRESQC.....................
D4P3T3_HBV/14-194               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRESLESSDHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSASPASQ-.....................
B7TTJ9_HBV/31-212               .............DIDPYKEFGASAELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZN99_HBV/31-182               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---------.-------.........----------.................---------.....................
B4Z5S0_HBV/30-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q7THR4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAT.LCWGELMNLATWVGSNLDDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B4Z3D9_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D9U5K6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELIVSY.........................................VNVNMGLKIRQLLWSHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B5BPT0_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
E5RDA4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.KRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5R2_HBV/31-57                .............DIDPYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z5W4_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C4P147_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0P7_HBV/2-123                .............DIDPYKEFGASVELLSF.LPADFFPNVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGTNLEDQSSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLCFGREIVIEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
Q1PCY9_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8JSW8_HBV/1-130                .............----------------F.LRSDFFPSVRDLL.DAASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
Q68040_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGGNLEDPVSRDLVVGY.........................................VNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q80AH2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LWWGELMNLATWVGRSLDDPTSMELVVSY.........................................VNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1N8_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z2F5_HBV/31-66                .............DIDPYKEFGASVELLSF.LPSDFFPSARDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3YGS6_HBV/2-183                .............DIDPYKEFGATVELLSF.LPHDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMSLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPI....LSTLPETCVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2P8_HBV/2-41                 .............DIDPYKKFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0ZR99_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSPASQC.....................
C7AYA7_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPSSRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVIRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q8JSV7_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
H6V8A7_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5W0_HBV/31-73                .............DIDAYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREAL------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------dl...................
B4Z3H5_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q5EDT2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTAAAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETCVIRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSRSREPQC.....................
D0EZ15_HBV/2-183                .............DIDPYKEFGASVELLSF.LPADFFPSIRDLL.DTAAAL..FRDALESPEHC..SAHHTAI....RQAV.LCWGELIGLATWVGTNLEDQASRDLVVSY.........................................VNNNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRDSQC.....................
D5LBR6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASTL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z5T4_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DIASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z3A8_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P159_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B3VAY6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPQDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHLSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSREPQC.....................
D3YGA0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAF.LCWGELMNLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9IHC9_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q991J8_HBV/31-212               .............DIDPYKEFGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.QCWGEVMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z670_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D6R3X0_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPSHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPI....LSTLPETTVIRQ..RG-----RAPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B5B4L3_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RPQSRESQC.....................
Q67872_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLIFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D6QW31_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAX.LCWGELMNLATWVGSNLDDPASRELVVGY.........................................VNVNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q67894_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3GIM0_HBV/2-183                .............DIDPYKEFGASXELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESKC.....................
Q2F4Z8_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESSEHC..SPHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A9PLE2_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPESTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
Q5G3J4_HBV/31-54                .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5X7_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------k....................
C7AYV8_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGNNLDDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q9J1L7_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMNLASWVGNNLEDPASRELVVSY.........................................VNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPHRR.................RSQSPASQC.....................
B4YLK6_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5Z7_HBV/31-79                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPE--..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------tplt.................
G9G9C4_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRQALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B1NYC1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q507G5_HBV/31-163               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQVLWFHISCLTFGRETVLEXLVSFGVRIRTPXAYRP-----....------------..-----------.-------.........----------.................---------.....................
D0EDZ3_HBV/2-185                .............DIDPYKEFGATVELLSF.LPLDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q91EH4_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPPYRPPNAPI....LSTLPETTVIRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1P1_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q91A66_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFYPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q7TED7_HBV/31-163               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIHTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
CAPSD_HBVC2/2-183               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAT.LCWGELMNLATWVGSNLADPASRDLVVNY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
B4Z2M2_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8VBI3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPSSRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREYQC.....................
H6V8D1_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q917I3_HBV/2-183                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q80JA2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTAPAL..HREALESPEHC..SPHHTAL....RQAS.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNDNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A6MGB3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIPDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B6D6D2_HBV/2-67                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMN---------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q5R2P1_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGVNLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B5BPW1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G0YVM6_HBV/2-183                .............DIDPYKEFGAXVELLSF.LPTDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RX-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESXC.....................
Q60GZ1_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D6P595_HBV/2-183                .............DLDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESRC.....................
C0LKP9_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVIR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
F4MJH7_HBV/31-81                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHH---....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q910L4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTIATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z4P9_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G0Z307_HBV/2-121                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
H6UN83_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z4Q7_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q765F0_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........KRRSQSPRRR.................RSQSRESQC.....................
B4Z308_HBV/31-66                .............DIDPCKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G8H3F9_HBV/2-131                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
D3J5P2_HBV/31-57                .............DIDPYKEFGASVELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q1MST3_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWLHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
Q1MSL2_HBV/20-162               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
C7AYZ8_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVIRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESHC.....................
B4Z4K2_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5B4M9_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J6F1_HBV/31-70                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
O39876_HBV/1-165                .............-----------------.MPADFFPSVHDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAI.LCWGELMTLASWVGNNLQDPASRELVVNY.........................................VNTHMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSRSREPQC.....................
C4P1A7_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_WHV1/2-188                .............DIDPYKEFGSSYQLLNF.LPLDFFPDLNALV.DTATAL..YEEELTGREHC..SPHHTAI....RQAL.VCWDELTKLIAWMSSNITSEQVRTIIVNH.........................................VNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPI....LSTLPEHTVIRR..RGGARASRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPSANC.....................
H6V5T7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPXDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPXARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTIIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASRC.....................
C4P0Z3_HBV/31-76                .............DIDPYKEFEATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q4FDE4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLDDQXSRELVVSY.........................................VNVNMGLKVRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J626_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------k....................
D3J666_HBV/31-68                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TU16_HBV/31-212               .............DIDHYKEFGASVELLSF.LPFDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
Q7T7X5_HBV/31-212               .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPASREQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B5ATF9_HBV/2-80                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLED----------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------ft...................
Q99HT3_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVXH.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPI....LSTLPETAVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3TIJ8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRQ..RG-----RSTR.RRTPSPR.........RRRTQSPRRR.................RSKSRESQC.....................
Q7TEC4_HBV/31-163               .............DIDPYKEFGASVELLSF.LPSDFLPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWVRTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
C7DNL3_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFHSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
E3Q0P6_HBV/31-212               .............DIDPYKEFGASEELLSF.LPSDFFQSIRDLL.DTASDR..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTRATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A9PLH1_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPESTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
A7L354_HBV/2-161                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..HREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTP---.........----------.................---------.....................
Q60GW4_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z1V2_HBV/31-70                .............DIDPYKEXGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0S5_HBV/2-123                .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGANLEDPASRDLVVSY.........................................VNTHMGLKFRQLLWFHISCLTFGRDTVVKDLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
D8VB68_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TTX3_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLI.DTASAL..HREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z1M3_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B4Z257_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2L5G8_HBV/2-24                 .............DIDPYKEFGASVELLSF.LPSDFF-------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3G9_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
B2CSD2_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETAVVRP..RG-----RSLR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
A1KR49_HBV/2-25                 .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z5X3_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C1K1U1_HBV/31-120               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASCPYLIN-.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------tsgn.................
Q58VZ5_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G8Z911_HBV/2-139                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....------------..-----------.-------.........----------.................---------.....................
Q5G3H6_HBV/2-25                 .............DIDQYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C4P105_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q8AYY3_HBV/31-117               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVS-.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------m....................
D3GIK8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPSSRDLVVTY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRP..RG-----RSSR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A0FDK3_HBV/2-81                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPA--------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------f....................
Q2L590_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
HBEAG_HBVD5/31-212              .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTATAL..YRDALESPEHC..TPHHTAL....RHVC.LCWGDLMNLATWVGTNLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETTVVRQ..RG-----RTIR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZP56_HBV/2-110                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTAQAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGANLDDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTF-----------------------------....------------..-----------.-------.........----------.................---------.....................
D8VBN2_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E3Q0L3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSTRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAV.LCWGELMTLATWVGSNLEDPASRDLVVRY.........................................VNGNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2N7_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q60GX1_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
G1C8S1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGGNLEDPVSRDLVVGY.........................................VNTTVGLKFRQLLWFHISCLMFGRHTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPEATVIRG..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D3J608_HBV/31-88                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....SKAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
HBEAG_DHBV3/45-305              .............DINASRALANVYDL---.-PDDFFPKIDDLVrDAKDALepYWRSDSIKKHVliATHFVDLiedfWQTT.QGMHEIAEALRAVIPPTTTPVPQGYLIQHdeaeeiplgdlfkhqeerivsfqpdypitarihahlkayakINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTPERYRGRDAPT....IEAITRPIQVAQggRKTTSGTRKPR.GLEPRRRkvkttvvygRRRSKSRERRaptpqragsplprssssHHRSPSPRK.....................
Q6XGP2_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAQ..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3Z3_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q77N75_HBVF4/2-183              .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C1JYZ8_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
Q60H23_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
F5C1P8_HBV/2-183                .............DIDPYKEFGATVELLSF.LPTDFFPSVRDLL.DTASAL..YREALEPPEHW..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q7TED8_HBV/31-163               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLWWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRP-----....------------..-----------.-------.........----------.................---------.....................
D3TIL3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPTIRDLL.DTASAL..YRKALESPEHC..SPHHTAI....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTIVRQ..RG-----RSTR.RRTPSPR.........RRRTQSPRRR.................RSQSRESQC.....................
C4P0X2_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3Z5_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5N3_HBV/31-70                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6V8A9_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0ZP28_HBV/31-139               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTF-----------------------------....------------..-----------.-------.........----------.................---------.....................
B4X6I7_HBV/31-87                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHY..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4X6M0_HBV/31-86                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQ--.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2TJG2_HBV/2-131                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
C4P172_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D5MSF8_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q68048_HBV/2-183                .............DIDPYKEFGATVELLSF.LPTDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q4FD92_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWXELMNLATWVGSNLEDPASRELVVSY.........................................VNDNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RXPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
H9BMR6_HBV/2-168                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRS------.................---------.....................
B5B4A6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESR-w....................
Q5G3G5_HBV/31-54                .............DIDPYKEFGATVELLSF.LPSDFFP------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E5CZ06_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RKAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8QP39_HBV/1-132                .............-----------------.-------------.------..-----------..-----AL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPC.........RRRSQSPRRR.................RSQSRESQC.....................
B5M549_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELIVGY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESKC.....................
Q30BG8_HBV/31-113               .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASREL----.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q1MSN7_HBV/31-141               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGR---------------------------....------------..-----------.-------.........----------.................---------.....................
H2ERJ7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z289_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSFRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q2EGE5_HBV/31-99                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHW..SPHHTAL....RQAI.LCWGELMNLA-------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------t....................
Q80AH0_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGTNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPATTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z478_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5M5Q4_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRESVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREHQC.....................
Q6IT66_9HEPA/39-225             .............DIDPYKEFGSSYQLLNF.LPLDFFPDLNALV.DTATAL..YEEELTGREHC..SPHHTAI....RQAL.VCWDELTKLIAWMSSNITSEQVRTIIVNH.........................................VNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPI....LSTLPEHTVIRR..RGGARASRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPSANC.....................
G0Z2X8_HBV/2-121                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
G9G9U9_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHW..SPHHTAI....RQAI.LCWGXLMTLATWVGGNLEDXXSRDLVVSY.........................................VNXNXGLKFRQLLWFHISCLTFGXETVIEYLVXFGVWIRTPXAXRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPXRR.................RSXSRESQC.....................
B4Z463_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z5U3_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
D3J652_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B3VB82_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B3V3S0_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C7DN02_HBV/31-212               .............DIDPYKEFGATEELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q8JSV5_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
Q91SY2_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRGR.................RSQSRESQC.....................
C7DNE1_HBV/2-182                .............DLDPYKEFGATVELLSF.LPGDFFPSVRDLL.YTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDVMNLATWVGANLEDPVSRDLVVSY.........................................VNNNMGLKFRQLLWVHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRP..------SRSYR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C3W4E2_HBV/31-212               .............DIDPYKEFGATVELLSF.LPFDFFPSVRDFL.DSALAL..YRDSLEFPEPC..SPPHXAL....RPTL.FCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRG..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VBS8_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q91IP4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5T8_HBV/31-88                .............DIDPYKEFGASGELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------k....................
B6ULG7_HBV/31-90                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LC---------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VBR9_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q68RP4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRESVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5Q2_HBV/31-57                .............DIDHYKEFGASVELLSF.LPLDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VBK2_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0U5_HBV/31-152               .............DIDPYKEFGATVELLSF.LPSDFFPSVQDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPASRDLVVRY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
B2LSK8_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPI....LSTLPENTVVRP..RR-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
G1E8E6_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPHRR.................RSQSRESQC.....................
B4Z1L2_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q67903_HBV/2-166                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVSY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........----------.................---------.....................
D2JMZ7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPDHC..TPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLMWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETTXXXX..XX-----XSPR.RRXPSRR.........RRRSRSPRRR.................RSQSRESQC.....................
B9VK81_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAV....RQAI.VCWGELMNLATWVGSNLEDPASRELVVGY.........................................VKVNMGLKRGQKSWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z448_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0ZP21_HBV/31-139               .............DIDHYKEFGASVELLSF.LPLDFFPSVRDLL.ETASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELTTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTF-----------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z4P0_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTTSAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6V5Q1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDQASRDQVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.TRTPSPR.........RRRSKSPRRR.................RSQSREPQC.....................
B4ZYW7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLQDPTSRDLVVTY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G1EIH4_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
C7DSN0_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAF....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRDSQC.....................
Q1MSW3_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
D6P5A1_HBV/2-183                .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SHHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B5B4L2_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RPQSRESQC.....................
Q2L4J7_HBV/31-214               .............DIDPYKEFGATAELLSF.LPPDFFPSARDLL.DTASAL..FRDALESPEHC..SAHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQILWFHLSCIMFGRDIVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2L5F6_HBV/2-23                 .............DIDPYKEFGASVELLSF.LPSDF--------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B2MUE1_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
D3J6H1_HBV/31-69                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTAPA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------ppye.................
Q68010_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSAFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3G6_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
A9PLI0_HBV/1-39                 .............-----------------.-------------.------..-----------..-------....----.-----------------------------.........................................--------------------------------------------------I....LSTLPESTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQ------.....................
G1E7H7_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTALAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3TK80_HBV/31-212               .............DIDPYKEFGASAELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
Q1XHG6_HBV/31-214               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLQDPASRDQVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B6D6B2_HBV/31-211               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQ-.....................
H6UGP9_HBV/2-183                .............DLDPYKEFGASVELLSF.LPGDFFPSIRDLL.DTASAL..FRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGANLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D8VB80_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60H20_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C3W3R7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPNVRDLL.DTASAL..FRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGANLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETSVVRR..RG-----RSPR.RRTPSPR.........RRRXQSPRRR.................RSQSRESQC.....................
B0YK39_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAF....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
F1CFD4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESKC.....................
C3W4B1_HBV/2-183                .............DIDPYKEFGATVQLLSF.LPSDFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDLMSLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETCVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
B4Z1E9_HBV/2-40                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------cigk.................
B5TXV3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q1MSL0_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FRDALESPDHV..SSHHTAL....RQAI.LCWGDLMSLATWVGVNLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
B4Z303_HBV/31-66                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0ZP15_HBV/31-57                .............DIDPYKEFGATAELLSF.LPSDFFPSVR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q4FDI4_HBV/31-212               .............DIDPYKEFGAXVELLSF.LPSDFFPSXRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3E1_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q2L4I8_HBV/31-214               .............DIDPYKEFGATVELLSF.LPHDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQCV.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPI....LSILPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q91IP2_HBV/144-325              .............DIGPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C1KTA5_HBV/31-210               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
B0YK71_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPNIRDLL.DTANAL..YREALESPEHC..SAHHTAL....RQAI.VCWGELMNLATWVGGNLEDPGSRELVVGY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRQ..RG-----RTPR.RRTPSPR.........RRRSKSPRRK.................RSQSRDSQC.....................
D8VBA1_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6X5G0_HBV/1-130                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
D9U589_HBV/2-183                .............DIDTYKEFGASVELLSF.LPTDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDQASRELIVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D7R730_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESAEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2M8_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5V4_HBV/31-88                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAM.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7DM36_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAF....RQAI.LCWGDLMSLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B5TXM3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGESMNLATWAGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFRRETVLEYLVSFGVWIRTPHAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
A7L353_HBV/2-161                .............DIDPYKEFGASVELLPF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RC-----RSPR.RRTP---.........----------.................---------.....................
C3W499_HBV/2-183                .............DIDPYKEFGASVELLSF.LPQDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDPPSRDLVVSY.........................................VNTNVGLKFRQLLWFHLSCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B4Z1L6_HBV/2-42                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q8JXG8_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRFPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3D8_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
G3E5I3_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSVTDLL.DTASAL..YREALESPEHC..SPNHTAL....RQAI.LCWGELMSLASWVGNNLEDPASRELVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C7DMB6_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDVMNLATWVGVNLQDPASRDQVVGY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASKC.....................
Q917J4_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRHLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3X7_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D6QVQ2_HBV/2-183                .............DIDXYKEFGASVELLSF.LPXDFXPXVRDLL.DTASAL..YREALESPEHC..TPHHTXL....RQAI.VCWGELMNLATWVGGNLEDXXSRXXVVXY.........................................VNVNMGIKIRQLLWFHISCLXFGRETVLEYLVSFGVWIRTPXAYRPXNAPI....LSTLPETTVXRG..RR-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
Q45F50_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................KSQSRESQC.....................
A6MGA7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALEAPEHC..SPHHTAL....RQAL.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D6QVM0_HBV/2-183                .............DIDTYKEFGASVXLLSF.LPSDFFPSXXDLL.DTASAL..YREALESPEHY..TPHHTAL....RQAI.VCWGELMNLATWVGXNLEDPXSREAVVNY.........................................VNVNMGIKIRQLLWFHISCLTFGXXTVLEYLVSFGVWXRTPPAYRPQNAPI....LSTLPETTVXRQ..RG-----RSPR.RRTPSPR.........RRRSQSPRCR.................RSQSREPRC.....................
B4Z2W1_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C9W201_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYGPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q09KX3_HBV/2-20                 .............DIDPYKEFGATVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
E0ZNW5_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z4J2_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z1K6_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q5Q0Z3_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B0B352_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALKSPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPI....LSTLPENTVVRR..RG-----RPPR.GRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
Q09KV7_HBV/2-20                 .............DIDPYKEFGATVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6I6Q6_HBV/31-74                .............DIDPYKEFGATGELLSF.LPSDFFPSVRDLL.DTASAL..YREALES----..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------p....................
B4Z2T1_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3TIG0_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
C7DSN7_HBV/31-201               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHNAL....RQAI.LCWGELMTLATWVGINLEDPASR------.........................................-----GLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRDSQC.....................
Q2TJE4_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C1KTA1_HBV/31-210               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
Q8QP27_HBV/1-130                .............-----------------.-------------.------..-----------..-----AL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z5V3_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRE--------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------p....................
B4Z2W3_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVGDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B0FCQ7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPAPRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J5V1_HBV/31-87                .............DIDPYKEFGASAELLSF.LPSDFFPSVRDLI.HTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B7TU94_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESHC.....................
B4Z3S7_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q80GW7_HBV/2-86                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRGF----.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------gv...................
Q1MSQ6_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
G0Z308_HBV/2-121                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVTEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
C7DSN8_HBV/2-172                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTAAAL..YRDALESPEHC..SPHHNAL....RQAI.LCWGELMTLATWVGINLEDPASR------.........................................-----GLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRDSQC.....................
Q80H39_HBV/2-183                .............DIDPYKEFGASLELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q2TJD8_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z3G3_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q9QRR2_HBV/2-64                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWG-------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------s....................
Q6RSF8_9HEPA/2-262              .............DINASRALANVYDL---.-PDDFFPKIDDLVrDAKDALepYWKSDSIKKHVliATHFVDLiedfWQTT.QGMHEIAEALRTVIPPTTVPVPQGYLIQHeeaeeiplgdlfkhqeerivsfqpdypitarihahlkayakINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTPEKYRGRDAPT....IEAITRPIQVAKggRKTTQGTGKPR.GLEPRRRkvkttvvygRRRSKSRERRaptpqragsplprssssHHRSPSPRK.....................
Q89247_9HEPA/2-188              .............DIDPYKEFGSSYQLLNF.LPLDFFPDLNALV.DTATAL..YEEELTGREHC..SPHHTAI....RQAL.VCWDELTKLIAWMSSNITSEQVRTIIVNH.........................................VNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPI....LSTLPEHTVIRR..RGGARASRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPSTNC.....................
B4Z3D3_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q09KY8_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C7DM64_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
C4P1H2_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D8VC73_HBV/2-51                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D3J5X1_HBV/31-79                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPD--..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------tfpp.................
Q9QB20_HBV/2-183                .............DIDPYKEFGASVELLSY.LTSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRPQSPRRR.................RSKSRESQC.....................
Q1MSJ9_HBV/31-173               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLXSFGXGXXTPPXYRPPNAPI....LSTLP-------..-----------.-------.........----------.................---------.....................
D0EEL6_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETTVVRC..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
F5C093_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELVNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2L1_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3T1_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0N7_HBV/31-152               .............DIDPYKEFGATTELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDQTSRDLVVSY.........................................VNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
Q80J99_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........KRRSQSPRRI.................RSQSRESQC.....................
E5KUG1_9HEPA/45-305             .............DINASRALANVYDL---.-PDDFFPKIDDLVrDAKDALepYWKSDSIKKHVliATHFVDLiedfWQTT.QGMHEIAESLRAVIPPTTTPVPPGYLIQHeeaeeiplgdlfkhqeerivsfqpdypitarihahlkayakINEESLDRARRLLWWHYNCLLWGEAQVTNYISRLRTWLSTPEKYRGRDAPT....IEAITRPIHVAQggRKTTTGTRKPR.GLEPRRRkvkttvvygRRRSKSRERRaptpqragsplprssssHHRSPSPRK.....................
Q9E0Q7_HBV/2-123                .............DLDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..FREALKSPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLQDPTSRDLVVNY.........................................VNNTAGLKFRQLLWFHISCLTFGREVVLKYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
G1EIJ8_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYTPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
B4Z3U0_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D0EEC4_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGDVMSLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..QH---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q8QSA7_HBV/31-212               .............DIDPYIEFRASGELLSF.LPSDFFPSIRDLL.DTASAL..YREALQSPEHC..SPHHTAL....RQDI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D8VCF5_HBV/2-36                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASA-..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
G1C8M3_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHV..SAHHTAL....RQAI.LCWGELMTLATWVGGNLDDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRGSQC.....................
B5BPS6_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTAAAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPAAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
F1AEV8_HBV/14-195               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRESLESSEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSASPASQC.....................
Q3LTX1_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVQDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VTTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P1P2_HBV/31-76                .............DIDPYKEFGASVELLSF.LPSDFFPSVQDLL.DTASAL..YRDALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z372_HBV/2-37                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6I6W6_HBV/31-74                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALES----..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------p....................
C0LKK8_HBV/2-183                ............g-IDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........GRRSQSPRRR.................RSQSRESQC.....................
I0DG30_HBV/31-212               .............DIDXYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESQEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELXVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPXAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D8V9V1_HBV/31-80                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.HTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
F2WS99_HBV/31-212               ............a-IDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMTLATWVGSNLEDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z2J5_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
I0DG79_HBV/31-212               .............DIDPYKEFGASXELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPXAPI....LSTLPETTVVRR..RX-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESXC.....................
B4Z638_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q6J323_HBV/31-214               .............DIDPYKEFGATVELLSF.LPSDFFPSVLDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWVELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G0Z2Y8_HBV/2-121                .............DIDPYKEFGASVELLSF.LPHDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMNLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
D3J663_HBV/31-79                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPKHV..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------ff...................
D8VCF8_HBV/2-37                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3W6_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3R0_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
CAPSD_HPBDB/2-262               .............DINASRALANVYDL---.-PDDFFPKIDDLVrDAKDALepYWKSDSIKKHVliATHFVDLiedfWQTT.QGMHEIAESLRAVIPPTTAPVPTGYLIQHeeaeeiplgdlfkhqeerivsfqpdypitarihahlkayakINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTPEKYRGRDAPT....IEAITRPIQVAQggRKTSSGTRKPR.GLEPRRRkvkttvvygRRRSKSRDRRapspqragsplprssssHHRSPSPRK.....................
D2JMW5_HBV/2-183                .............DIDPYKEFGASVELLSF.LPTDFFPNIRDLL.DTASAL..FREALESPEHC..SHHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E0ZND8_HBV/31-182               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
G1C979_HBV/2-183                .............DIDPYKEFGASVELLSF.LPTDFYPSVRDLL.DTASAL..YREALESPEHC..SAHHTAL....RQAI.LCWGDLMNLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D3J5R7_HBV/31-57                .............DIDPYKEFGASGELLSF.LPSDFFPSIR---.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q9E0W5_HBV/2-123                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGANLEDQASRDLVVSY.........................................VNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFG----------------....------------..-----------.-------.........----------.................---------.....................
D3J5Z3_HBV/31-79                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPD--..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------tlhn.................
E5RN28_HBV/1-162                .............----YKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAV.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRR-------.................---------.....................
Q8QSD3_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASVL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P123_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRTLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4X6L6_HBV/31-87                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQA-.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
H6V883_HBV/31-56                .............DIDPYKEFGATVELLSF.LPSDFFPSV----.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
D2JMD4_HBV/31-212               .............DIDRYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D3J660_HBV/31-79                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHA..SP-----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B0FCS7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDFL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGVLMNLATWVGSNLENPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q80JB0_HBV/2-79                 .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLED----------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
HBEAG_HHBV/45-305               .............DVNASRALANVYDL---.-PDDFFPQIDDLVrDAKDALepYWKAETIKKHVliATHFVDLiedfWQTT.QGMSQIADALRAVIPPTTVPVPEGFLITHseaeeiplndlfsnqeerivnfqpdypitarihthlrvytkLNEQALDKARRLLWWHYNCLLWGEATVTNYISRLRTWLSTPEKYRGKDAPT....IEAITRPIQVAQggRNQTKGTRKPR.GLEPRRRkvkttvvygRRRSKSRGRRsspsqragsplprnrgnQTRSPSPR-e....................
B0YK45_HBV/2-183                .............DIDPYKEFGASVQLLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..TPHHTAL....RQTI.LCWGELVNLATWVGSNLDDPASRELVVGY.........................................VNGNMGLKIRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSILPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSKSRESQC.....................
D8VBS4_HBV/31-212               .............DIDPYKEFGASVGLLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETAVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q3LTZ6_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVQDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVFSY.........................................VNTNMGLKFRQLLWLHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPC.........RRRSQSPRRR.................RSQSRESQC.....................
A9CM32_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..TSHHTAL....RQAI.LCWGELMTLATWVGNNLQDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCICFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RV-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60GY9_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
Q9QMJ4_HBV/31-212               .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESKC.....................
B4Z4S9_HBV/2-41                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q80GX1_HBV/31-210               .............DIDPYKEFGASVELLSF.LPADFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.QCWGEVMNLATWVGGNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RC-----RSPR.RGTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
Q6I6U6_HBV/31-71                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
E0ZP45_HBV/2-110                .............DIDPYKEFGATVELLSF.LPTDFFPSVRDLL.DTASXL..YREALKSPEHC..SHHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTXMGLKFRQLLWFHISCLTF-----------------------------....------------..-----------.-------.........----------.................---------.....................
G1E8F2_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTAAAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RTPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E3Q0I1_HBV/2-183                .............DIDPYKEFGASVELISF.LPSDFFPTIRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQII.LCWGELMNLATWVGSNLDDPASRDLVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RTQSRESQC.....................
G1EIH7_HBV/2-153                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG---------.-------.........----------.................---------.....................
F5C1C3_HBV/2-173                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.L----------WVGVNLEDPASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPI....LSTLPETCVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
F5C1S6_HBV/29-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRESLESPEHC..SPHHTAL....RQDI.LCWGELMTLATWVGTNLEDPASRDLVVNY.........................................VNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPQTTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q917I1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGANLDDPASRDLVVSY.........................................VNNNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
I0DG82_HBV/31-212               .............DIDPYKEFGASXELLSF.LPSDFFPSIRDLL.DTASAL..XREALESPEHC..SPHHTAL....RQAI.LCWXELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXXAPI....LSTLPETTVVRR..RX-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G8H3F7_HBV/2-131                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPNHTAL....RQAI.LCWGELMTLASWVGNNLEDPAARDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA--------....------------..-----------.-------.........----------.................---------.....................
B3VAY2_HBV/2-183                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
CAPSD_HBVB3/2-183               .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q8JSW2_HBV/1-130                .............----------------F.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETT----..-----------.-------.........----------.................---------.....................
G0Z2W8_HBV/2-121                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPISRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVS------------------....------------..-----------.-------.........----------.................---------.....................
C7AYW4_HBV/2-185                .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPQNAPI....LSTLPETTVVRR..GD---RGRSLR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
C3W3Z0_HBV/2-183                .............DIDPYKEFGASVELLSF.LPHDFFPSVRDLL.DTATAL..FRDALESPEHC..SPHHTAL....RQAI.LCWGDVMNIATWVGVNLQDQASRDQVVNY.........................................VNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
C7DN74_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFHSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRELLVSY.........................................VNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPENTVVRR..RG-----RSPR.RRTPSPR.........QRRSQSPRRR.................RSQSPASQC.....................
H6UG98_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RV-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
G1C8F4_HBV/2-183                .............DIDPYKEFGASVELLSF.LPADFFPSVRDLL.DTATAL..FRQDLESPEHV..SAHHTAL....RQAI.LCWGELMNLATWVGGNLDDPTSRDQVVSY.........................................VNTNMGLKFRQLLWFHISCISFGRTTVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RV-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B4Z400_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C9WD99_HBV/31-212               .............DIDPYKEFGATVELLSF.LPADFFPSVRDLL.DTASAL..FRDALESPEHC..SPHHTAL....RQAC.LCWGELMTLATWVGANLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESHC.....................
Q2VAD4_9HEPA/45-305             .............DINASRALANVYDL---.-PDDFFPKIDDLVrDAKDALepYWKSDSIKKRVliATHFVDLiedfWQTT.QGMHEIAESLRAVIPPTTAPVPTGYLIQHeeaeeiplgdlfkhqeerivssqpdypitarihahlkayakINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTPEKYRGRDAPT....IEAITRPIQVAQggRKTSSGTRKPR.GLEPRRRkvkttvvygRRRSKSRDRRapspqragsplprssssHPRSPSPR-k....................
Q2PWX7_HBV/2-185                .............DIDTYKEFGATVELLSF.LPPDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RLAI.VCWGELMNLATWVGNNWQDPASRDVVVNY.........................................VNTNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRSPPAYRPPNAPI....LSTLPETTVIRR..RD---RGRSPR.RRTPSPR.........RRRFQSPRHR.................RSRSRGSQC.....................
C1KTC3_HBV/31-210               .............DIDRYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLITLSTWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRES--.....................
D3J6D1_HBV/31-70                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z3W2_HBV/31-68                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q5U7L1_HBV/2-134                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGVNLEDPASRDLVVSY.........................................VNTNMGLKVRQLLGFHISWLTFGRETGIEYLRAFGMWIRTPPGYRP-----....------------..-----------.-------.........----------.................---------.....................
G1C8Y4_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
C4P0Y2_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
C3W4D6_HBV/2-185                .............DIDPYKEFGATVELLSF.LPRDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQII.LCWGDVMTLATWVGTNLZDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
B4Z1U6_HBV/31-80                .............DIDPYKEFGATVELLSF.LPPDFFPSVRDLL.DTASAL..YREALESPEHC..SPH----....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B8PTD6_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDVL.DTASAL..YREALESPEHC..SPNHTAF....RQAV.LCWGELMTLASWVGNNLEDPASRELVVNY.........................................VNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPASQC.....................
B7TV52_HBV/2-183                .............DIDTYKEFGASVELLSF.LPSDFFPSIRDLL.DTATAL..YREALESPEHC..SPHHTAL....RQAI.VCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESRC.....................
D0EZ03_HBV/2-183                .............DIDPYKEFGASVELLSF.LPQDFFPSVRDLL.DTAAAL..YRNALESPEHC..SPHHTAI....RQAI.LCWGELMXLATWVGANLEDQASRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q6XEA1_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSEFYPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGANLEDPASRDLVVSY.........................................VNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTLSPR.........RRRSQSPRRR.................RSKSRESQC.....................
Q60GU6_HBV/31-71                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
C3W475_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..FREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPXNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
Q8JJN8_HBV/33-70                .............DIDPYKEFGASVELLSF.LPSDFFPAIRDLL.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------rhrlcyvs.............
HBEAG_WHV5/32-218               .............DIDPYKEFGSSYQLLNF.LPLDFFPDLNALV.DTATAL..YEEELTGREHC..SPHHTAI....RQAL.VCWDELTKLIAWMSSNITSEQVRTIIVNH.........................................VNDTWGLKVRQSLWFHLSCLTFGQHTVQEFLVSFGVWIRTPAPYRPPNAPI....LSTLPEHTVIRR..RGGARASRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSPSANC.....................
Q2L5A1_HBV/2-20                 .............DIDPYKEFGASVELLSF.LP-----------.------..-----------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B4Z237_HBV/31-70                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..FREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
B5LXZ7_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YRDALESPEHC..TPHHTAL....RQAI.LCWGELMTLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHVSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
G1E7Q7_HBV/31-212               .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAI....RQAV.LCWGELMSLATWVGGNLEDPTSRDLVVSY.........................................VNTNMGLKFRQLLWFHISCLTFGRQTVLEYLISFGVWMRTPPAYRPPNAPI....LSTLPETSVIRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
B7TTA2_HBV/2-183                .............DIDAYKEFGASVELLSF.LPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
Q60GW7_HBV/31-71                .............DIDTYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREA-------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------l....................
F1CFD5_HBV/2-183                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGGNLEDPVSRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESKC.....................
B4Z464_HBV/2-39                 .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YR---------..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q77BG9_HBV/1-96                 .............-----------------.-------------.------..-----------..-------....----.----------------------------Y.........................................VNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPI....LSTIPETCVIRR..RG-----RSPR.RRTPSPR.........RRRSKSPRRR.................RSQSRESQC.....................
C4P1E0_HBV/31-76                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEH-..-------....----.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------.....................
Q67995_HBV/2-181                .............DIDPYKEFGASVELLSF.LPSDFFPSVRDLL.DTATAL..YREAL-SPEHC..SPHHTAL....RQAI.ICWAELMTLATWVGGNLEDPTSRDLVVGY.........................................VNSNMGLKFRQLLWFHISC-TFGRETVIEYLVSFGVWIRTPPPYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
D4QGI6_HBV/31-212               .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGDLMTLATWVGVNLEDPASRDLVVSY.........................................VNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRSPQAYRPPNAPI....LSTLLETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
D6P5A3_HBV/2-183                .............DIDPYKEFGASVELLSF.LPSDFFPSIRDLL.DTAAAL..YREALESPEHC..TPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVGY.........................................VNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPI....LSTLPETTVVRR..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSRSRESQC.....................
D3J636_HBV/31-89                .............DIDTYKEFGASVELLSF.LPTDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RKAI.-----------------------------.........................................---------------------------------------------------....------------..-----------.-------.........----------.................---------d....................
C7AYY0_HBV/2-185                .............DIDXYKEFGASVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHX..SPHHTAL....RQAI.LCWGELTTLXTWVGNNLQDPASRDQVVBY.........................................VNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRXPNAPI....LSTLPETTVVRR..RX---RGRSPR.RRTPSPR.........RRRSQSPRRR.................RSQSREPQC.....................
O42034_HBV/2-183                .............DIDPYKEFGASVELLSF.MPSDFFPSIRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMNLATWVGSNLEDPASRELVVSY.........................................VNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRC..RG-----RSPR.RRTPSPR.........RRRSQSPRRR.................RSQSRESQC.....................
E9L2M5_HBV/2-185                .............DIDPYKEFGATVELLSF.LPSDFFPSVRDLL.DTASAL..YREALESPEHC..SPHHTAL....RQAI.LCWGELMTLATWVGNNLEDPASRDLVVNY.........................................VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPI....LSTLPETTVVRR..RD---RGRSPR.RRTPSPR.........GRRSQSPRRR.................RSQSRESQC.....................
C4P1P3_HBV/31-76                ...